2B0OE

Crystal structure of uplc1 gap domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
264
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of GAP and ankyrin domains of UPLC1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords UPLC1
total genus 82
structure length 264
sequence length 265
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2b0oE02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2b0oE01
5AN8A 4J8YA 4HQDA 1AWCB 2FO1E 2Y1LE 4G8KA 4U95D 3TWSA 3TWTA 4DX7D 4HBDA 3IXEA 1IKND 3D9HA 5AQ9A 5CECB 4ZHBA 2BKGA 4QFVA 3ZUVB 4ZFHA 4F1PA 2JABA 2F37A 5CERB 2XZTG 4LNUD 4GPMA 4HRMB 3ZKJA 4U8YD 5ENTD 4BESA 4CYMD 2ETAA 3UI2A 5ENSD 2QC9A 2QYJA 2V5QC 3TWQA 5CEDB 4HNAD 1K1BA 1WDYA 4HI8A 1BU9A 3AAAC 5ENOD 3TWXA 1OY3D 2VGEA 4U8VD 5AQAA 3SO8A 2DZNA 2CRWA 2P57A 3EU9A 2Y0BG 3LVQE 3F6QA 2KBXA 2XZDG 3ZNGA 2RFAA 1MYOA 4DRXE 3UXGA 1MX6A 4Z68A 4K5BA 3TWRA 1TR4A 1G3NB 2L6BA 1N0RA 3JUEA 3FM8C 4YDWA 5AQBA 1BI7B 3B7BA 2ZGDA 4HRNA 2DWZA 4U96D 4ATZD 2V4HC 4O1OA 5ENQD 2F8XK 3HRAA 5FIOA 4BSZB 5KBAA 3LJUX 5CBOA 4N5QA 5HS0A 4DUIA 5JMND 4OAUC 4F6RD 2AJAA 4LG6A 3AJIA 2CRRA 2ETCA 5ENPD 1SW6A 5HRYA 1K3ZD 3LJNA 5KNGA 4BETA 2DZOA 3TWVA 3W9FA 5EYLA 4GMRA 3DEPA 2F8YA 2P2CP 4TUMA 3T9KA 5ITZF 3DWDA 2ZGGA 1BI8B 4A63B 3NBNB 4G8LA 4DX2A 2OWAA 3O47A 1MJ0A 3UTMA 1MX2A 1YYHA 3V31A 1SVXA 5D66A 4BERA 5FINA 4JB8P 2IQJA 5JA4D 1UOHA 2XENA 5AQ7A 4HLLA 5KWDA 4K5CA 3MDBC 1QYMA 1NFIE 3Q9UC 1S70B 3TWWA 3C5RA 5BXOA 1N11A 2B0OE 4C48B 1BLXB 4YDYA 2NYJA 3LVRE 4O60A 5AAOA 2XEHA 4DX1A 5CBNA 2XEEA 4OAVB 2MYOA 4BEPA 3FEHA 2ETBA 4K5AB 4O1PA 5ENRD 3V2XA 3V79K 3SUBA 1IXVA 5EIDA 1BD8A 4NIKA 5BXUA 3HG0D 1YCSB 4DX6D 5CEAA 1WG0A 3KEAA 4UUCA 1A5EA 5HKPA 3J5QB 3V30A 5EYPF 2A5EA 3T8KA 5EILA 1D9SA 1DC2A 2HE0A 4DX5D 1IHBA 3B95A 1MX4A 2J8SD 3JXJA 5AARA 1YMPA 5EIBE 4HI9A 2BKKB 3EHQA 4QQIA 3W9GA 4J7WA 1N0QA 3J5PA 3JXIA 3ZU7B 4B93B 1K1AA 1OT8A 3NOCD 3EHRA 4HB5A 3TWUA 4RLYA 2RFMA 1DCQA 5EN5D 3Q9NC 4LSZE 2PNNA 1AP7A 3V2OA 3DEOA 2KXPC 3NOGD 2DVWA 4CZ2D 5KNHD 4HRLA
chains in the Genus database with same CATH superfamily
2CSZA 1HU3A 1MQSA 2WXGA 2BF0X 3U5PA 5AIUA 3Q5MA 4ZQLA 2V4LA 1MBMA 4QF3A 4HOUA 2OEVA 2G6QA 3EDTB 2Y0BG 5DINA 2XPZA 1TR4A 5SVXA 2D8SA 4I9CA 1BI7B 4WZ0A 3O4ZA 5EX0A 2KIZA 4H9DA 2XOZA 3U9WA 5KJMA 4BWRA 3AG2E 2XCCA 2DZOA 2X6HA 2BUGA 5KH7A 5CCMA 3UTMA 2GROB 1N4SA 1E8YA 3DDTA 2VPGA 3KSQA 2ECNA 4O6FA 1FP0A 3LY7A 5FJYA 1HE8A 4BX9A 2AXUA 2WXJA 3C3RA 4EZLA 3L1ZB 1N4QA 1Z2QA 1BPOA 2OXQC 3C6WA 3CVPA 3RIBA 4K5AB 3SUBA 4GPKA 3ZTGA 2VNFA 3PURA 4L1BA 1WG0A 4URKA 3M99A 2XOCA 4DX5D 5EDSA 3CK7A 2A5UA 3QAQA 2WXNA 3UM1A 2GW1A 4B93B 4LNGA 2LSUA 4YNDA 4OVUA 5EN5D 2XS1A 5LP0A 1SZAA 4X8QA 1WEEA 2X3MA 2EIJE 1TEZA 3ABKE 4GB0A 3D9HA 3MV2B 2KE1A 4ZHBA 1E96B 2EIME 3VTYA 2IDAA 3ZGQA 3ZFWA 4YAXA 2PNXA 5ENTD 4GYOA 2F42A 3CVLA 2CKLB 4E6HA 1NA3A 2KC7A 5HQ8A 1JCQA 3HDXA 1FVFA 4I2ZA 2RG8A 4GNDA 3JQ0A 2BEDA 2HR2A 3KSLA 4A1GA 3FANA 4I6EA 4LERA 3UIPC 3P1UA 5B1BE 4JPSA 4HRNA 1H6OA 4ILHB 1F62A 3DRAA 4I6GA 1LD8A 4FK5A 3LJUX 1WGMA 4AP2A 3IBEA 1U6GB 4IC3A 3AJIA 4AEZC 2VTBB 2R02A 2QJ0A 5SVIB 3T5XA 3PZDA 2OEWA 1FT1A 2Y69E 5I3LA 3CVWA 4I9EA 3PREA 2KYUA 2VJFB 1QZ2A 4A55A 3PE4A 5KJLA 3CVNA 2QIZA 3QKYA 2RKKA 3ASFA 2YQ8A 3D9OA 3MHHA 3ZVYA 2ETBA 4OGCA 4JZYA 4F52B 3ONKA 3S7FA 4NIKA 3RSEG 5G05C 4CRWA 4UUCA 4KZCA 2WXFA 1IHBA 2E61A 2WM9A 3ZVZB 4X3GA 4D10C 2FUUA 3ESLA 3CHMA 1MHQA 2J4DA 3E32A 4LEUA 3L16A 1NP7A 1EDUA 3URZA 3FWVA 3RK6A 3TG4A 1GW6A 2WQ7A 4ZFHA 4ILIA 4BT9A 5CERB 2EQXA 2XZTG 1ZBDB 2CT2A 4RG6A 4G25A 4UQYA 4CA1A 3CHQA 1SQMA 2DYSE 4CDMA 2OCCE 3DSUA 4WNEA 2E6RA 4E85A 4JW1A 4HI8A 1IYGA 5D0OD 4U0ZA 3EU9A 2KATA 4UWKA 4CGVA 3UXGA 2I1KA 4YDWA 1JM7A 2K17A 4JHJA 4L23A 5FIOA 1FCHA 5CBOA 2CFUA 4HOSA 3SFXA 3UX4A 1O1TA 2XGOA 1QBQA 3UUXA 2XPYA 3FAOA 4L2LA 3T8MA 5FQ7A 4ACKA 1MJ0A 2ONDA 2DIWA 4HLEA 3AS8A 3RAUA 1V54E 4NQ0A 4YADA 5AJDA 2VGXA 2IEJA 1Z60A 2NYJA 1JUQA 1RZ4A 3MGBA 4UWGA 2DSMA 1LD7A 4Q69A 2NXPA 1TNYA 5H7PA 2CSYA 4PDXA 2ZISA 4FULA 4J0UA 3J5QB 3V30A 4QQ4A 4A3VA 4UWLA 4PS8A 2EODA 4J8FA 2QFCA 5EIBE 3M63A 5H1UA 4Q6FA 4EQFA 4HB5A 3PNLB 3TWUA 4TXPA 1JCRA 2F0YA 1INZA 4K0RA 2KZTB 3RJVA 3UT4A 3LDZA 4J8YA 4CEMA 3TWTA 2HM8A 2L0TB 3ZIMA 4PS7A 2V0PA 2BKGA 4I1OB 5KCMA 3KD7A 5G05B 2LXLA 3Q1DA 4N3CA 5LOZA 3CSTA 2QYJA 1H2TC 3FTYA 4U8HA 4V3KC 4RSYA 3G2SA 4M7CA 5BPPA 3MJWA 5TABA 3R9AB 3TWRA 1RW2A 3FM8C 4AP4A 3B7BA 4ZDTA 3Q73A 4U07A 1N4RA 3FUEA 3UIOC 4O1OA 4GTTA 4H7YA 4FC8A 4UI9J 2GRQB 2AJAA 2XCBA 4UI9C 4G11A 2QZAA 4YDOA 4I6JA 5D1LB 2F8YA 1UN8A 3S7BA 2UZGA 5B8DA 3NBNB 4DX2A 4GZ5A 4APOA 2GRMA 3FTWA 4ABNA 1E4UA 5G0FA 4W9RA 2R59A 1JWFA 4B8AA 4AOFA 3Q49B 3M7KA 2DJAA 4EHMA 2ECVA 2B0OE 5B3SE 2XEHA 3O35A 2XEEA 5AENA 5G04B 3AG3E 4O1PA 1SZ9A 3V79K 5ARGA 4Z0RA 5BV1A 2CG2A 3HG0D 3SFYA 2UY1A 1X4JA 2KWOA 4XKCA 5EILA 4NRHB 5G04J 4F1SA 5H1VA 3ISMC 2YW8A 5J3XA 3UQ3A 2XP0A 5BT1A 4GTVA 2E2EA 3FUDA 5AIJA 5CMYA 1KZOA 3I3NA 3PEUB 4EZJA 3R9MA 3FULA 3CVUA 3FTUA 3FUFA 5EYAF 5KNHD 1WENA 4B86C 2Y1LE 3I4RB 3FFLA 4DX7D 3D9NA 4O64A 2L9BA 3APFA 5FTPA 4DJAA 2MT5A 1WY6A 2KCVA 2LQ6A 1S0PA 1PC2A 5KH9A 2XQ0A 3PNTB 3TGOA 1BU9A 3ZXPA 4IRUA 4U8VD 4GZDA 5AQAA 2CRWA 2IOLA 3CSFA 3FU6A 1DVPA 2XZDG 2RFAA 1UJKA 4K5BA 1WEUA 1N87A 1L5JA 3D9MA 4GYWA 5H9MA 2ZGDA 3PEVB 2VJ8A 2C0MA 4G23A 5BNWA 3CGHA 3ABLE 3HRAA 5TDRA 1OCCE 2KGIA 1K3ZD 3L13A 4V3LC 1Q2ZA 5LCWJ 2XOYA 1QNFA 5FINA 3EHNA 2HYZA 4R8PK 3FUNA 1QYMA 4B94A 1U3CA 4GA0A 2CKLA 1XNFA 2AXZA 5EIDA 2MNYA 3S7DA 4MSXA 5FERA 3LYAA 3RRUA 5HKPA 1WEOA 2BAYA 3FDHA 3UT7A 1TN6A 1ELWA 3QDNA 1VDYA 4J7WA 3OTNA 4LUNU 4Q94A 2X6FA 2VJEB 5C1DA 2LAHA 1G25A 2FFWA 4PS3A 2JMIA 2RFMA 4KYOB 3RO3A 3JUIA 1OXJA 1AWCB 2VJFA 4XIFA 3DPDA 1ZBPA 4UI9B 4MS6A 4EZKA 2JABA 4XZ4A 3N9MA 1JOCA 4IULA 1LF8A 4N39A 4FJYA 5ENSD 1Z3YA 2CFZA 3B13A 2ZU6B 2M1RA 5J08A 4NURA 3SD5A 2QICA 3IKOB 3SGHA 3F6QA 3LS8A 4MRUA 4BTBA 2LXHC 4LJNA 3IEGA 3DQVR 3Q79A 1NL4A 5HS0A 5G2NA 1LDJB 4BFRA 2OOEA 2YYRA 1OCZE 2H6HA 4BETA 5EYLA 2R5SA 3DEPA 3CEQA 3DWDA 2VSYA 1X81A 4OVVA 4G8LA 3LQHA 1MX2A 2PM7A 2F6JA 3WXXA 1U3DA 4GZ6A 4BERA 2MNZA 1UOHA 3MDBC 1H2UA 3ML9A 5TDWA 5JJ7A 4ZUXU 2A4ZA 3NZUA 4AVXA 4C48B 1BLXB 1Z6UA 1FPPA 3U3WA 3KV6A 4LKAA 3FH8A 2DX8A 4G24A 3V2XA 3DBSA 3CHRA 5CEAA 5B76A 4GA1A 3NZSA 1JM7B 2WXIA 1DC2A 2HE0A 2P9PG 5AYWD 4RQIA 2VSNA 2WVIA 3BUAA 3O7AA 3MZLB 4IN3B 5LX8A 4I17A 2LGGA 1H6PA 2H6FA 4MBGA 1K8KG 4RLYA 5BW8C 4GMLA 1OCOE 2M63A 2X38A 4CT4A 5B79A 4HQDA 1CHCA 1W3BA 3VK6A 4ANVA 4U95D 4FHJA 1NI1A 4Q96A 1IQRA 4ME2A 3PS6A 1Z3XA 4FIPA 3PZ3A 4ACLA 2ETAA 5ENNA 2YHEA 5DIZA 5FT9A 1K2FA 4FA6A 3ZYMA 4B0ZA 2WXRA 3FUKA 3I4GA 2GRRB 3FUHA 1LDKC 3SO8A 4DK5A 3QWVA 3L17A 1N95A 5JHAA 2PQNA 3ZEFA 3L08A 2OV8A 2DYRE 2KU3A 4J8EA 4JC8A 4JD2G 4NN2A 4ATZD 4AY5A 3PHDA 5KBAA 1LTXA 3MHSA 4F6RD 2ECGA 5ENPD 2C0LA 2WXQA 5KNGA 3OXGA 4GTSA 5ITZF 2JMDA 3PUJA 4GYYA 1YA0A 3L9TA 4P5OB 5D66A 4B8CB 5AQ7A 4FJZA 3QK0A 3TXNA 4YBTA 3ZYKA 3O70A 3B7RL 2WMOA 4UI9K 3DWLG 3QARA 2MYOA 3DPLR 1IXVA 3SHFA 3ZPV1 4WWPA 2ECJA 1TNUA 2JMJA 4XX5A 1V87A 4GNFA 3UT8A 1OUVA 3SFZA 2B6CA 2OVBA 2VSOE 4JEUA 2XEVA 4CCAA 3J5PA 3PE3A 1OT8A 4GTPA 3FTZA 3QWWA 3RO2A 1DCEA 3V2OA 1H6KA 4CZ2D 1SA4A 4G26A 3G2TA 3NAWA 4HRLA 4GTRA 2YREA 3HHMA 2FO1E 4FHKA 3ULEG 4WA6A 1WIMA 4F53A 3FEYA 4LNUD 3SBSA 4P29A 5ARFA 2P9LG 2RI7A 3MA5A 4N5CA 2D8UA 4FO9A 3AAAC 4OYSA 3CKCA 4KZ0A 3ASLA 2C2LA 3PH0C 3CVXA 3BU8A 5AJLA 2P9NG 1IQUA 1VD4A 5ENQD 4BBQA 3L54A 3UKUG 2J08A 2G43A 5D0QD 4BY6A 2CRRA 4GMRA 2FULA 4TUMA 1OWLA 5KH3A 4A63B 2OWAA 5JJTA 3KEZA 4GTMA 3UINC 3U5OA 3VTXA 1WEVA 5IY5E 3ASNE 3OXFA 3H7HA 2WQ6A 2ZETC 3D9JA 4UQXA 4Y6WA 3HVEB 4CDRA 2GGFA 5CBNA 4FU3A 4F3VA 5FZQA 3Q15A 3FEHA 2IY0C 4GNEA 5ENRD 2EXUA 5E76A 2PZIA 5E75A 4AM9A 4I43A 3FU5A 1SA5A 4KMOA 5LKUA 5BUZA 2AVPA 3EIQC 2H0DA 2IFUA 2ZXWE 4AY6A 5FQ8A 1X4IA 3NF1A 3ULYA 1JWGA 3JXJA 3L11A 1YMPA 4L58A 2J4BA 3BQOA 3S7JA 5T4YA 3NOCD 3DSWA 3ASHA 2I2OA 4Y6CA 1MM3A 5DBKA 2CONA 3DEOA 2FBNA 3UKRG 3U66A 2RSDA 1A17A 2LUHA 3FH5A 5AQ9A 1EPUA 1U2VG 5FB0A 1IHGA 3C3OA 3MYVA 5CHEE 4F1PA 4EPZA 2EA6A 4FADA 4LRZA 2WXOA 2XPIA 5LCWB 2JUNA 3U5NA 2OVFA 1HX8A 3ASGA 4AYCA 3X2QE 2V5QC 3E30A 5B78A 3S2AA 4FP7A 4U0UA 2ECWA 5TBNA 4A4CA 2LO6A 3O34A 2WXKA 4WWNA 1HS6A 2MKEA 1P5QA 1E8ZA 3D9IA 3ZNIA 2DWZA 3IHVA 4U96D 3CVVA 4PH4B 4OGEA 5LCWC 2VJEA 5BV0A 3LY9A 5JMND 2Y43A 3FTXA 3FY4A 3NG2A 4BHWA 1HG5A 1ZB1A 2HO1A 4XI9A 4XEIG 3N71A 3O47A 5LKXA 3UPVA 4I7BA 1UN9A 2P9IG 3PRZA 5SVYA 3CHSA 4JA7A 2YSJA 1XGWA 4YBSA 4DLOA 3HXBA 3APCA 1XWHA 4UP5A 4O60A 4A4BA 2WXPA 2LN0A 1OWNA 1TNZA 2IJGX 5LFAA 3PZ2A 2DCPA 1HF8A 3O48A 3ASDA 2Y4TA 3Q7FA 4HXIA 1RMDA 4APFA 3KEAA 2M13A 1PY1A 3AS4A 3SOXA 4N4FA 2MD8C 3U5MA 3B95A 2GRLA 3ZU7B 4AUQB 4MKTA 3IV0A 2LSVA 3LPZA 3ONLA 1N52A 1N54A 1E8WA 2LGKA 3CLJA 3ZPJA 4L7TA 5AN8A 5DKAA 2I1JA 5EKQD 3CHPA 4LCTA 1TJCA 2VYIA 2L75A 1O5MA 3QC1A 4JEHA 1WM5A 3UI2A 5B75A 1X5BA 4I7DA 3Q4AB 1EF1C 2VGEA 3NB2A 3SF4A 3P2BA 2XB1A 3MKQB 2P57A 2KBXA 5H1TA 3ZNGA 3TG5A 3FHEA 4DI3A 4Z68A 2AN6A 4DPRA 3EB6A 3LXUX 2L6BA 2KGGA 5FEYA 5B77A 5CRVA 3CK8A 5D1KB 2YUCA 1O1RA 3VLDA 1HZ4A 4KBQA 3DSXA 4G2VA 2ETCA 4PUCA 5HRYA 3U64A 3LJNA 2AWIA 5K3QA 3RRMB 1BI8B 2ZGGA 3TJPA 4LK9A 4JB8P 1NA0A 5JA4D 2XENA 5KWDA 2CHXA 3SBTB 2FF4A 3LEWA 2I9CA 3IHYA 3LVRE 4CDNA 2ILRA 3HIZA 3V43A 4MVTA 2MIQA 3T5VA 1HYIA 1TN7A 4IC2A 3AG1E 1Y6IA 5FQ4A 3ZXSA 3CK9A 1A5EA 3OAWA 3T8KA 5ANRA 5ANLA 1D9SA 3PUKA 3ZHEB 3G2WA 4CT0A 5AARA 1ZU2A 4YATA 3EHQA 4TKPB 3TAXA 3QWPA 5G55A 3QNKA 3LY8A 3Q9NC 4B7YC 4L9PA 1TYQG 5D2MC 1KT1A 2QYUA 2PUYA 2EGMA 1IKND 5CECB 3HCUA 4BTAA 3RPGB 2V5FA 3G2UA 4GNGA 2LAUA 4A3TA 4GCNA 4GCOA 3RKVA 4BSXA 2P9KG 1WILA 3KV5A 4HNAD 5LKTA 4A49A 1OY3D 1OWOA 4S3OB 4WNFA 3UM0A 2YNQA 1MYOA 4DI4A 1N0RA 1ELRA 4JVSA 5FWQA 4TUUA 3QJZA 4JL0A 1KT0A 4GU5A 2F8XK 3TL5A 3I2DA 4TXRA 4UWHA 2YT5A 4LG6A 2L6JA 2IQCA 3LQJA 3IHPA 3SOUA 2L0IA 3DPYA 2IO3C 3CQCB 1OWMA 3LKUA 1NFIE 2R03A 3KAEA 2MA5A 1FBVA 2R17C 2J49A 4ANWA 5AAOA 4DX1A 2XEUA 4OAVB 5JJ6A 1WFKA 2J07A 4KXKB 5A6CA 3C5KA 3Q75A 3LQIA 5C13A 3RPGC 2L43A 2YURA 2VPBA 2KM4A 1N9AA 1TNOA 3D9LA 2XS8A 2J8SD 3D3MA 2BKKB 3W9GA 4AYCB 3SI5A 3D9KA 3HYMB 2FO7A 2KFTA 2LGLA 2ECIA 3HXFA 3SQVA 2XRYA 3MX3A 3KQIA 3SHBA 5JHBA 3LDYA 1QQEA 4L2YA 5JG6A 3MV3B 1E90A 2LXMA 3K9IA 4R7LA 3HXEA 1Z5SC 3UM3A 1K1BA 1KZPA 1TNBA 2DZNA 3Q47B 2H0DB 2IF4A 4J6IA 1MX6A 2X6KA 4U63A 4HOTA 5FQ6A 4W4UA 4WZ3B 2IONA 2WPVA 1HFAA 1MZCA 5HI7A 4UWFA 2PM6A 2KWNA 2P2CP 2EIKE 4YVQC 2KWKA 3V31A 4ANXA 4WNDA 2KWJA 4J8DA 3QB2A 1N11A 1E7UA 3PZ4A 4I2WA 3CVQA 2LDRA 3GV4A 4WWOA 2KKYA 3CHOA 3C72A 3BG1B 3DSVA 2GRPB 5J90A 3BEEA 4GZ3A 3FH7A 4HI9A 3FUMA 4HVBA 2XGSA 2VPDA 2LAIA 1HYJA 3JXIA 3R7RA 3HTKC 2JRJA 2IU1A 4AJWA 1DCQA 2KXPC 2MHKA 3EIJA 3D9PA 3O36A 3FU0A 2AXVA 4A0CD 4QFVA 2FEZA 2F37A 4YVOA 2RR4A 2NAAA 1OWPA 1JCSA 5A7DB 4WZ2A 3HVEA 3QZVA 3FTVA 4ATGA 3RRNB 3TWXA 4U0SA 1VFYA 2NSZA 3U4TA 1DNPA 2PL2A 1TJFA 2I6HA 4C9BB 2KCLA 2V4HC 5D1MB 2LXPC 2MOWA 4B89A 4BSZB 4N5QA 3RTRB 4OAUC 2EGPA 2CSVA 3L82A 2J09A 3KDEC 3LJ3A 1V55E 3EJNA 3T6RA 2JM3A 1E7VA 2K4DA 4EBAG 4BT8A 3SOWA 4CCGX 4U7EB 3DSTA 3GYZA 3ZHEA 2ECTA 3SY2A 3FP3A 4N3WA 3M62A 5LKZA 2WXLA 2FI7A 2NC9A 2Y4UA 4K03A 1X4UA 4PTBA 5T3RA 4I1MA 3FTSA 1E8XA 3FEXA 3PUQA 4LADB 4XI0A 3FJUB 2R05A 2M3HA 1BD8A 2M85A 5BXUA 5C11A 3EB5A 2ZIRA 3HXDA 3NQPA 3CKBA 2Y1NA 3O33A 4F7AA 5EYPF 3B7SA 1D8EA 2CHWA 4HFGA 4MLPA 5AITA 2A5EA 2JLBA 1WEQA 5G04C 2VP7A 3N9NA 1WEMA 3LCAA 4QQIA 4G1TA 3C3QA 1K1AA 2Y1MA 3EHRA 5SVIA 2HYED 4N2SA 3ESKA 3N9QA 4C9ZA 4R2YA 5C2YA 5T8IA 2IOSA 3TWSA 3ZN3A 2K1JA 2X6JA 3ZUVB 2E0IA 4AV7A 3AU4A 3ZYQA 4HRMB 3GZSA 2C2VS 4J8SA 4U8YD 3TXMA 3BG0B 4C0MA 5M72A 1WDYA 4C0EA 2R2LA 2I50A 5KJNA 2YHNA 2P9UG 3CIAA 2CG3A 4DRXE 3MKRA 1G3NB 5AQBA 2VGXB 3AS5A 4AXHA 4WAFA 3PDNA 3ULQA 4ANUA 3N9OA 1VYXA 4KVOA 2AW6A 3AG4E 3L22A 5TRBA 2WMNA 1B89A 1HO8A 3PZ1A 3T7LA 2IO2C 1NZNA 4HLLA 3SZ7A 2GRNB 2WXMA 3WG7E 3JQ1A 4FJCA 2G45A 4UQZA 4L7XA 5BXOA 4FLHA 2M6MA 4YDEA 4A1SA 2YINA 5A23A 3Q7AA 1FVHA 3FU3A 3KS2A 4U04A 2KZTA 3FL2A 3GZ1A 3CV0A 4I1AA 4I7CA 1HH8A 2YSMA 1Z6TA 3MKQA 1JPLA 4N3AA 2L80A 1S64A 4RVBA 1ELKA 4XI1A 3DXMG 4JHKA 1T1HA 2LGVA 3R7QA 1N0QA 4ILGA 2PNNA 4UP0A 2DVWA 3OXLA 3E4BA 3C98A 4G8KA 4IYPA 2XRZA 4YC9A 2MA6A 4V3IA 2EINE 2L7PA 5EX3A 4BESA 3CR3A 5CCLA 3UM2A 2QC9A 4JHRA 4BX8A 3MCXA 5CEDB 4NACA 1WE9A 2X6IA 2VQ2A 4GMJA 2FSAA 5FZRA 4N3BA 3B7UX 4TRQA 4YABA 1MM2A 4N2QA 4JA9A 3ZPVE 2LRIC 2K16A 4S3OC 3JUEA 5FZSA 2YU4A 1H2VC 3CQGB 4YBMA 2VSXE 5CMWA 4XE0A 2VGYA 3CVYA 3APDA 3GW4A 4M3OA 4TXQA 1SW6A 2H6GA 1KPSB 3L1XA 4GZCA 3ML8A 4O62A 1H19A 3T9KA 2EILE 2VPEA 3FUIA 2MUMA 1SVXA 2YHOA 2KR4A 2IQJA 3I5PA 3HCTA 3Q9UC 3TWWA 1WAO1 1PAQA 3C5RA 4DLQA 4FLBA 2WXHA 4YDYA 1KLXA 3L6AA 3LRQA 1WEPA 1UW4B 2FUIA 4GA2A 2YQLA 2LNIA 3N9PA 2YVRA 3ZW3A 2VTBA 4RG9A 3E2DA 4LLBA 3HXCA 4KVMA 1YCSB 2L5UA 1IYMA 3G2VA 3Q78A 1D8DA 3EHMA 1WEWA 1N4PA 4GTQA 1MX4A 3B7TA 1S63A 2FD4A 3RU0A 5G05J 3O37A 3JCKC 2QY7A 1OCRE 2CHZA 3ZVVA 4LSZE 3E37A 1UG3A 3JYSA 3SNXA 4GAAA 3ZRHA 1HG2A 4R7EA 4HBDA 3EUVA 3IXEA 2V8SE 4WNGA 4GPMA 3ZKJA 4HS2A 3PLWA 4CYMD 2L0BA 1O1SA 3TWQA 2KREA 4AIFA 3VLEA 5ENOD 1HXIA 4KT6B 2YQMA 1H0AA 2P58C 1WESA 2UY1B 3LVQE 3E34A 3KNVA 2KCKA 4HOQA 3EU5A 2YHCA 5CRUA 1UJJA 3ENEA 1TN8A 4GTOA 4DUIA 3ZYLA 4LNBA 3TWVA 3W9FA 2XHEA 1BORA 2H6IA 2P9SG 1Y8MA 2WQHA 4PPEA 3N9LA 1YYHA 2MD7B 1N94A 4GB9A 2BTDA 1FT2A 4TV3A 4K5CA 4EECA 3FUJA 1S70B 4QF2A 4JXTA 3ABME 4Z0OA 3E33A 3PVLA 3QOUA 4BEPA 2JEKA 2LV9A 4CGWA 3HCSA 4WUYA 2Y3AA 4DX6D 2HDPA 2RD0A 2XGMA 3AU5A 4H7XA 3UMVA 3GZ2A 2Q7FA 4HORA 3DSSA 2UWJG 3GL6A 2E6SA 4EBAA 5FB1A 2DBAA 5KJKA 1EYHA 3ASOE 2KKXA 2F6NA 4XKBA 3DXKG 2PQRA 2J9QA 2MRIA 3MEKA 3VLFA 1AP7A 3NOGD 2WB2A 5B1AE
chains in the Genus database with same CATH topology
5AN8A 4J8YA 4HQDA 2YREA 1AWCB 2FO1E 2Y1LE 4G8KA 4U95D 3TWSA 3TWTA 4DX7D 4HBDA 3IXEA 2EGMA 1IKND 3D9HA 5AQ9A 5CECB 4ZHBA 2BKGA 4QFVA 3ZUVB 4ZFHA 4F1PA 2JABA 2L7PA 2F37A 3LDYA 2RR4A 5CERB 2XZTG 4LNUD 4GPMA 4HRMB 3ZKJA 3PLWA 4U8YD 5ENTD 4BESA 4CYMD 2LAUA 2JUNA 3Q1DA 2ETAA 3UI2A 5ENSD 2QC9A 2QYJA 2V5QC 3TWQA 5CEDB 4HNAD 1K1BA 1WDYA 4HI8A 1BU9A 2D8UA 3AAAC 5ENOD 3TWXA 1OY3D 2VGEA 4U8VD 5AQAA 3SO8A 2DZNA 2CRWA 2P57A 3EU9A 2Y0BG 3LVQE 3F6QA 2KBXA 2XZDG 3ZNGA 2RFAA 1MYOA 4DRXE 3UXGA 1MX6A 4Z68A 4K5BA 3TWRA 2MKEA 1TR4A 1G3NB 2L6BA 1N0RA 3JUEA 3FM8C 4YDWA 5AQBA 5SVXA 1BI7B 3B7BA 2ZGDA 4HRNA 2DWZA 4H9DA 4U96D 4ATZD 2V4HC 2XOZA 4O1OA 5ENQD 2F8XK 4OGEA 3HRAA 5FIOA 4BSZB 5KBAA 3LJUX 5CBOA 4N5QA 5HS0A 4DUIA 5JMND 4OAUC 4F6RD 2AJAA 4LG6A 3AJIA 2CRRA 2ETCA 5ENPD 1SW6A 5HRYA 1K3ZD 3LJNA 5KNGA 2CSVA 4BETA 2DZOA 3TWVA 3W9FA 5EYLA 5K3QA 4GMRA 3KDEC 5SVIB 4O62A 3DEPA 2F8YA 2P2CP 4TUMA 3T9KA 5ITZF 2XOYA 3DWDA 2ZGGA 1BI8B 4A63B 3NBNB 4G8LA 4DX2A 2JM3A 2OWAA 3O47A 1MJ0A 3UTMA 1MX2A 1YYHA 3V31A 3DDTA 1SVXA 5D66A 4BERA 5FINA 5SVYA 4JB8P 2IQJA 5JA4D 3H7HA 1UOHA 2XENA 5AQ7A 4HLLA 5KWDA 4K5CA 3MDBC 1QYMA 1NFIE 3Q9UC 1S70B 3TWWA 3C5RA 3M7KA 2DJAA 4Z0OA 5BXOA 1N11A 2B0OE 4C48B 1BLXB 4YDYA 2NYJA 3LVRE 4O60A 5AAOA 2XEHA 4DX1A 5CBNA 2XEEA 4OAVB 2MYOA 4BEPA 3FEHA 2ETBA 4OGCA 4K5AB 4O1PA 5ENRD 3V2XA 3V79K 2EXUA 1IXVA 2YVRA 3FJUB 5EIDA 4Z0RA 1BD8A 4NIKA 3E2DA 5BXUA 3HG0D 1YCSB 4DX6D 5CEAA 2KKYA 1WG0A 3KEAA 4UUCA 1A5EA 2M13A 5HKPA 3J5QB 3V30A 5EYPF 4QQ4A 2A5EA 2XOCA 3T8KA 5EILA 1D9SA 1DC2A 2HE0A 4DX5D 1IHBA 3B95A 2E61A 1MX4A 2J8SD 3JXJA 5AARA 1YMPA 5EIBE 4HI9A 2BKKB 2XP0A 3EHQA 4QQIA 2FD4A 3W9GA 4J7WA 1N0QA 3J5PA 3JXIA 3ZU7B 4B93B 1K1AA 1OT8A 3NOCD 3EHRA 4HB5A 2FFWA 2KKXA 3TWUA 5SVIA 4RLYA 2RFMA 1DCQA 5EN5D 3Q9NC 4LSZE 2CONA 2PNNA 1AP7A 3V2OA 3DEOA 2KXPC 3NOGD 2DVWA 4CZ2D 5KNHD 3SUBA 4HRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN8 A;  4J8Y A;  4HQD A;  1AWC B;  2FO1 E;  2Y1L E;  4G8K A;  4U95 D;  3TWS A;  3TWT A;  4DX7 D;  4HBD A;  3IXE A;  1IKN D;  3D9H A;  5AQ9 A;  5CEC B;  4ZHB A;  2BKG A;  4QFV A;  3ZUV B;  4ZFH A;  4F1P A;  2JAB A;  2F37 A;  5CER B;  2XZT G;  4LNU D;  4GPM A;  4HRM B;  3ZKJ A;  4U8Y D;  5ENT D;  4BES A;  4CYM D;  2ETA A;  3UI2 A;  5ENS D;  2QC9 A;  2QYJ A;  2V5Q C;  3TWQ A;  5CED B;  4HNA D;  1K1B A;  1WDY A;  4HI8 A;  1BU9 A;  3AAA C;  5ENO D;  3TWX A;  1OY3 D;  2VGE A;  4U8V D;  5AQA A;  3SO8 A;  2DZN A;  2CRW A;  2P57 A;  3EU9 A;  2Y0B G;  3LVQ E;  3F6Q A;  2KBX A;  2XZD G;  3ZNG A;  2RFA A;  1MYO A;  4DRX E;  3UXG A;  1MX6 A;  4Z68 A;  4K5B A;  3TWR A;  1TR4 A;  1G3N B;  2L6B A;  1N0R A;  3JUE A;  3FM8 C;  4YDW A;  5AQB A;  1BI7 B;  3B7B A;  2ZGD A;  4HRN A;  2DWZ A;  4U96 D;  4ATZ D;  2V4H C;  4O1O A;  5ENQ D;  2F8X K;  3HRA A;  5FIO A;  4BSZ B;  5KBA A;  3LJU X;  5CBO A;  4N5Q A;  5HS0 A;  4DUI A;  5JMN D;  4OAU C;  4F6R D;  2AJA A;  4LG6 A;  3AJI A;  2CRR A;  2ETC A;  5ENP D;  1SW6 A;  5HRY A;  1K3Z D;  3LJN A;  5KNG A;  4BET A;  2DZO A;  3TWV A;  3W9F A;  5EYL A;  4GMR A;  3DEP A;  2F8Y A;  2P2C P;  4TUM A;  3T9K A;  5ITZ F;  3DWD A;  2ZGG A;  1BI8 B;  4A63 B;  3NBN B;  4G8L A;  4DX2 A;  2OWA A;  3O47 A;  1MJ0 A;  3UTM A;  1MX2 A;  1YYH A;  3V31 A;  1SVX A;  5D66 A;  4BER A;  5FIN A;  4JB8 P;  2IQJ A;  5JA4 D;  1UOH A;  2XEN A;  5AQ7 A;  4HLL A;  5KWD A;  4K5C A;  3MDB C;  1QYM A;  1NFI E;  3Q9U C;  1S70 B;  3TWW A;  3C5R A;  5BXO A;  1N11 A;  2B0O E;  4C48 B;  1BLX B;  4YDY A;  2NYJ A;  3LVR E;  4O60 A;  5AAO A;  2XEH A;  4DX1 A;  5CBN A;  2XEE A;  4OAV B;  2MYO A;  4BEP A;  3FEH A;  2ETB A;  4K5A B;  4O1P A;  5ENR D;  3V2X A;  3V79 K;  3SUB A;  1IXV A;  5EID A;  1BD8 A;  4NIK A;  5BXU A;  3HG0 D;  1YCS B;  4DX6 D;  5CEA A;  1WG0 A;  3KEA A;  4UUC A;  1A5E A;  5HKP A;  3J5Q B;  3V30 A;  5EYP F;  2A5E A;  3T8K A;  5EIL A;  1D9S A;  1DC2 A;  2HE0 A;  4DX5 D;  1IHB A;  3B95 A;  1MX4 A;  2J8S D;  3JXJ A;  5AAR A;  1YMP A;  5EIB E;  4HI9 A;  2BKK B;  3EHQ A;  4QQI A;  3W9G A;  4J7W A;  1N0Q A;  3J5P A;  3JXI A;  3ZU7 B;  4B93 B;  1K1A A;  1OT8 A;  3NOC D;  3EHR A;  4HB5 A;  3TWU A;  4RLY A;  2RFM A;  1DCQ A;  5EN5 D;  3Q9N C;  4LSZ E;  2PNN A;  1AP7 A;  3V2O A;  3DEO A;  2KXP C;  3NOG D;  2DVW A;  4CZ2 D;  5KNH D;  4HRL A; 
#chains in the Genus database with same CATH topology
 2CSZ A;  1HU3 A;  1MQS A;  2WXG A;  2BF0 X;  3U5P A;  5AIU A;  3Q5M A;  4ZQL A;  2V4L A;  1MBM A;  4QF3 A;  4HOU A;  2OEV A;  2G6Q A;  3EDT B;  2Y0B G;  5DIN A;  2XPZ A;  1TR4 A;  5SVX A;  2D8S A;  4I9C A;  1BI7 B;  4WZ0 A;  3O4Z A;  5EX0 A;  2KIZ A;  4H9D A;  2XOZ A;  3U9W A;  5KJM A;  4BWR A;  3AG2 E;  2XCC A;  2DZO A;  2X6H A;  2BUG A;  5KH7 A;  5CCM A;  3UTM A;  2GRO B;  1N4S A;  1E8Y A;  3DDT A;  2VPG A;  3KSQ A;  2ECN A;  4O6F A;  1FP0 A;  3LY7 A;  5FJY A;  1HE8 A;  4BX9 A;  2AXU A;  2WXJ A;  3C3R A;  4EZL A;  3L1Z B;  1N4Q A;  1Z2Q A;  1BPO A;  2OXQ C;  3C6W A;  3CVP A;  3RIB A;  4K5A B;  3SUB A;  4GPK A;  3ZTG A;  2VNF A;  3PUR A;  4L1B A;  1WG0 A;  4URK A;  3M99 A;  2XOC A;  4DX5 D;  5EDS A;  3CK7 A;  2A5U A;  3QAQ A;  2WXN A;  3UM1 A;  2GW1 A;  4B93 B;  4LNG A;  2LSU A;  4YND A;  4OVU A;  5EN5 D;  2XS1 A;  5LP0 A;  1SZA A;  4X8Q A;  1WEE A;  2X3M A;  2EIJ E;  1TEZ A;  3ABK E;  4GB0 A;  3D9H A;  3MV2 B;  2KE1 A;  4ZHB A;  1E96 B;  2EIM E;  3VTY A;  2IDA A;  3ZGQ A;  3ZFW A;  4YAX A;  2PNX A;  5ENT D;  4GYO A;  2F42 A;  3CVL A;  2CKL B;  4E6H A;  1NA3 A;  2KC7 A;  5HQ8 A;  1JCQ A;  3HDX A;  1FVF A;  4I2Z A;  2RG8 A;  4GND A;  3JQ0 A;  2BED A;  2HR2 A;  3KSL A;  4A1G A;  3FAN A;  4I6E A;  4LER A;  3UIP C;  3P1U A;  5B1B E;  4JPS A;  4HRN A;  1H6O A;  4ILH B;  1F62 A;  3DRA A;  4I6G A;  1LD8 A;  4FK5 A;  3LJU X;  1WGM A;  4AP2 A;  3IBE A;  1U6G B;  4IC3 A;  3AJI A;  4AEZ C;  2VTB B;  2R02 A;  2QJ0 A;  5SVI B;  3T5X A;  3PZD A;  2OEW A;  1FT1 A;  2Y69 E;  5I3L A;  3CVW A;  4I9E A;  3PRE A;  2KYU A;  2VJF B;  1QZ2 A;  4A55 A;  3PE4 A;  5KJL A;  3CVN A;  2QIZ A;  3QKY A;  2RKK A;  3ASF A;  2YQ8 A;  3D9O A;  3MHH A;  3ZVY A;  2ETB A;  4OGC A;  4JZY A;  4F52 B;  3ONK A;  3S7F A;  4NIK A;  3RSE G;  5G05 C;  4CRW A;  4UUC A;  4KZC A;  2WXF A;  1IHB A;  2E61 A;  2WM9 A;  3ZVZ B;  4X3G A;  4D10 C;  2FUU A;  3ESL A;  3CHM A;  1MHQ A;  2J4D A;  3E32 A;  4LEU A;  3L16 A;  1NP7 A;  1EDU A;  3URZ A;  3FWV A;  3RK6 A;  3TG4 A;  1GW6 A;  2WQ7 A;  4ZFH A;  4ILI A;  4BT9 A;  5CER B;  2EQX A;  2XZT G;  1ZBD B;  2CT2 A;  4RG6 A;  4G25 A;  4UQY A;  4CA1 A;  3CHQ A;  1SQM A;  2DYS E;  4CDM A;  2OCC E;  3DSU A;  4WNE A;  2E6R A;  4E85 A;  4JW1 A;  4HI8 A;  1IYG A;  5D0O D;  4U0Z A;  3EU9 A;  2KAT A;  4UWK A;  4CGV A;  3UXG A;  2I1K A;  4YDW A;  1JM7 A;  2K17 A;  4JHJ A;  4L23 A;  5FIO A;  1FCH A;  5CBO A;  2CFU A;  4HOS A;  3SFX A;  3UX4 A;  1O1T A;  2XGO A;  1QBQ A;  3UUX A;  2XPY A;  3FAO A;  4L2L A;  3T8M A;  5FQ7 A;  4ACK A;  1MJ0 A;  2OND A;  2DIW A;  4HLE A;  3AS8 A;  3RAU A;  1V54 E;  4NQ0 A;  4YAD A;  5AJD A;  2VGX A;  2IEJ A;  1Z60 A;  2NYJ A;  1JUQ A;  1RZ4 A;  3MGB A;  4UWG A;  2DSM A;  1LD7 A;  4Q69 A;  2NXP A;  1TNY A;  5H7P A;  2CSY A;  4PDX A;  2ZIS A;  4FUL A;  4J0U A;  3J5Q B;  3V30 A;  4QQ4 A;  4A3V A;  4UWL A;  4PS8 A;  2EOD A;  4J8F A;  2QFC A;  5EIB E;  3M63 A;  5H1U A;  4Q6F A;  4EQF A;  4HB5 A;  3PNL B;  3TWU A;  4TXP A;  1JCR A;  2F0Y A;  1INZ A;  4K0R A;  2KZT B;  3RJV A;  3UT4 A;  3LDZ A;  4J8Y A;  4CEM A;  3TWT A;  2HM8 A;  2L0T B;  3ZIM A;  4PS7 A;  2V0P A;  2BKG A;  4I1O B;  5KCM A;  3KD7 A;  5G05 B;  2LXL A;  3Q1D A;  4N3C A;  5LOZ A;  3CST A;  2QYJ A;  1H2T C;  3FTY A;  4U8H A;  4V3K C;  4RSY A;  3G2S A;  4M7C A;  5BPP A;  3MJW A;  5TAB A;  3R9A B;  3TWR A;  1RW2 A;  3FM8 C;  4AP4 A;  3B7B A;  4ZDT A;  3Q73 A;  4U07 A;  1N4R A;  3FUE A;  3UIO C;  4O1O A;  4GTT A;  4H7Y A;  4FC8 A;  4UI9 J;  2GRQ B;  2AJA A;  2XCB A;  4UI9 C;  4G11 A;  2QZA A;  4YDO A;  4I6J A;  5D1L B;  2F8Y A;  1UN8 A;  3S7B A;  2UZG A;  5B8D A;  3NBN B;  4DX2 A;  4GZ5 A;  4APO A;  2GRM A;  3FTW A;  4ABN A;  1E4U A;  5G0F A;  4W9R A;  2R59 A;  1JWF A;  4B8A A;  4AOF A;  3Q49 B;  3M7K A;  2DJA A;  4EHM A;  2ECV A;  2B0O E;  5B3S E;  2XEH A;  3O35 A;  2XEE A;  5AEN A;  5G04 B;  3AG3 E;  4O1P A;  1SZ9 A;  3V79 K;  5ARG A;  4Z0R A;  5BV1 A;  2CG2 A;  3HG0 D;  3SFY A;  2UY1 A;  1X4J A;  2KWO A;  4XKC A;  5EIL A;  4NRH B;  5G04 J;  4F1S A;  5H1V A;  3ISM C;  2YW8 A;  5J3X A;  3UQ3 A;  2XP0 A;  5BT1 A;  4GTV A;  2E2E A;  3FUD A;  5AIJ A;  5CMY A;  1KZO A;  3I3N A;  3PEU B;  4EZJ A;  3R9M A;  3FUL A;  3CVU A;  3FTU A;  3FUF A;  5EYA F;  5KNH D;  1WEN A;  4B86 C;  2Y1L E;  3I4R B;  3FFL A;  4DX7 D;  3D9N A;  4O64 A;  2L9B A;  3APF A;  5FTP A;  4DJA A;  2MT5 A;  1WY6 A;  2KCV A;  2LQ6 A;  1S0P A;  1PC2 A;  5KH9 A;  2XQ0 A;  3PNT B;  3TGO A;  1BU9 A;  3ZXP A;  4IRU A;  4U8V D;  4GZD A;  5AQA A;  2CRW A;  2IOL A;  3CSF A;  3FU6 A;  1DVP A;  2XZD G;  2RFA A;  1UJK A;  4K5B A;  1WEU A;  1N87 A;  1L5J A;  3D9M A;  4GYW A;  5H9M A;  2ZGD A;  3PEV B;  2VJ8 A;  2C0M A;  4G23 A;  5BNW A;  3CGH A;  3ABL E;  3HRA A;  5TDR A;  1OCC E;  2KGI A;  1K3Z D;  3L13 A;  4V3L C;  1Q2Z A;  5LCW J;  2XOY A;  1QNF A;  5FIN A;  3EHN A;  2HYZ A;  4R8P K;  3FUN A;  1QYM A;  4B94 A;  1U3C A;  4GA0 A;  2CKL A;  1XNF A;  2AXZ A;  5EID A;  2MNY A;  3S7D A;  4MSX A;  5FER A;  3LYA A;  3RRU A;  5HKP A;  1WEO A;  2BAY A;  3FDH A;  3UT7 A;  1TN6 A;  1ELW A;  3QDN A;  1VDY A;  4J7W A;  3OTN A;  4LUN U;  4Q94 A;  2X6F A;  2VJE B;  5C1D A;  2LAH A;  1G25 A;  2FFW A;  4PS3 A;  2JMI A;  2RFM A;  4KYO B;  3RO3 A;  3JUI A;  1OXJ A;  1AWC B;  2VJF A;  4XIF A;  3DPD A;  1ZBP A;  4UI9 B;  4MS6 A;  4EZK A;  2JAB A;  4XZ4 A;  3N9M A;  1JOC A;  4IUL A;  1LF8 A;  4N39 A;  4FJY A;  5ENS D;  1Z3Y A;  2CFZ A;  3B13 A;  2ZU6 B;  2M1R A;  5J08 A;  4NUR A;  3SD5 A;  2QIC A;  3IKO B;  3SGH A;  3F6Q A;  3LS8 A;  4MRU A;  4BTB A;  2LXH C;  4LJN A;  3IEG A;  3DQV R;  3Q79 A;  1NL4 A;  5HS0 A;  5G2N A;  1LDJ B;  4BFR A;  2OOE A;  2YYR A;  1OCZ E;  2H6H A;  4BET A;  5EYL A;  2R5S A;  3DEP A;  3CEQ A;  3DWD A;  2VSY A;  1X81 A;  4OVV A;  4G8L A;  3LQH A;  1MX2 A;  2PM7 A;  2F6J A;  3WXX A;  1U3D A;  4GZ6 A;  4BER A;  2MNZ A;  1UOH A;  3MDB C;  1H2U A;  3ML9 A;  5TDW A;  5JJ7 A;  4ZUX U;  2A4Z A;  3NZU A;  4AVX A;  4C48 B;  1BLX B;  1Z6U A;  1FPP A;  3U3W A;  3KV6 A;  4LKA A;  3FH8 A;  2DX8 A;  4G24 A;  3V2X A;  3DBS A;  3CHR A;  5CEA A;  5B76 A;  4GA1 A;  3NZS A;  1JM7 B;  2WXI A;  1DC2 A;  2HE0 A;  2P9P G;  5AYW D;  4RQI A;  2VSN A;  2WVI A;  3BUA A;  3O7A A;  3MZL B;  4IN3 B;  5LX8 A;  4I17 A;  2LGG A;  1H6P A;  2H6F A;  4MBG A;  1K8K G;  4RLY A;  5BW8 C;  4GML A;  1OCO E;  2M63 A;  2X38 A;  4CT4 A;  5B79 A;  4HQD A;  1CHC A;  1W3B A;  3VK6 A;  4ANV A;  4U95 D;  4FHJ A;  1NI1 A;  4Q96 A;  1IQR A;  4ME2 A;  3PS6 A;  1Z3X A;  4FIP A;  3PZ3 A;  4ACL A;  2ETA A;  5ENN A;  2YHE A;  5DIZ A;  5FT9 A;  1K2F A;  4FA6 A;  3ZYM A;  4B0Z A;  2WXR A;  3FUK A;  3I4G A;  2GRR B;  3FUH A;  1LDK C;  3SO8 A;  4DK5 A;  3QWV A;  3L17 A;  1N95 A;  5JHA A;  2PQN A;  3ZEF A;  3L08 A;  2OV8 A;  2DYR E;  2KU3 A;  4J8E A;  4JC8 A;  4JD2 G;  4NN2 A;  4ATZ D;  4AY5 A;  3PHD A;  5KBA A;  1LTX A;  3MHS A;  4F6R D;  2ECG A;  5ENP D;  2C0L A;  2WXQ A;  5KNG A;  3OXG A;  4GTS A;  5ITZ F;  2JMD A;  3PUJ A;  4GYY A;  1YA0 A;  3L9T A;  4P5O B;  5D66 A;  4B8C B;  5AQ7 A;  4FJZ A;  3QK0 A;  3TXN A;  4YBT A;  3ZYK A;  3O70 A;  3B7R L;  2WMO A;  4UI9 K;  3DWL G;  3QAR A;  2MYO A;  3DPL R;  1IXV A;  3SHF A;  3ZPV 1;  4WWP A;  2ECJ A;  1TNU A;  2JMJ A;  4XX5 A;  1V87 A;  4GNF A;  3UT8 A;  1OUV A;  3SFZ A;  2B6C A;  2OVB A;  2VSO E;  4JEU A;  2XEV A;  4CCA A;  3J5P A;  3PE3 A;  1OT8 A;  4GTP A;  3FTZ A;  3QWW A;  3RO2 A;  1DCE A;  3V2O A;  1H6K A;  4CZ2 D;  1SA4 A;  4G26 A;  3G2T A;  3NAW A;  4HRL A;  4GTR A;  2YRE A;  3HHM A;  2FO1 E;  4FHK A;  3ULE G;  4WA6 A;  1WIM A;  4F53 A;  3FEY A;  4LNU D;  3SBS A;  4P29 A;  5ARF A;  2P9L G;  2RI7 A;  3MA5 A;  4N5C A;  2D8U A;  4FO9 A;  3AAA C;  4OYS A;  3CKC A;  4KZ0 A;  3ASL A;  2C2L A;  3PH0 C;  3CVX A;  3BU8 A;  5AJL A;  2P9N G;  1IQU A;  1VD4 A;  5ENQ D;  4BBQ A;  3L54 A;  3UKU G;  2J08 A;  2G43 A;  5D0Q D;  4BY6 A;  2CRR A;  4GMR A;  2FUL A;  4TUM A;  1OWL A;  5KH3 A;  4A63 B;  2OWA A;  5JJT A;  3KEZ A;  4GTM A;  3UIN C;  3U5O A;  3VTX A;  1WEV A;  5IY5 E;  3ASN E;  3OXF A;  3H7H A;  2WQ6 A;  2ZET C;  3D9J A;  4UQX A;  4Y6W A;  3HVE B;  4CDR A;  2GGF A;  5CBN A;  4FU3 A;  4F3V A;  5FZQ A;  3Q15 A;  3FEH A;  2IY0 C;  4GNE A;  5ENR D;  2EXU A;  5E76 A;  2PZI A;  5E75 A;  4AM9 A;  4I43 A;  3FU5 A;  1SA5 A;  4KMO A;  5LKU A;  5BUZ A;  2AVP A;  3EIQ C;  2H0D A;  2IFU A;  2ZXW E;  4AY6 A;  5FQ8 A;  1X4I A;  3NF1 A;  3ULY A;  1JWG A;  3JXJ A;  3L11 A;  1YMP A;  4L58 A;  2J4B A;  3BQO A;  3S7J A;  5T4Y A;  3NOC D;  3DSW A;  3ASH A;  2I2O A;  4Y6C A;  1MM3 A;  5DBK A;  2CON A;  3DEO A;  2FBN A;  3UKR G;  3U66 A;  2RSD A;  1A17 A;  2LUH A;  3FH5 A;  5AQ9 A;  1EPU A;  1U2V G;  5FB0 A;  1IHG A;  3C3O A;  3MYV A;  5CHE E;  4F1P A;  4EPZ A;  2EA6 A;  4FAD A;  4LRZ A;  2WXO A;  2XPI A;  5LCW B;  2JUN A;  3U5N A;  2OVF A;  1HX8 A;  3ASG A;  4AYC A;  3X2Q E;  2V5Q C;  3E30 A;  5B78 A;  3S2A A;  4FP7 A;  4U0U A;  2ECW A;  5TBN A;  4A4C A;  2LO6 A;  3O34 A;  2WXK A;  4WWN A;  1HS6 A;  2MKE A;  1P5Q A;  1E8Z A;  3D9I A;  3ZNI A;  2DWZ A;  3IHV A;  4U96 D;  3CVV A;  4PH4 B;  4OGE A;  5LCW C;  2VJE A;  5BV0 A;  3LY9 A;  5JMN D;  2Y43 A;  3FTX A;  3FY4 A;  3NG2 A;  4BHW A;  1HG5 A;  1ZB1 A;  2HO1 A;  4XI9 A;  4XEI G;  3N71 A;  3O47 A;  5LKX A;  3UPV A;  4I7B A;  1UN9 A;  2P9I G;  3PRZ A;  5SVY A;  3CHS A;  4JA7 A;  2YSJ A;  1XGW A;  4YBS A;  4DLO A;  3HXB A;  3APC A;  1XWH A;  4UP5 A;  4O60 A;  4A4B A;  2WXP A;  2LN0 A;  1OWN A;  1TNZ A;  2IJG X;  5LFA A;  3PZ2 A;  2DCP A;  1HF8 A;  3O48 A;  3ASD A;  2Y4T A;  3Q7F A;  4HXI A;  1RMD A;  4APF A;  3KEA A;  2M13 A;  1PY1 A;  3AS4 A;  3SOX A;  4N4F A;  2MD8 C;  3U5M A;  3B95 A;  2GRL A;  3ZU7 B;  4AUQ B;  4MKT A;  3IV0 A;  2LSV A;  3LPZ A;  3ONL A;  1N52 A;  1N54 A;  1E8W A;  2LGK A;  3CLJ A;  3ZPJ A;  4L7T A;  5AN8 A;  5DKA A;  2I1J A;  5EKQ D;  3CHP A;  4LCT A;  1TJC A;  2VYI A;  2L75 A;  1O5M A;  3QC1 A;  4JEH A;  1WM5 A;  3UI2 A;  5B75 A;  1X5B A;  4I7D A;  3Q4A B;  1EF1 C;  2VGE A;  3NB2 A;  3SF4 A;  3P2B A;  2XB1 A;  3MKQ B;  2P57 A;  2KBX A;  5H1T A;  3ZNG A;  3TG5 A;  3FHE A;  4DI3 A;  4Z68 A;  2AN6 A;  4DPR A;  3EB6 A;  3LXU X;  2L6B A;  2KGG A;  5FEY A;  5B77 A;  5CRV A;  3CK8 A;  5D1K B;  2YUC A;  1O1R A;  3VLD A;  1HZ4 A;  4KBQ A;  3DSX A;  4G2V A;  2ETC A;  4PUC A;  5HRY A;  3U64 A;  3LJN A;  2AWI A;  5K3Q A;  3RRM B;  1BI8 B;  2ZGG A;  3TJP A;  4LK9 A;  4JB8 P;  1NA0 A;  5JA4 D;  2XEN A;  5KWD A;  2CHX A;  3SBT B;  2FF4 A;  3LEW A;  2I9C A;  3IHY A;  3LVR E;  4CDN A;  2ILR A;  3HIZ A;  3V43 A;  4MVT A;  2MIQ A;  3T5V A;  1HYI A;  1TN7 A;  4IC2 A;  3AG1 E;  1Y6I A;  5FQ4 A;  3ZXS A;  3CK9 A;  1A5E A;  3OAW A;  3T8K A;  5ANR A;  5ANL A;  1D9S A;  3PUK A;  3ZHE B;  3G2W A;  4CT0 A;  5AAR A;  1ZU2 A;  4YAT A;  3EHQ A;  4TKP B;  3TAX A;  3QWP A;  5G55 A;  3QNK A;  3LY8 A;  3Q9N C;  4B7Y C;  4L9P A;  1TYQ G;  5D2M C;  1KT1 A;  2QYU A;  2PUY A;  2EGM A;  1IKN D;  5CEC B;  3HCU A;  4BTA A;  3RPG B;  2V5F A;  3G2U A;  4GNG A;  2LAU A;  4A3T A;  4GCN A;  4GCO A;  3RKV A;  4BSX A;  2P9K G;  1WIL A;  3KV5 A;  4HNA D;  5LKT A;  4A49 A;  1OY3 D;  1OWO A;  4S3O B;  4WNF A;  3UM0 A;  2YNQ A;  1MYO A;  4DI4 A;  1N0R A;  1ELR A;  4JVS A;  5FWQ A;  4TUU A;  3QJZ A;  4JL0 A;  1KT0 A;  4GU5 A;  2F8X K;  3TL5 A;  3I2D A;  4TXR A;  4UWH A;  2YT5 A;  4LG6 A;  2L6J A;  2IQC A;  3LQJ A;  3IHP A;  3SOU A;  2L0I A;  3DPY A;  2IO3 C;  3CQC B;  1OWM A;  3LKU A;  1NFI E;  2R03 A;  3KAE A;  2MA5 A;  1FBV A;  2R17 C;  2J49 A;  4ANW A;  5AAO A;  4DX1 A;  2XEU A;  4OAV B;  5JJ6 A;  1WFK A;  2J07 A;  4KXK B;  5A6C A;  3C5K A;  3Q75 A;  3LQI A;  5C13 A;  3RPG C;  2L43 A;  2YUR A;  2VPB A;  2KM4 A;  1N9A A;  1TNO A;  3D9L A;  2XS8 A;  2J8S D;  3D3M A;  2BKK B;  3W9G A;  4AYC B;  3SI5 A;  3D9K A;  3HYM B;  2FO7 A;  2KFT A;  2LGL A;  2ECI A;  3HXF A;  3SQV A;  2XRY A;  3MX3 A;  3KQI A;  3SHB A;  5JHB A;  3LDY A;  1QQE A;  4L2Y A;  5JG6 A;  3MV3 B;  1E90 A;  2LXM A;  3K9I A;  4R7L A;  3HXE A;  1Z5S C;  3UM3 A;  1K1B A;  1KZP A;  1TNB A;  2DZN A;  3Q47 B;  2H0D B;  2IF4 A;  4J6I A;  1MX6 A;  2X6K A;  4U63 A;  4HOT A;  5FQ6 A;  4W4U A;  4WZ3 B;  2ION A;  2WPV A;  1HFA A;  1MZC A;  5HI7 A;  4UWF A;  2PM6 A;  2KWN A;  2P2C P;  2EIK E;  4YVQ C;  2KWK A;  3V31 A;  4ANX A;  4WND A;  2KWJ A;  4J8D A;  3QB2 A;  1N11 A;  1E7U A;  3PZ4 A;  4I2W A;  3CVQ A;  2LDR A;  3GV4 A;  4WWO A;  2KKY A;  3CHO A;  3C72 A;  3BG1 B;  3DSV A;  2GRP B;  5J90 A;  3BEE A;  4GZ3 A;  3FH7 A;  4HI9 A;  3FUM A;  4HVB A;  2XGS A;  2VPD A;  2LAI A;  1HYJ A;  3JXI A;  3R7R A;  3HTK C;  2JRJ A;  2IU1 A;  4AJW A;  1DCQ A;  2KXP C;  2MHK A;  3EIJ A;  3D9P A;  3O36 A;  3FU0 A;  2AXV A;  4A0C D;  4QFV A;  2FEZ A;  2F37 A;  4YVO A;  2RR4 A;  2NAA A;  1OWP A;  1JCS A;  5A7D B;  4WZ2 A;  3HVE A;  3QZV A;  3FTV A;  4ATG A;  3RRN B;  3TWX A;  4U0S A;  1VFY A;  2NSZ A;  3U4T A;  1DNP A;  2PL2 A;  1TJF A;  2I6H A;  4C9B B;  2KCL A;  2V4H C;  5D1M B;  2LXP C;  2MOW A;  4B89 A;  4BSZ B;  4N5Q A;  3RTR B;  4OAU C;  2EGP A;  2CSV A;  3L82 A;  2J09 A;  3KDE C;  3LJ3 A;  1V55 E;  3EJN A;  3T6R A;  2JM3 A;  1E7V A;  2K4D A;  4EBA G;  4BT8 A;  3SOW A;  4CCG X;  4U7E B;  3DST A;  3GYZ A;  3ZHE A;  2ECT A;  3SY2 A;  3FP3 A;  4N3W A;  3M62 A;  5LKZ A;  2WXL A;  2FI7 A;  2NC9 A;  2Y4U A;  4K03 A;  1X4U A;  4PTB A;  5T3R A;  4I1M A;  3FTS A;  1E8X A;  3FEX A;  3PUQ A;  4LAD B;  4XI0 A;  3FJU B;  2R05 A;  2M3H A;  1BD8 A;  2M85 A;  5BXU A;  5C11 A;  3EB5 A;  2ZIR A;  3HXD A;  3NQP A;  3CKB A;  2Y1N A;  3O33 A;  4F7A A;  5EYP F;  3B7S A;  1D8E A;  2CHW A;  4HFG A;  4MLP A;  5AIT A;  2A5E A;  2JLB A;  1WEQ A;  5G04 C;  2VP7 A;  3N9N A;  1WEM A;  3LCA A;  4QQI A;  4G1T A;  3C3Q A;  1K1A A;  2Y1M A;  3EHR A;  5SVI A;  2HYE D;  4N2S A;  3ESK A;  3N9Q A;  4C9Z A;  4R2Y A;  5C2Y A;  5T8I A;  2IOS A;  3TWS A;  3ZN3 A;  2K1J A;  2X6J A;  3ZUV B;  2E0I A;  4AV7 A;  3AU4 A;  3ZYQ A;  4HRM B;  3GZS A;  2C2V S;  4J8S A;  4U8Y D;  3TXM A;  3BG0 B;  4C0M A;  5M72 A;  1WDY A;  4C0E A;  2R2L A;  2I50 A;  5KJN A;  2YHN A;  2P9U G;  3CIA A;  2CG3 A;  4DRX E;  3MKR A;  1G3N B;  5AQB A;  2VGX B;  3AS5 A;  4AXH A;  4WAF A;  3PDN A;  3ULQ A;  4ANU A;  3N9O A;  1VYX A;  4KVO A;  2AW6 A;  3AG4 E;  3L22 A;  5TRB A;  2WMN A;  1B89 A;  1HO8 A;  3PZ1 A;  3T7L A;  2IO2 C;  1NZN A;  4HLL A;  3SZ7 A;  2GRN B;  2WXM A;  3WG7 E;  3JQ1 A;  4FJC A;  2G45 A;  4UQZ A;  4L7X A;  5BXO A;  4FLH A;  2M6M A;  4YDE A;  4A1S A;  2YIN A;  5A23 A;  3Q7A A;  1FVH A;  3FU3 A;  3KS2 A;  4U04 A;  2KZT A;  3FL2 A;  3GZ1 A;  3CV0 A;  4I1A A;  4I7C A;  1HH8 A;  2YSM A;  1Z6T A;  3MKQ A;  1JPL A;  4N3A A;  2L80 A;  1S64 A;  4RVB A;  1ELK A;  4XI1 A;  3DXM G;  4JHK A;  1T1H A;  2LGV A;  3R7Q A;  1N0Q A;  4ILG A;  2PNN A;  4UP0 A;  2DVW A;  3OXL A;  3E4B A;  3C98 A;  4G8K A;  4IYP A;  2XRZ A;  4YC9 A;  2MA6 A;  4V3I A;  2EIN E;  2L7P A;  5EX3 A;  4BES A;  3CR3 A;  5CCL A;  3UM2 A;  2QC9 A;  4JHR A;  4BX8 A;  3MCX A;  5CED B;  4NAC A;  1WE9 A;  2X6I A;  2VQ2 A;  4GMJ A;  2FSA A;  5FZR A;  4N3B A;  3B7U X;  4TRQ A;  4YAB A;  1MM2 A;  4N2Q A;  4JA9 A;  3ZPV E;  2LRI C;  2K16 A;  4S3O C;  3JUE A;  5FZS A;  2YU4 A;  1H2V C;  3CQG B;  4YBM A;  2VSX E;  5CMW A;  4XE0 A;  2VGY A;  3CVY A;  3APD A;  3GW4 A;  4M3O A;  4TXQ A;  1SW6 A;  2H6G A;  1KPS B;  3L1X A;  4GZC A;  3ML8 A;  4O62 A;  1H19 A;  3T9K A;  2EIL E;  2VPE A;  3FUI A;  2MUM A;  1SVX A;  2YHO A;  2KR4 A;  2IQJ A;  3I5P A;  3HCT A;  3Q9U C;  3TWW A;  1WAO 1;  1PAQ A;  3C5R A;  4DLQ A;  4FLB A;  2WXH A;  4YDY A;  1KLX A;  3L6A A;  3LRQ A;  1WEP A;  1UW4 B;  2FUI A;  4GA2 A;  2YQL A;  2LNI A;  3N9P A;  2YVR A;  3ZW3 A;  2VTB A;  4RG9 A;  3E2D A;  4LLB A;  3HXC A;  4KVM A;  1YCS B;  2L5U A;  1IYM A;  3G2V A;  3Q78 A;  1D8D A;  3EHM A;  1WEW A;  1N4P A;  4GTQ A;  1MX4 A;  3B7T A;  1S63 A;  2FD4 A;  3RU0 A;  5G05 J;  3O37 A;  3JCK C;  2QY7 A;  1OCR E;  2CHZ A;  3ZVV A;  4LSZ E;  3E37 A;  1UG3 A;  3JYS A;  3SNX A;  4GAA A;  3ZRH A;  1HG2 A;  4R7E A;  4HBD A;  3EUV A;  3IXE A;  2V8S E;  4WNG A;  4GPM A;  3ZKJ A;  4HS2 A;  3PLW A;  4CYM D;  2L0B A;  1O1S A;  3TWQ A;  2KRE A;  4AIF A;  3VLE A;  5ENO D;  1HXI A;  4KT6 B;  2YQM A;  1H0A A;  2P58 C;  1WES A;  2UY1 B;  3LVQ E;  3E34 A;  3KNV A;  2KCK A;  4HOQ A;  3EU5 A;  2YHC A;  5CRU A;  1UJJ A;  3ENE A;  1TN8 A;  4GTO A;  4DUI A;  3ZYL A;  4LNB A;  3TWV A;  3W9F A;  2XHE A;  1BOR A;  2H6I A;  2P9S G;  1Y8M A;  2WQH A;  4PPE A;  3N9L A;  1YYH A;  2MD7 B;  1N94 A;  4GB9 A;  2BTD A;  1FT2 A;  4TV3 A;  4K5C A;  4EEC A;  3FUJ A;  1S70 B;  4QF2 A;  4JXT A;  3ABM E;  4Z0O A;  3E33 A;  3PVL A;  3QOU A;  4BEP A;  2JEK A;  2LV9 A;  4CGW A;  3HCS A;  4WUY A;  2Y3A A;  4DX6 D;  2HDP A;  2RD0 A;  2XGM A;  3AU5 A;  4H7X A;  3UMV A;  3GZ2 A;  2Q7F A;  4HOR A;  3DSS A;  2UWJ G;  3GL6 A;  2E6S A;  4EBA A;  5FB1 A;  2DBA A;  5KJK A;  1EYH A;  3ASO E;  2KKX A;  2F6N A;  4XKB A;  3DXK G;  2PQR A;  2J9Q A;  2MRI A;  3MEK A;  3VLF A;  1AP7 A;  3NOG D;  2WB2 A;  5B1A E; 
#chains in the Genus database with same CATH homology
 5AN8 A;  4J8Y A;  4HQD A;  2YRE A;  1AWC B;  2FO1 E;  2Y1L E;  4G8K A;  4U95 D;  3TWS A;  3TWT A;  4DX7 D;  4HBD A;  3IXE A;  2EGM A;  1IKN D;  3D9H A;  5AQ9 A;  5CEC B;  4ZHB A;  2BKG A;  4QFV A;  3ZUV B;  4ZFH A;  4F1P A;  2JAB A;  2L7P A;  2F37 A;  3LDY A;  2RR4 A;  5CER B;  2XZT G;  4LNU D;  4GPM A;  4HRM B;  3ZKJ A;  3PLW A;  4U8Y D;  5ENT D;  4BES A;  4CYM D;  2LAU A;  2JUN A;  3Q1D A;  2ETA A;  3UI2 A;  5ENS D;  2QC9 A;  2QYJ A;  2V5Q C;  3TWQ A;  5CED B;  4HNA D;  1K1B A;  1WDY A;  4HI8 A;  1BU9 A;  2D8U A;  3AAA C;  5ENO D;  3TWX A;  1OY3 D;  2VGE A;  4U8V D;  5AQA A;  3SO8 A;  2DZN A;  2CRW A;  2P57 A;  3EU9 A;  2Y0B G;  3LVQ E;  3F6Q A;  2KBX A;  2XZD G;  3ZNG A;  2RFA A;  1MYO A;  4DRX E;  3UXG A;  1MX6 A;  4Z68 A;  4K5B A;  3TWR A;  2MKE A;  1TR4 A;  1G3N B;  2L6B A;  1N0R A;  3JUE A;  3FM8 C;  4YDW A;  5AQB A;  5SVX A;  1BI7 B;  3B7B A;  2ZGD A;  4HRN A;  2DWZ A;  4H9D A;  4U96 D;  4ATZ D;  2V4H C;  2XOZ A;  4O1O A;  5ENQ D;  2F8X K;  4OGE A;  3HRA A;  5FIO A;  4BSZ B;  5KBA A;  3LJU X;  5CBO A;  4N5Q A;  5HS0 A;  4DUI A;  5JMN D;  4OAU C;  4F6R D;  2AJA A;  4LG6 A;  3AJI A;  2CRR A;  2ETC A;  5ENP D;  1SW6 A;  5HRY A;  1K3Z D;  3LJN A;  5KNG A;  2CSV A;  4BET A;  2DZO A;  3TWV A;  3W9F A;  5EYL A;  5K3Q A;  4GMR A;  3KDE C;  5SVI B;  4O62 A;  3DEP A;  2F8Y A;  2P2C P;  4TUM A;  3T9K A;  5ITZ F;  2XOY A;  3DWD A;  2ZGG A;  1BI8 B;  4A63 B;  3NBN B;  4G8L A;  4DX2 A;  2JM3 A;  2OWA A;  3O47 A;  1MJ0 A;  3UTM A;  1MX2 A;  1YYH A;  3V31 A;  3DDT A;  1SVX A;  5D66 A;  4BER A;  5FIN A;  5SVY A;  4JB8 P;  2IQJ A;  5JA4 D;  3H7H A;  1UOH A;  2XEN A;  5AQ7 A;  4HLL A;  5KWD A;  4K5C A;  3MDB C;  1QYM A;  1NFI E;  3Q9U C;  1S70 B;  3TWW A;  3C5R A;  3M7K A;  2DJA A;  4Z0O A;  5BXO A;  1N11 A;  2B0O E;  4C48 B;  1BLX B;  4YDY A;  2NYJ A;  3LVR E;  4O60 A;  5AAO A;  2XEH A;  4DX1 A;  5CBN A;  2XEE A;  4OAV B;  2MYO A;  4BEP A;  3FEH A;  2ETB A;  4OGC A;  4K5A B;  4O1P A;  5ENR D;  3V2X A;  3V79 K;  2EXU A;  1IXV A;  2YVR A;  3FJU B;  5EID A;  4Z0R A;  1BD8 A;  4NIK A;  3E2D A;  5BXU A;  3HG0 D;  1YCS B;  4DX6 D;  5CEA A;  2KKY A;  1WG0 A;  3KEA A;  4UUC A;  1A5E A;  2M13 A;  5HKP A;  3J5Q B;  3V30 A;  5EYP F;  4QQ4 A;  2A5E A;  2XOC A;  3T8K A;  5EIL A;  1D9S A;  1DC2 A;  2HE0 A;  4DX5 D;  1IHB A;  3B95 A;  2E61 A;  1MX4 A;  2J8S D;  3JXJ A;  5AAR A;  1YMP A;  5EIB E;  4HI9 A;  2BKK B;  2XP0 A;  3EHQ A;  4QQI A;  2FD4 A;  3W9G A;  4J7W A;  1N0Q A;  3J5P A;  3JXI A;  3ZU7 B;  4B93 B;  1K1A A;  1OT8 A;  3NOC D;  3EHR A;  4HB5 A;  2FFW A;  2KKX A;  3TWU A;  5SVI A;  4RLY A;  2RFM A;  1DCQ A;  5EN5 D;  3Q9N C;  4LSZ E;  2CON A;  2PNN A;  1AP7 A;  3V2O A;  3DEO A;  2KXP C;  3NOG D;  2DVW A;  4CZ2 D;  5KNH D;  3SUB A;  4HRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...