2B0OE

Crystal structure of uplc1 gap domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
264
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of GAP and ankyrin domains of UPLC1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords UPLC1
total genus 82
structure length 264
sequence length 265
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2b0oE02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2b0oE01
4OAUC 1N0RA 1AP7A 1BI8B 5AARA 3TWXA 4O1OA 5JA4D 1MYOA 2F37A 4N5QA 4HI9A 3TWTA 2XENA 4K5BA 3KEAA 4C48B 5CECB 1WG0A 4HI8A 4BETA 4DRXE 1TR4A 2KXPC 5KNGA 4DX7D 1QYMA 3F6QA 2RFMA 3TWRA 4DUIA 2ZGGA 1SW6A 5CERB 1N0QA 2OWAA 4BERA 3NOCD 3JUEA 4ATZD 3AJIA 1DC2A 1D9SA 1IXVA 1K1AA 4B93B 2F8XK 3V31A 3ZU7B 3FM8C 1K1BA 4K5AB 3UXGA 3HG0D 4HRMB 5KNHD 4NIKA 3V2OA 4RLYA 3B7BA 2XZDG 5AQ7A 1MX4A 1YCSB 3W9GA 3EHQA 3TWSA 5EYPF 3IXEA 2XEEA 4BSZB 3EHRA 1BI7B 2V4HC 4O60A 3UTMA 2DZOA 4CZ2D 3C5RA 2Y0BG 1BD8A 2XEHA 4OAVB 1BU9A 4UUCA 3DWDA 5CEDB 5KBAA 5KWDA 5EN5D 1WDYA 1G3NB 1MJ0A 4HBDA 3SUBA 5CBNA 5ENTD 4F6RD 3NBNB 3Q9UC 4GMRA 2ETAA 3MDBC 3DEPA 2JABA 4U96D 2DVWA 2IQJA 3UI2A 5ENRD 4YDWA 4ZFHA 4HB5A 4U95D 3W9FA 3T9KA 3O47A 4BEPA 5EIDA 5ENPD 3B95A 2MYOA 3Q9NC 1OT8A 3SO8A 5D66A 5AAOA 3FEHA 2ETCA 3HRAA 5EYLA 4ZHBA 3V79K 4HRLA 1SVXA 2QYJA 2PNNA 2Y1LE 4LNUD 3J5PA 2XZTG 1IKND 1OY3D 5FIOA 2BKGA 3T8KA 5BXUA 2CRRA 2L6BA 3LJNA 5AQAA 4JB8P 4Z68A 1BLXB 1MX6A 1S70B 4DX5D 2A5EA 5BXOA 3DEOA 5CEAA 5ENOD 2KBXA 1IHBA 4QFVA 5HKPA 4J7WA 3TWQA 2P57A 4A63B 4HQDA 2J8SD 5AQ9A 3NOGD 2AJAA 4GPMA 1DCQA 3J5QB 5HS0A 2P2CP 4U8VD 4HRNA 4G8KA 2NYJA 2HE0A 1N11A 3AAAC 5ENSD 5EIBE 3JXIA 4O1PA 2BKKB 3D9HA 4HLLA 4TUMA 5AN8A 2B0OE 2F8YA 2FO1E 4CYMD 4LSZE 5HRYA 5FINA 3V30A 3TWWA 3EU9A 4DX1A 2QC9A 4YDYA 3TWVA 4F1PA 1A5EA 4DX2A 3LVQE 5AQBA 5EILA 1AWCB 1YYHA 5ENQD 3V2XA 4G8LA 4HNAD 1NFIE 5JMND 2VGEA 4U8YD 4LG6A 4QQIA 3ZKJA 2DZNA 3LVRE 2CRWA 2V5QC 3LJUX 3ZNGA 1MX2A 4K5CA 4BESA 2DWZA 1YMPA 2ETBA 1K3ZD 2RFAA 2ZGDA 4DX6D 5ITZF 3ZUVB 4J8YA 5CBOA 3JXJA 3TWUA 1UOHA
chains in the Genus database with same CATH superfamily
1SA4A 2H6HA 5AARA 4CRWA 3AS5A 2EODA 3FTSA 2XENA 1WG0A 5B79A 4UQYA 2KWJA 2P9UG 5JJTA 3I4RB 2WXNA 3MKQB 3HYMB 1VFYA 2LSVA 4GZ3A 1PY1A 2JUNA 4O62A 2KREA 4CCGX 3ZU7B 3R9AB 2CG2A 3GZSA 1KZPA 5KNHD 3TL5A 3CHSA 4ANVA 3S7JA 3EHRA 4QQ4A 4EECA 1WEPA 2IJGX 4EQFA 1Y6IA 2ONDA 3L82A 3FUFA 2ETAA 3NZUA 4U96D 4ZDTA 2L7PA 4IULA 5FEYA 3EHNA 3BG1B 5JJ7A 4GTPA 3O47A 3T9KA 1TN8A 5DIZA 4BEPA 5EIDA 2YSJA 1V55E 2E61A 4ZHBA 3BEEA 5ANRA 2QYJA 4R8PK 3T8KA 2FUIA 2M85A 2YYRA 1S0PA 3LPZA 4HQDA 4BT9A 2KWNA 2QZAA 1UN9A 1UJJA 3L1ZB 4GZDA 4YNDA 4IN3B 1DVPA 3ZHEB 2WQHA 4XI9A 4DX2A 5EYAF 3PZ2A 2IOLA 3EU5A 1AWCB 1MM2A 4G26A 1X4UA 4PS8A 4ACKA 3APCA 3CK9A 3SHBA 3CLJA 3L16A 3ZKJA 2E2EA 3PUKA 4PDXA 4WUYA 3HXBA 4GTTA 3DPYA 2XB1A 3DPLR 1D8DA 1BI8B 2KWOA 5JA4D 1L5JA 3SNXA 5CECB 2KKYA 1TNUA 2C2VS 1K8KG 4YAXA 3ZYMA 3RRMB 2VJFB 3DXMG 5LKXA 3IHYA 4YATA 4HOQA 1FP0A 1HH8A 2H6IA 5B1AE 4X3GA 3T7LA 4W4UA 2X6IA 5A23A 1WFKA 1YCSB 4GMLA 3Q47B 4ILIA 5LOZA 3T5XA 3BUAA 2EIME 4CZ2D 1FCHA 5KWDA 3O35A 1WDYA 5H1VA 3HCUA 2I2OA 4Q96A 3SUBA 4TXPA 2P9PG 4YDWA 3R7RA 3DSXA 4YC9A 5AAOA 4HRLA 3TGOA 4DI3A 3PUQA 3FULA 3G2UA 3ISMC 1MHQA 3T5VA 5FERA 4BX8A 4F53A 3L54A 3R9MA 3KDEC 3VTXA 2C2LA 4J7WA 2P57A 1Z5SC 2VQ2A 3H7HA 4RSYA 4U0UA 2WVIA 5T3RA 1DCQA 4BFRA 3HCTA 2EXUA 1RZ4A 3PVLA 5J90A 5JG6A 5BV0A 2LAUA 5DBKA 4APOA 3U66A 3FY4A 5C2YA 3T6RA 2RD0A 2IQCA 2A4ZA 2PL2A 3HIZA 4GNGA 3Q7FA 3ABLE 2D8SA 1E4UA 1E8YA 3EIQC 4NURA 3IEGA 5JMND 2Y1NA 4OYSA 3ZXPA 5IY5E 4N4FA 1H6KA 3ZNGA 3D9PA 3LXUX 1YMPA 3FH7A 4DX6D 4BX9A 2ZGDA 5ITZF 4A4BA 3C3OA 4R2YA 5G05B 3B7UX 4I1AA 4UP5A 5B77A 2I1JA 2RI7A 5T4YA 2V0PA 3I3NA 1WIMA 3FHEA 4JHKA 1H2TC 2DSMA 4PTBA 3WXXA 1UW4B 3D9OA 4YADA 4AUQB 3PREA 4K5AB 4I2WA 4BHWA 2GRQB 3V2OA 4RLYA 4TXQA 2BUGA 2EIJE 3PZDA 3IKOB 3FTUA 4FADA 4GMJA 3LY7A 4GU5A 2YUCA 4CT4A 3AU5A 5CEDB 2IEJA 4I17A 2UY1B 5K3QA 2V5FA 5H7PA 3UM1A 2AVPA 5FQ4A 4I7BA 5FZSA 3CHPA 3SOUA 3B95A 3E34A 3I4GA 2WB2A 1BPOA 2EGPA 5G05J 3L11A 3HRAA 3J5PA 2YHOA 4DJAA 3UQ3A 2JLBA 4XZ4A 4EHMA 4GAAA 3UKUG 2DX8A 2ECWA 4AIFA 5CHEE 3VK6A 2NYJA 3S7DA 2X6FA 2B0OE 3N9OA 3U4TA 3EU9A 2QFCA 4B0ZA 2X6HA 5EILA 4GCNA 3I5PA 4YABA 1EF1C 2LXMA 3CIAA 3OAWA 4KT6B 3ZPJA 1HF8A 4P5OB 5T8IA 3RIBA 2Y1MA 3MV2B 4XEIG 2LDRA 3E4BA 3ZUVB 2WXHA 2LO6A 3TWUA 3MKQA 4WNGA 4YVOA 1E8XA 2KXPC 4GTQA 4UWGA 1HYJA 4MRUA 3TG5A 3FUMA 2AXVA 4HORA 5D0QD 2QY7A 4NIKA 4LEUA 3RO2A 3TWSA 3Q15A 3L13A 3JQ1A 4O60A 2WXJA 4BSXA 1HG5A 4I6GA 2GRRB 2VPEA 3ZEFA 3IBEA 3FTWA 4TUUA 1Z6UA 2F0YA 4B94A 1U2VG 4WA6A 2LGKA 3CK7A 2EILE 3KS2A 4FJZA 1OCRE 3UI2A 2LGGA 4N2SA 5FTPA 5G05C 2JMDA 3FEYA 2Y3AA 4CEMA 5CCLA 3UX4A 4V3LC 4HVBA 4LNUD 2PNNA 1IYGA 2XCCA 2B6CA 2CRRA 2OEVA 3E30A 3LJNA 4LUNU 4DLOA 1MM3A 3DEOA 4IYPA 5CEAA 3FUDA 3C3RA 3TWQA 5KH3A 2J8SD 3SFZA 3PUJA 5G04C 5FQ7A 3RU0A 2L0TB 4FC8A 4L2YA 3EB5A 2UY1A 4FP7A 3ONKA 5FQ8A 4ZQLA 5EIBE 1OWPA 4YDEA 2C0LA 1WAO1 2FO1E 2R5SA 2MHKA 1FT2A 5ENQD 2XS8A 4U8YD 2PQRA 4Y6CA 2KCLA 2IONA 4NACA 2X6KA 1WEMA 4FJYA 3PZ3A 4AEZC 1OUVA 1HS6A 4L58A 3G2WA 4AYCB 3LY9A 1P5QA 1ZBDB 1WEVA 4AY6A 2CHZA 4N5CA 2KC7A 3RPGC 1HG2A 3ZTGA 4AP4A 3LEWA 3SI5A 4O64A 2WXQA 5AYWD 4HRMB 2XRZA 3FTYA 1MX4A 2QICA 5EYPF 1BI7B 3SHFA 3N9NA 3ONLA 1IHGA 4UWKA 1TNBA 2WXLA 3PNLB 4R7LA 3ZFWA 1KLXA 2IQJA 3KNVA 2V8SE 4W9RA 2A5UA 3SBSA 2WMOA 2GW1A 2JMIA 3U64A 2GRPB 4QF3A 4EBAG 3TAXA 3ZVYA 1UG3A 1SVXA 2QYUA 2XZTG 3PE4A 2KCKA 3LCAA 4S3OC 2HYZA 5BXUA 5KJLA 1BLXB 3CVXA 4MLPA 2KGGA 4N3WA 1ELRA 2LAIA 3HHMA 4IC2A 4U8HA 2VJEA 3EDTB 3FTXA 2YINA 4GA1A 4OGEA 2QJ0A 3ASLA 2LRIC 4KXKB 3C98A 2ECJA 2L5UA 3LVQE 3TWVA 4ANUA 2Y4TA 2R03A 2CHWA 5H1UA 4B8CB 3L08A 3MYVA 3D9MA 3ULEG 1LF8A 5JJ6A 5AITA 1EPUA 3HXCA 4UWFA 1WY6A 4UP0A 2I9CA 3O36A 5G04B 3L22A 2L0BA 2Q7FA 3GV4A 3UMVA 4TKPB 4OAUC 3DDTA 3CK8A 4C48B 3HXFA 3L9TA 4FHKA 4JC8A 1TR4A 5KNGA 4FHJA 2LQ6A 2MKEA 4GNDA 3UM0A 2YQMA 3GYZA 5D1MB 2MT5A 4J0UA 3MA5A 4RVBA 1IXVA 4GA2A 3U3WA 3APDA 4A1GA 2LNIA 4XKBA 4AV7A 3ZXSA 4G11A 3MCXA 3TXMA 2YW8A 3UKRG 3FUJA 3SZ7A 2XEEA 2L75A 1E7UA 3PLWA 3C5RA 2CKLB 4CCAA 4UUCA 4JA9A 5B75A 1MJ0A 4A0CD 5ENTD 3FFLA 4X8QA 4J8FA 1HU3A 1RMDA 1WESA 3KV6A 1OT8A 3FJUB 2R59A 3KV5A 2VPDA 4LKAA 2AW6A 3RK6A 3VLDA 1IKND 3DBSA 3KEZA 2HO1A 4KMOA 5HKPA 3PEUB 2VTBA 2FO7A 4PPEA 2J4DA 4CDMA 2PM7A 4NN2A 1O1RA 2Y69E 2L6JA 3CV0A 3FU5A 1RW2A 3CGHA 2QC9A 3FUKA 4C9BB 1OCZE 4ME2A 3ASNE 5ARFA 2CFZA 1SA5A 1XNFA 3ASFA 4K0RA 5BV1A 2ETBA 4WZ2A 3LJ3A 5G04J 1N4PA 3RO3A 2KR4A 2IOSA 1FT1A 5TDRA 4JEUA 5KCMA 2WXIA 1LD8A 3PH0C 4K5BA 3KEAA 4FA6A 2ZISA 4HI8A 5B78A 1IYMA 4C0MA 4M3OA 2UZGA 3QARA 4E6HA 2XP0A 2ZGGA 3ZN3A 4G2VA 4DPRA 3UINC 4U0ZA 4ATZD 2HDPA 3ABME 4C0EA 3ASHA 3E37A 3OXFA 3UM3A 5CMYA 5I3LA 1NP7A 4U63A 5DINA 2V4HC 1TJCA 2XQ0A 4GTVA 3DRAA 5EN5D 3Q7AA 2L9BA 4L1BA 1D8EA 3B13A 1N94A 2CSYA 3PE3A 3EIJA 4XI0A 2RR4A 1LDKC 3D9LA 2LUHA 4LJNA 4MKTA 1WEEA 3CVLA 2J4BA 3AG4E 1HXIA 4Y6WA 4Z0OA 5FIOA 3FH8A 4G23A 1TJFA 2K16A 4UWHA 5EKQD 1VDYA 4JB8P 1CHCA 4PS3A 4GB0A 2J49A 3QWPA 5LCWJ 1X4JA 1ZU2A 4QFVA 3CVNA 2KU3A 2ECGA 3VLEA 4G8KA 4I6JA 2BKKB 2VSOE 3D9HA 4JD2G 4TUMA 3RSEG 2KIZA 3TWWA 5AQBA 3DQVR 4KBQA 3ZVZB 3UM2A 3ESKA 3LS8A 2G43A 4HNAD 4Q69A 2VPBA 4UI9B 5CCMA 1A17A 3LJUX 2KKXA 2CG3A 4BESA 3UT8A 4CDRA 3ASDA 2XOCA 4FIPA 2G45A 4B7YC 4DX7D 4KYOB 4ILHB 4U07A 4LLBA 3CVVA 3MV3B 3CVQA 3V43A 4DI4A 4OGCA 1FBVA 2X6JA 2M1RA 5SVYA 1N95A 4GYYA 3KQIA 4G1TA 4AOFA 2I1KA 4BSZB 1X5BA 4C9ZA 2MIQA 2Y0BG 4HOTA 4GZ5A 5C13A 3G2VA 4L23A 5G0FA 5KBAA 3PZ1A 2ECNA 2VPGA 3B7RL 1LDJB 3L17A 1BORA 5JHBA 3MHHA 3PZ4A 4G24A 2H6GA 2RSDA 2H0DB 3JCKC 3AG2E 4AM9A 5ENPD 3RRNB 2AWIA 3S2AA 3RPGB 3NAWA 2LGLA 4E85A 3PEVB 3MZLB 3LDYA 2CSZA 3UT4A 5LCWC 4MBGA 3SOXA 3Q79A 5ENOD 3VLFA 4FLHA 4JW1A 2PZIA 3C72A 2E6RA 5AQ9A 3U9WA 4GYOA 5HS0A 3UPVA 5ENSD 1DNPA 4A3TA 3HTKC 5HRYA 4GA0A 3FANA 4YVQC 3FUIA 1H19A 1JCRA 4G8LA 3URZA 3B7TA 2NC9A 2P9NG 2GGFA 2XGOA 1TN6A 5BW8C 1HE8A 3JXJA 1E90A 4ILGA 1INZA 2IU1A 2GRMA 4GZ6A 2J08A 4IC3A 3AS8A 4L9PA 3FU3A 2D8UA 1G25A 2RFMA 5LKUA 4PS7A 4GZCA 4UI9C 5FZQA 5AIUA 2VJ8A 4GYWA 4B93B 3DWLG 4BWRA 3V31A 3FM8C 2VSNA 4Q6FA 2R02A 3UXGA 3LQJA 4FU3A 3DSSA 3SBTB 4ACLA 3IXEA 1Y8MA 4U7EB 1HFAA 2DZOA 2L0IA 4OAVB 2CSVA 3MJWA 1H6OA 4ZUXU 1JPLA 2IF4A 4CGVA 5SVIB 3ZYKA 5CBNA 4WZ0A 4GTSA 5ANLA 3L6AA 5ENRD 3FAOA 1V54E 4U95D 1OCOE 4DLQA 3JQ0A 3QK0A 2Y1LE 2R17C 3MHSA 3GZ1A 4YBSA 4KVMA 5SVXA 2WXKA 5H1TA 4KZ0A 1O5MA 2KBXA 3C6WA 2P9IG 4A63B 4CT0A 4GPMA 3RTRB 4UI9K 3GZ2A 4JHRA 2FBNA 3RKVA 3NG2A 2KGIA 3KAEA 1W3BA 4F1PA 2JRJA 4I9CA 4ANWA 1JCQA 3V2XA 1SQMA 4QQIA 1N9AA 1FVHA 2AXZA 3M62A 2CRWA 1EDUA 4BT8A 1UOHA 3BG0B 4J8EA 1UJKA 2XEVA 3N9QA 1OWMA 4LCTA 4DK5A 4P29A 4DUIA 3U5OA 1QQEA 3ESLA 3SOWA 2J9QA 2F8XK 5HI7A 2EIKE 5TDWA 5TBNA 3JUIA 1NL4A 3W9GA 3EHQA 5AJDA 2CONA 3QDNA 2MA6A 3CR3A 3RRUA 5H9MA 4JPSA 1XWHA 5J08A 4TRQA 3ZHEA 2WMNA 2YQ8A 1JWFA 2WXFA 2VSYA 2ECVA 2QIZA 2ETCA 4XKCA 2NSZA 4HS2A 3QWWA 1TEZA 4F7AA 5LX8A 1NA3A 4RG9A 2HYED 5BXOA 5CMWA 4JHJA 3DSVA 3CHOA 2XPYA 3ZRHA 3NOGD 2AJAA 2P2CP 3AAAC 3JXIA 4O1PA 5DKAA 3CQGB 5D1LB 5FINA 4Q94A 3ZGQA 1ELKA 1X81A 3P1UA 2LSUA 4I1OB 2ILRA 3Q78A 3CEQA 4LG6A 2MNZA 4WNFA 4BTAA 3EJNA 4MVTA 4F52B 2WXOA 3E32A 3O7AA 2WXMA 2H0DA 5D1KB 3ZNIA 4AP2A 3HCSA 1NI1A 1MQSA 4XE0A 3BQOA 3PRZA 2MD7B 5M72A 2BAYA 3NOCD 3HVEA 3AJIA 1GW6A 4WWNA 2V4LA 3KSQA 4UWLA 5LCWB 4N3CA 1JM7A 3SF4A 2HR2A 1S63A 5AQ7A 2FEZA 3OTNA 2DIWA 2FSAA 3MX3A 4HOSA 2VGXB 3AG3E 4LNBA 3PHDA 5ARGA 3ASGA 1U6GB 2Y43A 3HVEB 1SZAA 2DVWA 4I7DA 4UQXA 3Q73A 3I2DA 4GB9A 2WXGA 4LK9A 5B76A 3Q9NC 1HZ4A 5ENNA 5FWQA 2YREA 3EHMA 2KZTB 1N87A 3HDXA 3B7SA 5LKTA 2OXQC 2CHXA 3DXKG 4DX5D 4V3KC 3HXEA 3S7FA 2P9KG 2MOWA 2X38A 2J07A 1E96B 3ABKE 1Z3XA 1KT1A 2AXUA 3L1XA 2LXHC 4F1SA 4YBTA 3UUXA 2CFUA 4URKA 3DSUA 3QOUA 1OWOA 1O1SA 2IO2C 2P58C 3C3QA 2EGMA 3RAUA 3QJZA 2FD4A 3Q4AB 3LVRE 3P2BA 1Z2QA 4AJWA 2VP7A 3U5PA 2X3MA 3AU4A 2ZIRA 4NQ0A 5CBOA 4JL0A 4CGWA 4GNFA 3D9IA 3QKYA 3NF1A 2HM8A 4B86C 2DYSE 4KVOA 5D0OD 1QYMA 1JWGA 4LNGA 3CKBA 3FEXA 1N0QA 5FZRA 5A7DB 2M6MA 3R7QA 2VSXE 5BT1A 1V87A 2JM3A 3HG0D 4TXRA 2XZDG 2OCCE 1N4SA 4ABNA 1LD7A 4JA7A 4PH4B 3DWDA 5FJYA 3O48A 2MNYA 1U3CA 1WENA 4ATGA 4HBDA 3FTVA 2IO3C 3OXLA 4F6RD 3NBNB 3APFA 1H2UA 3Q49B 4WAFA 3FTZA 3E2DA 2WM9A 3GW4A 1T1HA 4M7CA 4D10C 5KH7A 2K4DA 4GCOA 3PS6A 4XIFA 1WE9A 3O37A 3UT7A 4RQIA 2DYRE 3Q5MA 1NZNA 5C1DA 4PUCA 2ECTA 1IHBA 3MEKA 4HFGA 3CVUA 2YSMA 1JUQA 4XI1A 2DCPA 4U8VD 5LKZA 4FLBA 2MD8C 4EBAA 3LQIA 4TV3A 2VGYA 1LTXA 1OWNA 2XRYA 2F8YA 5BPPA 2XOZA 3V30A 4DX1A 5E76A 1TYQG 3TJPA 3ZYQA 3LDZA 1NFIE 1TNOA 4CDNA 4FJCA 2FF4A 2KZTA 3FUNA 4K03A 4J8SA 3LY8A 4A4CA 2V5QC 4O6FA 3ML8A 1B89A 3M63A 3S7BA 3ZIMA 3QZVA 1N0RA 2NAAA 3TWXA 4O1OA 4OVVA 2FI7A 3FU6A 2DJAA 3D9JA 5D2MC 3LRQA 3Q1DA 2LV9A 1KZOA 4AXHA 3PURA 3O4ZA 2OWAA 4I2ZA 4WZ3B 3EUVA 1TNYA 1K1AA 2GROB 4GPKA 2F6JA 3NZSA 5FB0A 3PNTB 2XPZA 3CKCA 4JZYA 3VTYA 3B7BA 4N39A 2XPIA 3ZYLA 1TN7A 1K2FA 4V3IA 1NA0A 4YBMA 3QWVA 4WNDA 2YT5A 4G25A 4WNEA 2YHEA 3CHRA 2KATA 1HX8A 1WEWA 2OVFA 4GMRA 4IRUA 4AVXA 3DEPA 2R05A 1HO8A 4ZFHA 4QF2A 2VTBB 1XGWA 3NQPA 3SO8A 2M3HA 2RKKA 2VJFA 2KFTA 2ZXWE 2L43A 1N54A 3OXGA 1WEUA 2KWKA 2LXPC 2JEKA 3ULQA 5LP0A 5AQAA 1WILA 2YURA 2XGMA 4F3VA 3QNKA 2IY0C 4A49A 1WEQA 3MGBA 1MBMA 4HRNA 2MA5A 3U5NA 2LGVA 2PNXA 1HYIA 5BUZA 3E33A 3N9MA 4GTOA 1A5EA 4OVUA 3IHVA 4R7EA 2PQNA 4XX5A 2DZNA 3D3MA 2F6NA 3LQHA 1ZBPA 4K5CA 2K1JA 1U3DA 2I50A 4N3BA 2RFAA 3RJVA 2KCVA 3ZW3A 3N9PA 1QNFA 3FU0A 1N52A 4HI9A 3TWTA 2L80A 4MSXA 4BETA 1PC2A 1IQUA 1JOCA 3AG1E 5KH9A 3ML9A 4H7XA 4BTBA 3D9KA 5FQ6A 3JYSA 3TWRA 1Z6TA 5TABA 2ZU6B 4ANXA 1SW6A 1QZ2A 5CERB 3LYAA 3CVWA 2WQ6A 3JUEA 3ENEA 1DC2A 1D9SA 2YVRA 1DCEA 5AENA 3DSTA 2XEUA 3UTMA 3C5KA 2XEHA 2OEWA 4LRZA 2RG8A 5BNWA 3X2QE 2ECIA 4Z0RA 3Q9UC 5B8DA 3MDBC 1N4RA 2VJEB 3W9FA 2MYOA 4EZLA 3QB2A 4N3AA 3Q75A 5C11A 2WQ7A 4HLEA 2JMJA 2Y4UA 2VGXA 3MKRA 1E8ZA 2NXPA 2M63A 3ZPV1 2WXPA 1EYHA 4FO9A 1ELWA 3CQCB 4JVSA 2KM4A 5EX3A 3D9NA 4HLLA 3NB2A 4LSZE 1YA0A 1ZB1A 1Z60A 4GNEA 2FULA 2E0IA 2BF0X 3SY2A 3TG4A 3GL6A 2OVBA 2EA6A 4H7YA 4L7XA 3IV0A 2H6FA 1H2VC 2DWZA 3CVYA 4J8YA 4I6EA 1Z3YA 3O33A 2E6SA 3CSTA 1WGMA 1E7VA 2F37A 3FWVA 2C0MA 3DPDA 4I1MA 2P9SG 4MS6A 4DRXE 4WWOA 3CVPA 5FT9A 3F6QA 4L2LA 4HXIA 1FVFA 3CHMA 3SFYA 3DSWA 5G2NA 4BERA 5EDSA 4N2QA 1H0AA 5CRUA 1K1BA 3N71A 2GRNB 3SD5A 4A3VA 3CHQA 2XCBA 2WXRA 4L7TA 2CT2A 4H9DA 1N4QA 3SFXA 4GTRA 3ZVVA 5A6CA 1G3NB 1PAQA 3FUHA 3WG7E 2UWJG 4WWPA 1FPPA 4EZKA 2JABA 4S3OB 4RG6A 1KPSB 4JEHA 3O70A 4HB5A 1SZ9A 2M13A 1JCSA 3K9IA 4UI9J 5AJLA 5D66A 2CKLA 4BY6A 3FEHA 5EYLA 3V79K 1OY3D 4YDOA 1F62A 4Z68A 3FUEA 1MX6A 4HOUA 2A5EA 4J6IA 1H6PA 2P9LG 4FK5A 3J5QB 2VYIA 2R2LA 2DBAA 1N11A 1TNZA 4GTMA 4UQZA 1KT0A 2PM6A 3KSLA 2YHNA 2OOEA 3G2SA 5EX0A 3KD7A 4I9EA 5B1BE 2LN0A 2F42A 4JXTA 2G6QA 3FP3A 5CRVA 3BU8A 1MX2A 1OXJA 5TRBA 2IFUA 1K3ZD 1AP7A 2YNQA 4CA1A 1IQRA 5B3SE 1MYOA 4N5QA 2LAHA 4AYCA 4EZJA 4I43A 3CSFA 3FH5A 5FB1A 3LKUA 2GRLA 3UIPC 2MUMA 4EPZA 3T8MA 3PDNA 3FL2A 3TXNA 2YU4A 1E8WA 2AN6A 1JM7B 3ZPVE 3G2TA 5SVIA 1OCCE 4LERA 4LADB 3SGHA 5HQ8A 1Q2ZA 2I6HA 4A55A 1X4IA 1UN8A 1BD8A 1BU9A 4APFA 2BTDA 2KE1A 5AIJA 3ASOE 3IHPA 3O34A 4NRHB 1MZCA 4U04A 5G55A 3ULYA 4U0SA 5JHAA 4FULA 4I7CA 5J3XA 2XS1A 4J8DA 2MRIA 2PUYA 5KJMA 3HXDA 2YQLA 2OV8A 2FFWA 2ZETC 4A1SA 2IDAA 3EB6A 1O1TA 1S64A 2BKGA 4B8AA 2L6BA 2LXLA 1S70B 1WM5A 5LFAA 2YHCA 3N9LA 4B89A 2XHEA 1OWLA 2J09A 4BBQA 1WEOA 2VNFA 3AS4A 4KZCA 2HE0A 2K17A 2XOYA 2FUUA 5AN8A 3UIOC 4CYMD 2EQXA 3FDHA 4AY5A 4YDYA 1QBQA 3SQVA 2WPVA 1YYHA 3QC1A 3M7KA 3U5MA 5KJKA 2BEDA 1VYXA 2VGEA 2EINE 5KJNA 2XGSA 5E75A 3M99A 2KYUA 3QAQA 1VD4A
chains in the Genus database with same CATH topology
4OAUC 1N0RA 1AP7A 1BI8B 5AARA 3TWXA 3DDTA 4O1OA 5JA4D 1MYOA 2F37A 4N5QA 4HI9A 3TWTA 2XENA 4K5BA 3KEAA 4C48B 5CECB 1WG0A 4HI8A 2KKYA 4BETA 4DRXE 2DJAA 1TR4A 2KXPC 5KNGA 4DX7D 2MKEA 1QYMA 3Q1DA 3F6QA 2D8UA 2XP0A 2RFMA 3TWRA 4DUIA 2ZGGA 1SW6A 5CERB 1N0QA 2OWAA 4OGCA 4BERA 3NOCD 3JUEA 4ATZD 3AJIA 1DC2A 1D9SA 1IXVA 2JUNA 4O62A 1K1AA 4B93B 2F8XK 2YVRA 3V31A 3ZU7B 3FM8C 5SVYA 1K1BA 5SVIA 4K5AB 3UXGA 2JM3A 3HG0D 4HRMB 5KNHD 4NIKA 3V2OA 4RLYA 3B7BA 2XZDG 5AQ7A 1MX4A 1YCSB 3W9GA 3EHQA 3TWSA 5EYPF 3IXEA 2CONA 2XEEA 4BSZB 3EHRA 1BI7B 4QQ4A 2V4HC 4O60A 3UTMA 2DZOA 3PLWA 4H9DA 4CZ2D 3C5RA 2Y0BG 1BD8A 2XEHA 4OAVB 1BU9A 4UUCA 3DWDA 5CEDB 2CSVA 5KBAA 5KWDA 5EN5D 1WDYA 1G3NB 1MJ0A 4HBDA 5SVIB 5CBNA 3SUBA 5ENTD 4Z0RA 4F6RD 3NBNB 5K3QA 3Q9UC 4GMRA 2ETAA 3MDBC 3DEPA 2JABA 4U96D 2DVWA 2IQJA 3UI2A 2L7PA 5ENRD 4YDWA 4ZFHA 2RR4A 4HB5A 4U95D 2M13A 3W9FA 3T9KA 3O47A 4BEPA 3E2DA 5EIDA 5ENPD 3B95A 2MYOA 3Q9NC 1OT8A 3SO8A 3FJUB 2E61A 5D66A 2YREA 2FFWA 5AAOA 3FEHA 2ETCA 3HRAA 5EYLA 4ZHBA 3V79K 4HRLA 1SVXA 2QYJA 2PNNA 2Y1LE 4LNUD 3J5PA 2XZTG 1IKND 4Z0OA 1OY3D 5FIOA 2BKGA 3T8KA 3LDYA 5BXUA 2CRRA 2L6BA 3LJNA 5AQAA 4JB8P 4Z68A 1BLXB 1MX6A 1S70B 4DX5D 2A5EA 5BXOA 3DEOA 5CEAA 5SVXA 5ENOD 3KDEC 2KBXA 1IHBA 4QFVA 5HKPA 4J7WA 3TWQA 2P57A 4A63B 4HQDA 2J8SD 5AQ9A 3H7HA 3NOGD 2AJAA 4GPMA 1DCQA 3J5QB 2EXUA 5HS0A 2P2CP 4U8VD 4HRNA 4G8KA 2NYJA 2HE0A 1N11A 3AAAC 4OGEA 5ENSD 5EIBE 3JXIA 2LAUA 4O1PA 2BKKB 3D9HA 4HLLA 4TUMA 2XOYA 5AN8A 2B0OE 2F8YA 2FO1E 4CYMD 4LSZE 5HRYA 5FINA 3V30A 3TWWA 2XOZA 3EU9A 4DX1A 2QC9A 4YDYA 3TWVA 4F1PA 1A5EA 4DX2A 3LVQE 5AQBA 5EILA 1AWCB 1YYHA 5ENQD 3V2XA 3M7KA 4G8LA 4HNAD 1NFIE 5JMND 2EGMA 2VGEA 4U8YD 4LG6A 4QQIA 3ZKJA 2DZNA 2FD4A 3LVRE 2CRWA 2V5QC 3LJUX 3ZNGA 2KKXA 1MX2A 4K5CA 4BESA 2DWZA 1YMPA 2ETBA 1K3ZD 2RFAA 2ZGDA 4DX6D 5ITZF 3ZUVB 4J8YA 5CBOA 3JXJA 3TWUA 2XOCA 1UOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAU C;  1N0R A;  1AP7 A;  1BI8 B;  5AAR A;  3TWX A;  4O1O A;  5JA4 D;  1MYO A;  2F37 A;  4N5Q A;  4HI9 A;  3TWT A;  2XEN A;  4K5B A;  3KEA A;  4C48 B;  5CEC B;  1WG0 A;  4HI8 A;  4BET A;  4DRX E;  1TR4 A;  2KXP C;  5KNG A;  4DX7 D;  1QYM A;  3F6Q A;  2RFM A;  3TWR A;  4DUI A;  2ZGG A;  1SW6 A;  5CER B;  1N0Q A;  2OWA A;  4BER A;  3NOC D;  3JUE A;  4ATZ D;  3AJI A;  1DC2 A;  1D9S A;  1IXV A;  1K1A A;  4B93 B;  2F8X K;  3V31 A;  3ZU7 B;  3FM8 C;  1K1B A;  4K5A B;  3UXG A;  3HG0 D;  4HRM B;  5KNH D;  4NIK A;  3V2O A;  4RLY A;  3B7B A;  2XZD G;  5AQ7 A;  1MX4 A;  1YCS B;  3W9G A;  3EHQ A;  3TWS A;  5EYP F;  3IXE A;  2XEE A;  4BSZ B;  3EHR A;  1BI7 B;  2V4H C;  4O60 A;  3UTM A;  2DZO A;  4CZ2 D;  3C5R A;  2Y0B G;  1BD8 A;  2XEH A;  4OAV B;  1BU9 A;  4UUC A;  3DWD A;  5CED B;  5KBA A;  5KWD A;  5EN5 D;  1WDY A;  1G3N B;  1MJ0 A;  4HBD A;  3SUB A;  5CBN A;  5ENT D;  4F6R D;  3NBN B;  3Q9U C;  4GMR A;  2ETA A;  3MDB C;  3DEP A;  2JAB A;  4U96 D;  2DVW A;  2IQJ A;  3UI2 A;  5ENR D;  4YDW A;  4ZFH A;  4HB5 A;  4U95 D;  3W9F A;  3T9K A;  3O47 A;  4BEP A;  5EID A;  5ENP D;  3B95 A;  2MYO A;  3Q9N C;  1OT8 A;  3SO8 A;  5D66 A;  5AAO A;  3FEH A;  2ETC A;  3HRA A;  5EYL A;  4ZHB A;  3V79 K;  4HRL A;  1SVX A;  2QYJ A;  2PNN A;  2Y1L E;  4LNU D;  3J5P A;  2XZT G;  1IKN D;  1OY3 D;  5FIO A;  2BKG A;  3T8K A;  5BXU A;  2CRR A;  2L6B A;  3LJN A;  5AQA A;  4JB8 P;  4Z68 A;  1BLX B;  1MX6 A;  1S70 B;  4DX5 D;  2A5E A;  5BXO A;  3DEO A;  5CEA A;  5ENO D;  2KBX A;  1IHB A;  4QFV A;  5HKP A;  4J7W A;  3TWQ A;  2P57 A;  4A63 B;  4HQD A;  2J8S D;  5AQ9 A;  3NOG D;  2AJA A;  4GPM A;  1DCQ A;  3J5Q B;  5HS0 A;  2P2C P;  4U8V D;  4HRN A;  4G8K A;  2NYJ A;  2HE0 A;  1N11 A;  3AAA C;  5ENS D;  5EIB E;  3JXI A;  4O1P A;  2BKK B;  3D9H A;  4HLL A;  4TUM A;  5AN8 A;  2B0O E;  2F8Y A;  2FO1 E;  4CYM D;  4LSZ E;  5HRY A;  5FIN A;  3V30 A;  3TWW A;  3EU9 A;  4DX1 A;  2QC9 A;  4YDY A;  3TWV A;  4F1P A;  1A5E A;  4DX2 A;  3LVQ E;  5AQB A;  5EIL A;  1AWC B;  1YYH A;  5ENQ D;  3V2X A;  4G8L A;  4HNA D;  1NFI E;  5JMN D;  2VGE A;  4U8Y D;  4LG6 A;  4QQI A;  3ZKJ A;  2DZN A;  3LVR E;  2CRW A;  2V5Q C;  3LJU X;  3ZNG A;  1MX2 A;  4K5C A;  4BES A;  2DWZ A;  1YMP A;  2ETB A;  1K3Z D;  2RFA A;  2ZGD A;  4DX6 D;  5ITZ F;  3ZUV B;  4J8Y A;  5CBO A;  3JXJ A;  3TWU A;  1UOH A; 
#chains in the Genus database with same CATH topology
 1SA4 A;  2H6H A;  5AAR A;  4CRW A;  3AS5 A;  2EOD A;  3FTS A;  2XEN A;  1WG0 A;  5B79 A;  4UQY A;  2KWJ A;  2P9U G;  5JJT A;  3I4R B;  2WXN A;  3MKQ B;  3HYM B;  1VFY A;  2LSV A;  4GZ3 A;  1PY1 A;  2JUN A;  4O62 A;  2KRE A;  4CCG X;  3ZU7 B;  3R9A B;  2CG2 A;  3GZS A;  1KZP A;  5KNH D;  3TL5 A;  3CHS A;  4ANV A;  3S7J A;  3EHR A;  4QQ4 A;  4EEC A;  1WEP A;  2IJG X;  4EQF A;  1Y6I A;  2OND A;  3L82 A;  3FUF A;  2ETA A;  3NZU A;  4U96 D;  4ZDT A;  2L7P A;  4IUL A;  5FEY A;  3EHN A;  3BG1 B;  5JJ7 A;  4GTP A;  3O47 A;  3T9K A;  1TN8 A;  5DIZ A;  4BEP A;  5EID A;  2YSJ A;  1V55 E;  2E61 A;  4ZHB A;  3BEE A;  5ANR A;  2QYJ A;  4R8P K;  3T8K A;  2FUI A;  2M85 A;  2YYR A;  1S0P A;  3LPZ A;  4HQD A;  4BT9 A;  2KWN A;  2QZA A;  1UN9 A;  1UJJ A;  3L1Z B;  4GZD A;  4YND A;  4IN3 B;  1DVP A;  3ZHE B;  2WQH A;  4XI9 A;  4DX2 A;  5EYA F;  3PZ2 A;  2IOL A;  3EU5 A;  1AWC B;  1MM2 A;  4G26 A;  1X4U A;  4PS8 A;  4ACK A;  3APC A;  3CK9 A;  3SHB A;  3CLJ A;  3L16 A;  3ZKJ A;  2E2E A;  3PUK A;  4PDX A;  4WUY A;  3HXB A;  4GTT A;  3DPY A;  2XB1 A;  3DPL R;  1D8D A;  1BI8 B;  2KWO A;  5JA4 D;  1L5J A;  3SNX A;  5CEC B;  2KKY A;  1TNU A;  2C2V S;  1K8K G;  4YAX A;  3ZYM A;  3RRM B;  2VJF B;  3DXM G;  5LKX A;  3IHY A;  4YAT A;  4HOQ A;  1FP0 A;  1HH8 A;  2H6I A;  5B1A E;  4X3G A;  3T7L A;  4W4U A;  2X6I A;  5A23 A;  1WFK A;  1YCS B;  4GML A;  3Q47 B;  4ILI A;  5LOZ A;  3T5X A;  3BUA A;  2EIM E;  4CZ2 D;  1FCH A;  5KWD A;  3O35 A;  1WDY A;  5H1V A;  3HCU A;  2I2O A;  4Q96 A;  3SUB A;  4TXP A;  2P9P G;  4YDW A;  3R7R A;  3DSX A;  4YC9 A;  5AAO A;  4HRL A;  3TGO A;  4DI3 A;  3PUQ A;  3FUL A;  3G2U A;  3ISM C;  1MHQ A;  3T5V A;  5FER A;  4BX8 A;  4F53 A;  3L54 A;  3R9M A;  3KDE C;  3VTX A;  2C2L A;  4J7W A;  2P57 A;  1Z5S C;  2VQ2 A;  3H7H A;  4RSY A;  4U0U A;  2WVI A;  5T3R A;  1DCQ A;  4BFR A;  3HCT A;  2EXU A;  1RZ4 A;  3PVL A;  5J90 A;  5JG6 A;  5BV0 A;  2LAU A;  5DBK A;  4APO A;  3U66 A;  3FY4 A;  5C2Y A;  3T6R A;  2RD0 A;  2IQC A;  2A4Z A;  2PL2 A;  3HIZ A;  4GNG A;  3Q7F A;  3ABL E;  2D8S A;  1E4U A;  1E8Y A;  3EIQ C;  4NUR A;  3IEG A;  5JMN D;  2Y1N A;  4OYS A;  3ZXP A;  5IY5 E;  4N4F A;  1H6K A;  3ZNG A;  3D9P A;  3LXU X;  1YMP A;  3FH7 A;  4DX6 D;  4BX9 A;  2ZGD A;  5ITZ F;  4A4B A;  3C3O A;  4R2Y A;  5G05 B;  3B7U X;  4I1A A;  4UP5 A;  5B77 A;  2I1J A;  2RI7 A;  5T4Y A;  2V0P A;  3I3N A;  1WIM A;  3FHE A;  4JHK A;  1H2T C;  2DSM A;  4PTB A;  3WXX A;  1UW4 B;  3D9O A;  4YAD A;  4AUQ B;  3PRE A;  4K5A B;  4I2W A;  4BHW A;  2GRQ B;  3V2O A;  4RLY A;  4TXQ A;  2BUG A;  2EIJ E;  3PZD A;  3IKO B;  3FTU A;  4FAD A;  4GMJ A;  3LY7 A;  4GU5 A;  2YUC A;  4CT4 A;  3AU5 A;  5CED B;  2IEJ A;  4I17 A;  2UY1 B;  5K3Q A;  2V5F A;  5H7P A;  3UM1 A;  2AVP A;  5FQ4 A;  4I7B A;  5FZS A;  3CHP A;  3SOU A;  3B95 A;  3E34 A;  3I4G A;  2WB2 A;  1BPO A;  2EGP A;  5G05 J;  3L11 A;  3HRA A;  3J5P A;  2YHO A;  4DJA A;  3UQ3 A;  2JLB A;  4XZ4 A;  4EHM A;  4GAA A;  3UKU G;  2DX8 A;  2ECW A;  4AIF A;  5CHE E;  3VK6 A;  2NYJ A;  3S7D A;  2X6F A;  2B0O E;  3N9O A;  3U4T A;  3EU9 A;  2QFC A;  4B0Z A;  2X6H A;  5EIL A;  4GCN A;  3I5P A;  4YAB A;  1EF1 C;  2LXM A;  3CIA A;  3OAW A;  4KT6 B;  3ZPJ A;  1HF8 A;  4P5O B;  5T8I A;  3RIB A;  2Y1M A;  3MV2 B;  4XEI G;  2LDR A;  3E4B A;  3ZUV B;  2WXH A;  2LO6 A;  3TWU A;  3MKQ A;  4WNG A;  4YVO A;  1E8X A;  2KXP C;  4GTQ A;  4UWG A;  1HYJ A;  4MRU A;  3TG5 A;  3FUM A;  2AXV A;  4HOR A;  5D0Q D;  2QY7 A;  4NIK A;  4LEU A;  3RO2 A;  3TWS A;  3Q15 A;  3L13 A;  3JQ1 A;  4O60 A;  2WXJ A;  4BSX A;  1HG5 A;  4I6G A;  2GRR B;  2VPE A;  3ZEF A;  3IBE A;  3FTW A;  4TUU A;  1Z6U A;  2F0Y A;  4B94 A;  1U2V G;  4WA6 A;  2LGK A;  3CK7 A;  2EIL E;  3KS2 A;  4FJZ A;  1OCR E;  3UI2 A;  2LGG A;  4N2S A;  5FTP A;  5G05 C;  2JMD A;  3FEY A;  2Y3A A;  4CEM A;  5CCL A;  3UX4 A;  4V3L C;  4HVB A;  4LNU D;  2PNN A;  1IYG A;  2XCC A;  2B6C A;  2CRR A;  2OEV A;  3E30 A;  3LJN A;  4LUN U;  4DLO A;  1MM3 A;  3DEO A;  4IYP A;  5CEA A;  3FUD A;  3C3R A;  3TWQ A;  5KH3 A;  2J8S D;  3SFZ A;  3PUJ A;  5G04 C;  5FQ7 A;  3RU0 A;  2L0T B;  4FC8 A;  4L2Y A;  3EB5 A;  2UY1 A;  4FP7 A;  3ONK A;  5FQ8 A;  4ZQL A;  5EIB E;  1OWP A;  4YDE A;  2C0L A;  1WAO 1;  2FO1 E;  2R5S A;  2MHK A;  1FT2 A;  5ENQ D;  2XS8 A;  4U8Y D;  2PQR A;  4Y6C A;  2KCL A;  2ION A;  4NAC A;  2X6K A;  1WEM A;  4FJY A;  3PZ3 A;  4AEZ C;  1OUV A;  1HS6 A;  4L58 A;  3G2W A;  4AYC B;  3LY9 A;  1P5Q A;  1ZBD B;  1WEV A;  4AY6 A;  2CHZ A;  4N5C A;  2KC7 A;  3RPG C;  1HG2 A;  3ZTG A;  4AP4 A;  3LEW A;  3SI5 A;  4O64 A;  2WXQ A;  5AYW D;  4HRM B;  2XRZ A;  3FTY A;  1MX4 A;  2QIC A;  5EYP F;  1BI7 B;  3SHF A;  3N9N A;  3ONL A;  1IHG A;  4UWK A;  1TNB A;  2WXL A;  3PNL B;  4R7L A;  3ZFW A;  1KLX A;  2IQJ A;  3KNV A;  2V8S E;  4W9R A;  2A5U A;  3SBS A;  2WMO A;  2GW1 A;  2JMI A;  3U64 A;  2GRP B;  4QF3 A;  4EBA G;  3TAX A;  3ZVY A;  1UG3 A;  1SVX A;  2QYU A;  2XZT G;  3PE4 A;  2KCK A;  3LCA A;  4S3O C;  2HYZ A;  5BXU A;  5KJL A;  1BLX B;  3CVX A;  4MLP A;  2KGG A;  4N3W A;  1ELR A;  2LAI A;  3HHM A;  4IC2 A;  4U8H A;  2VJE A;  3EDT B;  3FTX A;  2YIN A;  4GA1 A;  4OGE A;  2QJ0 A;  3ASL A;  2LRI C;  4KXK B;  3C98 A;  2ECJ A;  2L5U A;  3LVQ E;  3TWV A;  4ANU A;  2Y4T A;  2R03 A;  2CHW A;  5H1U A;  4B8C B;  3L08 A;  3MYV A;  3D9M A;  3ULE G;  1LF8 A;  5JJ6 A;  5AIT A;  1EPU A;  3HXC A;  4UWF A;  1WY6 A;  4UP0 A;  2I9C A;  3O36 A;  5G04 B;  3L22 A;  2L0B A;  2Q7F A;  3GV4 A;  3UMV A;  4TKP B;  4OAU C;  3DDT A;  3CK8 A;  4C48 B;  3HXF A;  3L9T A;  4FHK A;  4JC8 A;  1TR4 A;  5KNG A;  4FHJ A;  2LQ6 A;  2MKE A;  4GND A;  3UM0 A;  2YQM A;  3GYZ A;  5D1M B;  2MT5 A;  4J0U A;  3MA5 A;  4RVB A;  1IXV A;  4GA2 A;  3U3W A;  3APD A;  4A1G A;  2LNI A;  4XKB A;  4AV7 A;  3ZXS A;  4G11 A;  3MCX A;  3TXM A;  2YW8 A;  3UKR G;  3FUJ A;  3SZ7 A;  2XEE A;  2L75 A;  1E7U A;  3PLW A;  3C5R A;  2CKL B;  4CCA A;  4UUC A;  4JA9 A;  5B75 A;  1MJ0 A;  4A0C D;  5ENT D;  3FFL A;  4X8Q A;  4J8F A;  1HU3 A;  1RMD A;  1WES A;  3KV6 A;  1OT8 A;  3FJU B;  2R59 A;  3KV5 A;  2VPD A;  4LKA A;  2AW6 A;  3RK6 A;  3VLD A;  1IKN D;  3DBS A;  3KEZ A;  2HO1 A;  4KMO A;  5HKP A;  3PEU B;  2VTB A;  2FO7 A;  4PPE A;  2J4D A;  4CDM A;  2PM7 A;  4NN2 A;  1O1R A;  2Y69 E;  2L6J A;  3CV0 A;  3FU5 A;  1RW2 A;  3CGH A;  2QC9 A;  3FUK A;  4C9B B;  1OCZ E;  4ME2 A;  3ASN E;  5ARF A;  2CFZ A;  1SA5 A;  1XNF A;  3ASF A;  4K0R A;  5BV1 A;  2ETB A;  4WZ2 A;  3LJ3 A;  5G04 J;  1N4P A;  3RO3 A;  2KR4 A;  2IOS A;  1FT1 A;  5TDR A;  4JEU A;  5KCM A;  2WXI A;  1LD8 A;  3PH0 C;  4K5B A;  3KEA A;  4FA6 A;  2ZIS A;  4HI8 A;  5B78 A;  1IYM A;  4C0M A;  4M3O A;  2UZG A;  3QAR A;  4E6H A;  2XP0 A;  2ZGG A;  3ZN3 A;  4G2V A;  4DPR A;  3UIN C;  4U0Z A;  4ATZ D;  2HDP A;  3ABM E;  4C0E A;  3ASH A;  3E37 A;  3OXF A;  3UM3 A;  5CMY A;  5I3L A;  1NP7 A;  4U63 A;  5DIN A;  2V4H C;  1TJC A;  2XQ0 A;  4GTV A;  3DRA A;  5EN5 D;  3Q7A A;  2L9B A;  4L1B A;  1D8E A;  3B13 A;  1N94 A;  2CSY A;  3PE3 A;  3EIJ A;  4XI0 A;  2RR4 A;  1LDK C;  3D9L A;  2LUH A;  4LJN A;  4MKT A;  1WEE A;  3CVL A;  2J4B A;  3AG4 E;  1HXI A;  4Y6W A;  4Z0O A;  5FIO A;  3FH8 A;  4G23 A;  1TJF A;  2K16 A;  4UWH A;  5EKQ D;  1VDY A;  4JB8 P;  1CHC A;  4PS3 A;  4GB0 A;  2J49 A;  3QWP A;  5LCW J;  1X4J A;  1ZU2 A;  4QFV A;  3CVN A;  2KU3 A;  2ECG A;  3VLE A;  4G8K A;  4I6J A;  2BKK B;  2VSO E;  3D9H A;  4JD2 G;  4TUM A;  3RSE G;  2KIZ A;  3TWW A;  5AQB A;  3DQV R;  4KBQ A;  3ZVZ B;  3UM2 A;  3ESK A;  3LS8 A;  2G43 A;  4HNA D;  4Q69 A;  2VPB A;  4UI9 B;  5CCM A;  1A17 A;  3LJU X;  2KKX A;  2CG3 A;  4BES A;  3UT8 A;  4CDR A;  3ASD A;  2XOC A;  4FIP A;  2G45 A;  4B7Y C;  4DX7 D;  4KYO B;  4ILH B;  4U07 A;  4LLB A;  3CVV A;  3MV3 B;  3CVQ A;  3V43 A;  4DI4 A;  4OGC A;  1FBV A;  2X6J A;  2M1R A;  5SVY A;  1N95 A;  4GYY A;  3KQI A;  4G1T A;  4AOF A;  2I1K A;  4BSZ B;  1X5B A;  4C9Z A;  2MIQ A;  2Y0B G;  4HOT A;  4GZ5 A;  5C13 A;  3G2V A;  4L23 A;  5G0F A;  5KBA A;  3PZ1 A;  2ECN A;  2VPG A;  3B7R L;  1LDJ B;  3L17 A;  1BOR A;  5JHB A;  3MHH A;  3PZ4 A;  4G24 A;  2H6G A;  2RSD A;  2H0D B;  3JCK C;  3AG2 E;  4AM9 A;  5ENP D;  3RRN B;  2AWI A;  3S2A A;  3RPG B;  3NAW A;  2LGL A;  4E85 A;  3PEV B;  3MZL B;  3LDY A;  2CSZ A;  3UT4 A;  5LCW C;  4MBG A;  3SOX A;  3Q79 A;  5ENO D;  3VLF A;  4FLH A;  4JW1 A;  2PZI A;  3C72 A;  2E6R A;  5AQ9 A;  3U9W A;  4GYO A;  5HS0 A;  3UPV A;  5ENS D;  1DNP A;  4A3T A;  3HTK C;  5HRY A;  4GA0 A;  3FAN A;  4YVQ C;  3FUI A;  1H19 A;  1JCR A;  4G8L A;  3URZ A;  3B7T A;  2NC9 A;  2P9N G;  2GGF A;  2XGO A;  1TN6 A;  5BW8 C;  1HE8 A;  3JXJ A;  1E90 A;  4ILG A;  1INZ A;  2IU1 A;  2GRM A;  4GZ6 A;  2J08 A;  4IC3 A;  3AS8 A;  4L9P A;  3FU3 A;  2D8U A;  1G25 A;  2RFM A;  5LKU A;  4PS7 A;  4GZC A;  4UI9 C;  5FZQ A;  5AIU A;  2VJ8 A;  4GYW A;  4B93 B;  3DWL G;  4BWR A;  3V31 A;  3FM8 C;  2VSN A;  4Q6F A;  2R02 A;  3UXG A;  3LQJ A;  4FU3 A;  3DSS A;  3SBT B;  4ACL A;  3IXE A;  1Y8M A;  4U7E B;  1HFA A;  2DZO A;  2L0I A;  4OAV B;  2CSV A;  3MJW A;  1H6O A;  4ZUX U;  1JPL A;  2IF4 A;  4CGV A;  5SVI B;  3ZYK A;  5CBN A;  4WZ0 A;  4GTS A;  5ANL A;  3L6A A;  5ENR D;  3FAO A;  1V54 E;  4U95 D;  1OCO E;  4DLQ A;  3JQ0 A;  3QK0 A;  2Y1L E;  2R17 C;  3MHS A;  3GZ1 A;  4YBS A;  4KVM A;  5SVX A;  2WXK A;  5H1T A;  4KZ0 A;  1O5M A;  2KBX A;  3C6W A;  2P9I G;  4A63 B;  4CT0 A;  4GPM A;  3RTR B;  4UI9 K;  3GZ2 A;  4JHR A;  2FBN A;  3RKV A;  3NG2 A;  2KGI A;  3KAE A;  1W3B A;  4F1P A;  2JRJ A;  4I9C A;  4ANW A;  1JCQ A;  3V2X A;  1SQM A;  4QQI A;  1N9A A;  1FVH A;  2AXZ A;  3M62 A;  2CRW A;  1EDU A;  4BT8 A;  1UOH A;  3BG0 B;  4J8E A;  1UJK A;  2XEV A;  3N9Q A;  1OWM A;  4LCT A;  4DK5 A;  4P29 A;  4DUI A;  3U5O A;  1QQE A;  3ESL A;  3SOW A;  2J9Q A;  2F8X K;  5HI7 A;  2EIK E;  5TDW A;  5TBN A;  3JUI A;  1NL4 A;  3W9G A;  3EHQ A;  5AJD A;  2CON A;  3QDN A;  2MA6 A;  3CR3 A;  3RRU A;  5H9M A;  4JPS A;  1XWH A;  5J08 A;  4TRQ A;  3ZHE A;  2WMN A;  2YQ8 A;  1JWF A;  2WXF A;  2VSY A;  2ECV A;  2QIZ A;  2ETC A;  4XKC A;  2NSZ A;  4HS2 A;  3QWW A;  1TEZ A;  4F7A A;  5LX8 A;  1NA3 A;  4RG9 A;  2HYE D;  5BXO A;  5CMW A;  4JHJ A;  3DSV A;  3CHO A;  2XPY A;  3ZRH A;  3NOG D;  2AJA A;  2P2C P;  3AAA C;  3JXI A;  4O1P A;  5DKA A;  3CQG B;  5D1L B;  5FIN A;  4Q94 A;  3ZGQ A;  1ELK A;  1X81 A;  3P1U A;  2LSU A;  4I1O B;  2ILR A;  3Q78 A;  3CEQ A;  4LG6 A;  2MNZ A;  4WNF A;  4BTA A;  3EJN A;  4MVT A;  4F52 B;  2WXO A;  3E32 A;  3O7A A;  2WXM A;  2H0D A;  5D1K B;  3ZNI A;  4AP2 A;  3HCS A;  1NI1 A;  1MQS A;  4XE0 A;  3BQO A;  3PRZ A;  2MD7 B;  5M72 A;  2BAY A;  3NOC D;  3HVE A;  3AJI A;  1GW6 A;  4WWN A;  2V4L A;  3KSQ A;  4UWL A;  5LCW B;  4N3C A;  1JM7 A;  3SF4 A;  2HR2 A;  1S63 A;  5AQ7 A;  2FEZ A;  3OTN A;  2DIW A;  2FSA A;  3MX3 A;  4HOS A;  2VGX B;  3AG3 E;  4LNB A;  3PHD A;  5ARG A;  3ASG A;  1U6G B;  2Y43 A;  3HVE B;  1SZA A;  2DVW A;  4I7D A;  4UQX A;  3Q73 A;  3I2D A;  4GB9 A;  2WXG A;  4LK9 A;  5B76 A;  3Q9N C;  1HZ4 A;  5ENN A;  5FWQ A;  2YRE A;  3EHM A;  2KZT B;  1N87 A;  3HDX A;  3B7S A;  5LKT A;  2OXQ C;  2CHX A;  3DXK G;  4DX5 D;  4V3K C;  3HXE A;  3S7F A;  2P9K G;  2MOW A;  2X38 A;  2J07 A;  1E96 B;  3ABK E;  1Z3X A;  1KT1 A;  2AXU A;  3L1X A;  2LXH C;  4F1S A;  4YBT A;  3UUX A;  2CFU A;  4URK A;  3DSU A;  3QOU A;  1OWO A;  1O1S A;  2IO2 C;  2P58 C;  3C3Q A;  2EGM A;  3RAU A;  3QJZ A;  2FD4 A;  3Q4A B;  3LVR E;  3P2B A;  1Z2Q A;  4AJW A;  2VP7 A;  3U5P A;  2X3M A;  3AU4 A;  2ZIR A;  4NQ0 A;  5CBO A;  4JL0 A;  4CGW A;  4GNF A;  3D9I A;  3QKY A;  3NF1 A;  2HM8 A;  4B86 C;  2DYS E;  4KVO A;  5D0O D;  1QYM A;  1JWG A;  4LNG A;  3CKB A;  3FEX A;  1N0Q A;  5FZR A;  5A7D B;  2M6M A;  3R7Q A;  2VSX E;  5BT1 A;  1V87 A;  2JM3 A;  3HG0 D;  4TXR A;  2XZD G;  2OCC E;  1N4S A;  4ABN A;  1LD7 A;  4JA7 A;  4PH4 B;  3DWD A;  5FJY A;  3O48 A;  2MNY A;  1U3C A;  1WEN A;  4ATG A;  4HBD A;  3FTV A;  2IO3 C;  3OXL A;  4F6R D;  3NBN B;  3APF A;  1H2U A;  3Q49 B;  4WAF A;  3FTZ A;  3E2D A;  2WM9 A;  3GW4 A;  1T1H A;  4M7C A;  4D10 C;  5KH7 A;  2K4D A;  4GCO A;  3PS6 A;  4XIF A;  1WE9 A;  3O37 A;  3UT7 A;  4RQI A;  2DYR E;  3Q5M A;  1NZN A;  5C1D A;  4PUC A;  2ECT A;  1IHB A;  3MEK A;  4HFG A;  3CVU A;  2YSM A;  1JUQ A;  4XI1 A;  2DCP A;  4U8V D;  5LKZ A;  4FLB A;  2MD8 C;  4EBA A;  3LQI A;  4TV3 A;  2VGY A;  1LTX A;  1OWN A;  2XRY A;  2F8Y A;  5BPP A;  2XOZ A;  3V30 A;  4DX1 A;  5E76 A;  1TYQ G;  3TJP A;  3ZYQ A;  3LDZ A;  1NFI E;  1TNO A;  4CDN A;  4FJC A;  2FF4 A;  2KZT A;  3FUN A;  4K03 A;  4J8S A;  3LY8 A;  4A4C A;  2V5Q C;  4O6F A;  3ML8 A;  1B89 A;  3M63 A;  3S7B A;  3ZIM A;  3QZV A;  1N0R A;  2NAA A;  3TWX A;  4O1O A;  4OVV A;  2FI7 A;  3FU6 A;  2DJA A;  3D9J A;  5D2M C;  3LRQ A;  3Q1D A;  2LV9 A;  1KZO A;  4AXH A;  3PUR A;  3O4Z A;  2OWA A;  4I2Z A;  4WZ3 B;  3EUV A;  1TNY A;  1K1A A;  2GRO B;  4GPK A;  2F6J A;  3NZS A;  5FB0 A;  3PNT B;  2XPZ A;  3CKC A;  4JZY A;  3VTY A;  3B7B A;  4N39 A;  2XPI A;  3ZYL A;  1TN7 A;  1K2F A;  4V3I A;  1NA0 A;  4YBM A;  3QWV A;  4WND A;  2YT5 A;  4G25 A;  4WNE A;  2YHE A;  3CHR A;  2KAT A;  1HX8 A;  1WEW A;  2OVF A;  4GMR A;  4IRU A;  4AVX A;  3DEP A;  2R05 A;  1HO8 A;  4ZFH A;  4QF2 A;  2VTB B;  1XGW A;  3NQP A;  3SO8 A;  2M3H A;  2RKK A;  2VJF A;  2KFT A;  2ZXW E;  2L43 A;  1N54 A;  3OXG A;  1WEU A;  2KWK A;  2LXP C;  2JEK A;  3ULQ A;  5LP0 A;  5AQA A;  1WIL A;  2YUR A;  2XGM A;  4F3V A;  3QNK A;  2IY0 C;  4A49 A;  1WEQ A;  3MGB A;  1MBM A;  4HRN A;  2MA5 A;  3U5N A;  2LGV A;  2PNX A;  1HYI A;  5BUZ A;  3E33 A;  3N9M A;  4GTO A;  1A5E A;  4OVU A;  3IHV A;  4R7E A;  2PQN A;  4XX5 A;  2DZN A;  3D3M A;  2F6N A;  3LQH A;  1ZBP A;  4K5C A;  2K1J A;  1U3D A;  2I50 A;  4N3B A;  2RFA A;  3RJV A;  2KCV A;  3ZW3 A;  3N9P A;  1QNF A;  3FU0 A;  1N52 A;  4HI9 A;  3TWT A;  2L80 A;  4MSX A;  4BET A;  1PC2 A;  1IQU A;  1JOC A;  3AG1 E;  5KH9 A;  3ML9 A;  4H7X A;  4BTB A;  3D9K A;  5FQ6 A;  3JYS A;  3TWR A;  1Z6T A;  5TAB A;  2ZU6 B;  4ANX A;  1SW6 A;  1QZ2 A;  5CER B;  3LYA A;  3CVW A;  2WQ6 A;  3JUE A;  3ENE A;  1DC2 A;  1D9S A;  2YVR A;  1DCE A;  5AEN A;  3DST A;  2XEU A;  3UTM A;  3C5K A;  2XEH A;  2OEW A;  4LRZ A;  2RG8 A;  5BNW A;  3X2Q E;  2ECI A;  4Z0R A;  3Q9U C;  5B8D A;  3MDB C;  1N4R A;  2VJE B;  3W9F A;  2MYO A;  4EZL A;  3QB2 A;  4N3A A;  3Q75 A;  5C11 A;  2WQ7 A;  4HLE A;  2JMJ A;  2Y4U A;  2VGX A;  3MKR A;  1E8Z A;  2NXP A;  2M63 A;  3ZPV 1;  2WXP A;  1EYH A;  4FO9 A;  1ELW A;  3CQC B;  4JVS A;  2KM4 A;  5EX3 A;  3D9N A;  4HLL A;  3NB2 A;  4LSZ E;  1YA0 A;  1ZB1 A;  1Z60 A;  4GNE A;  2FUL A;  2E0I A;  2BF0 X;  3SY2 A;  3TG4 A;  3GL6 A;  2OVB A;  2EA6 A;  4H7Y A;  4L7X A;  3IV0 A;  2H6F A;  1H2V C;  2DWZ A;  3CVY A;  4J8Y A;  4I6E A;  1Z3Y A;  3O33 A;  2E6S A;  3CST A;  1WGM A;  1E7V A;  2F37 A;  3FWV A;  2C0M A;  3DPD A;  4I1M A;  2P9S G;  4MS6 A;  4DRX E;  4WWO A;  3CVP A;  5FT9 A;  3F6Q A;  4L2L A;  4HXI A;  1FVF A;  3CHM A;  3SFY A;  3DSW A;  5G2N A;  4BER A;  5EDS A;  4N2Q A;  1H0A A;  5CRU A;  1K1B A;  3N71 A;  2GRN B;  3SD5 A;  4A3V A;  3CHQ A;  2XCB A;  2WXR A;  4L7T A;  2CT2 A;  4H9D A;  1N4Q A;  3SFX A;  4GTR A;  3ZVV A;  5A6C A;  1G3N B;  1PAQ A;  3FUH A;  3WG7 E;  2UWJ G;  4WWP A;  1FPP A;  4EZK A;  2JAB A;  4S3O B;  4RG6 A;  1KPS B;  4JEH A;  3O70 A;  4HB5 A;  1SZ9 A;  2M13 A;  1JCS A;  3K9I A;  4UI9 J;  5AJL A;  5D66 A;  2CKL A;  4BY6 A;  3FEH A;  5EYL A;  3V79 K;  1OY3 D;  4YDO A;  1F62 A;  4Z68 A;  3FUE A;  1MX6 A;  4HOU A;  2A5E A;  4J6I A;  1H6P A;  2P9L G;  4FK5 A;  3J5Q B;  2VYI A;  2R2L A;  2DBA A;  1N11 A;  1TNZ A;  4GTM A;  4UQZ A;  1KT0 A;  2PM6 A;  3KSL A;  2YHN A;  2OOE A;  3G2S A;  5EX0 A;  3KD7 A;  4I9E A;  5B1B E;  2LN0 A;  2F42 A;  4JXT A;  2G6Q A;  3FP3 A;  5CRV A;  3BU8 A;  1MX2 A;  1OXJ A;  5TRB A;  2IFU A;  1K3Z D;  1AP7 A;  2YNQ A;  4CA1 A;  1IQR A;  5B3S E;  1MYO A;  4N5Q A;  2LAH A;  4AYC A;  4EZJ A;  4I43 A;  3CSF A;  3FH5 A;  5FB1 A;  3LKU A;  2GRL A;  3UIP C;  2MUM A;  4EPZ A;  3T8M A;  3PDN A;  3FL2 A;  3TXN A;  2YU4 A;  1E8W A;  2AN6 A;  1JM7 B;  3ZPV E;  3G2T A;  5SVI A;  1OCC E;  4LER A;  4LAD B;  3SGH A;  5HQ8 A;  1Q2Z A;  2I6H A;  4A55 A;  1X4I A;  1UN8 A;  1BD8 A;  1BU9 A;  4APF A;  2BTD A;  2KE1 A;  5AIJ A;  3ASO E;  3IHP A;  3O34 A;  4NRH B;  1MZC A;  4U04 A;  5G55 A;  3ULY A;  4U0S A;  5JHA A;  4FUL A;  4I7C A;  5J3X A;  2XS1 A;  4J8D A;  2MRI A;  2PUY A;  5KJM A;  3HXD A;  2YQL A;  2OV8 A;  2FFW A;  2ZET C;  4A1S A;  2IDA A;  3EB6 A;  1O1T A;  1S64 A;  2BKG A;  4B8A A;  2L6B A;  2LXL A;  1S70 B;  1WM5 A;  5LFA A;  2YHC A;  3N9L A;  4B89 A;  2XHE A;  1OWL A;  2J09 A;  4BBQ A;  1WEO A;  2VNF A;  3AS4 A;  4KZC A;  2HE0 A;  2K17 A;  2XOY A;  2FUU A;  5AN8 A;  3UIO C;  4CYM D;  2EQX A;  3FDH A;  4AY5 A;  4YDY A;  1QBQ A;  3SQV A;  2WPV A;  1YYH A;  3QC1 A;  3M7K A;  3U5M A;  5KJK A;  2BED A;  1VYX A;  2VGE A;  2EIN E;  5KJN A;  2XGS A;  5E75 A;  3M99 A;  2KYU A;  3QAQ A;  1VD4 A; 
#chains in the Genus database with same CATH homology
 4OAU C;  1N0R A;  1AP7 A;  1BI8 B;  5AAR A;  3TWX A;  3DDT A;  4O1O A;  5JA4 D;  1MYO A;  2F37 A;  4N5Q A;  4HI9 A;  3TWT A;  2XEN A;  4K5B A;  3KEA A;  4C48 B;  5CEC B;  1WG0 A;  4HI8 A;  2KKY A;  4BET A;  4DRX E;  2DJA A;  1TR4 A;  2KXP C;  5KNG A;  4DX7 D;  2MKE A;  1QYM A;  3Q1D A;  3F6Q A;  2D8U A;  2XP0 A;  2RFM A;  3TWR A;  4DUI A;  2ZGG A;  1SW6 A;  5CER B;  1N0Q A;  2OWA A;  4OGC A;  4BER A;  3NOC D;  3JUE A;  4ATZ D;  3AJI A;  1DC2 A;  1D9S A;  1IXV A;  2JUN A;  4O62 A;  1K1A A;  4B93 B;  2F8X K;  2YVR A;  3V31 A;  3ZU7 B;  3FM8 C;  5SVY A;  1K1B A;  5SVI A;  4K5A B;  3UXG A;  2JM3 A;  3HG0 D;  4HRM B;  5KNH D;  4NIK A;  3V2O A;  4RLY A;  3B7B A;  2XZD G;  5AQ7 A;  1MX4 A;  1YCS B;  3W9G A;  3EHQ A;  3TWS A;  5EYP F;  3IXE A;  2CON A;  2XEE A;  4BSZ B;  3EHR A;  1BI7 B;  4QQ4 A;  2V4H C;  4O60 A;  3UTM A;  2DZO A;  3PLW A;  4H9D A;  4CZ2 D;  3C5R A;  2Y0B G;  1BD8 A;  2XEH A;  4OAV B;  1BU9 A;  4UUC A;  3DWD A;  5CED B;  2CSV A;  5KBA A;  5KWD A;  5EN5 D;  1WDY A;  1G3N B;  1MJ0 A;  4HBD A;  5SVI B;  5CBN A;  3SUB A;  5ENT D;  4Z0R A;  4F6R D;  3NBN B;  5K3Q A;  3Q9U C;  4GMR A;  2ETA A;  3MDB C;  3DEP A;  2JAB A;  4U96 D;  2DVW A;  2IQJ A;  3UI2 A;  2L7P A;  5ENR D;  4YDW A;  4ZFH A;  2RR4 A;  4HB5 A;  4U95 D;  2M13 A;  3W9F A;  3T9K A;  3O47 A;  4BEP A;  3E2D A;  5EID A;  5ENP D;  3B95 A;  2MYO A;  3Q9N C;  1OT8 A;  3SO8 A;  3FJU B;  2E61 A;  5D66 A;  2YRE A;  2FFW A;  5AAO A;  3FEH A;  2ETC A;  3HRA A;  5EYL A;  4ZHB A;  3V79 K;  4HRL A;  1SVX A;  2QYJ A;  2PNN A;  2Y1L E;  4LNU D;  3J5P A;  2XZT G;  1IKN D;  4Z0O A;  1OY3 D;  5FIO A;  2BKG A;  3T8K A;  3LDY A;  5BXU A;  2CRR A;  2L6B A;  3LJN A;  5AQA A;  4JB8 P;  4Z68 A;  1BLX B;  1MX6 A;  1S70 B;  4DX5 D;  2A5E A;  5BXO A;  3DEO A;  5CEA A;  5SVX A;  5ENO D;  3KDE C;  2KBX A;  1IHB A;  4QFV A;  5HKP A;  4J7W A;  3TWQ A;  2P57 A;  4A63 B;  4HQD A;  2J8S D;  5AQ9 A;  3H7H A;  3NOG D;  2AJA A;  4GPM A;  1DCQ A;  3J5Q B;  2EXU A;  5HS0 A;  2P2C P;  4U8V D;  4HRN A;  4G8K A;  2NYJ A;  2HE0 A;  1N11 A;  3AAA C;  4OGE A;  5ENS D;  5EIB E;  3JXI A;  2LAU A;  4O1P A;  2BKK B;  3D9H A;  4HLL A;  4TUM A;  2XOY A;  5AN8 A;  2B0O E;  2F8Y A;  2FO1 E;  4CYM D;  4LSZ E;  5HRY A;  5FIN A;  3V30 A;  3TWW A;  2XOZ A;  3EU9 A;  4DX1 A;  2QC9 A;  4YDY A;  3TWV A;  4F1P A;  1A5E A;  4DX2 A;  3LVQ E;  5AQB A;  5EIL A;  1AWC B;  1YYH A;  5ENQ D;  3V2X A;  3M7K A;  4G8L A;  4HNA D;  1NFI E;  5JMN D;  2EGM A;  2VGE A;  4U8Y D;  4LG6 A;  4QQI A;  3ZKJ A;  2DZN A;  2FD4 A;  3LVR E;  2CRW A;  2V5Q C;  3LJU X;  3ZNG A;  2KKX A;  1MX2 A;  4K5C A;  4BES A;  2DWZ A;  1YMP A;  2ETB A;  1K3Z D;  2RFA A;  2ZGD A;  4DX6 D;  5ITZ F;  3ZUV B;  4J8Y A;  5CBO A;  3JXJ A;  3TWU A;  2XOC A;  1UOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...