2B0OE

Crystal structure of uplc1 gap domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
264
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords UPLC1
publication title Structural analysis of GAP and ankyrin domains of UPLC1
rcsb
source organism Homo sapiens
total genus 82
structure length 264
sequence length 265
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2b0oE02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2b0oE01
2A5EA 2ZGGA 4A63B 4YDWA 3TWSA 3FM8C 4Z68A 4RLYA 5EN5D 5AARA 2XEEA 4LSZE 5CBNA 3Q9UC 3W9FA 3NOGD 4YDYA 3NOCD 4U95D 4K5AB 4QFVA 1SW6A 4F6RD 3O47A 2ETAA 4DX7D 3AJIA 2HE0A 4HLLA 3C5RA 5CEDB 4K5CA 1YCSB 2AJAA 3DEPA 5HRYA 4BSZB 4J8YA 3SUBA 5ITZF 4B93B 1MX2A 2BKGA 2F8XK 4ATZD 4C48B 3ZUVB 4HRMB 5ENTD 2CRRA 4LG6A 5AQAA 1MYOA 3TWVA 3FEHA 2MYOA 4OAUC 2CRWA 3J5PA 2NYJA 3TWUA 1TR4A 3TWRA 1N0RA 5CERB 2FO1E 4HRLA 4U8YD 5ENPD 4BETA 4CZ2D 2DVWA 3D9HA 2VGEA 3V31A 1K1BA 4BERA 3F6QA 4F1PA 3EU9A 4JB8P 2XENA 5HS0A 3V30A 3T8KA 2JABA 3TWQA 1IHBA 2F8YA 4O1OA 2XZTG 3HRAA 3B95A 3EHRA 4HNAD 5D66A 3TWTA 3UXGA 3JUEA 5FIOA 3LJUX 5JA4D 3J5QB 5EYLA 3DEOA 3LVQE 2QC9A 4GPMA 2OWAA 5KBAA 2V4HC 3KEAA 1SVXA 4HB5A 4ZHBA 4HRNA 3LVRE 3JXJA 1BI7B 4DX6D 2IQJA 5HKPA 1A5EA 4HI8A 5BXUA 5EIBE 3AAAC 4HBDA 1S70B 1MX6A 2P2CP 4G8LA 4U8VD 4DRXE 2ETBA 2V5QC 3UI2A 3ZKJA 5CEAA 4UUCA 1IXVA 1MJ0A 3B7BA 2KXPC 4DUIA 3W9GA 1BLXB 5AQ7A 3V79K 3V2XA 1N11A 2RFMA 3EHQA 1QYMA 1BD8A 2DZOA 3IXEA 3TWWA 4GMRA 4QQIA 2Y1LE 4O60A 5EILA 4OAVB 3DWDA 3HG0D 1DC2A 2DZNA 2BKKB 4BEPA 1BI8B 5ENOD 3Q9NC 3V2OA 5AAOA 4HQDA 2J8SD 5CECB 3NBNB 1BU9A 3ZNGA 4G8KA 5ENQD 3UTMA 1OT8A 2KBXA 3T9KA 5EYPF 2QYJA 3JXIA 2RFAA 1UOHA 4O1PA 1NFIE 5ENRD 5KWDA 5KNHD 4DX2A 5EIDA 3ZU7B 2B0OE 2PNNA 5BXOA 1G3NB 4N5QA 1WG0A 2ZGDA 5FINA 5AQ9A 1IKND 4U96D 2XZDG 1N0QA 4LNUD 4TUMA 1YMPA 1K3ZD 1AP7A 4ZFHA 5AN8A 1AWCB 4NIKA 4BESA 3SO8A 4CYMD 4DX1A 5KNGA 1YYHA 1D9SA 2P57A 1WDYA 1K1AA 5JMND 1DCQA 2DWZA 2ETCA 2F37A 4J7WA 4HI9A 2XEHA 5ENSD 5CBOA 3LJNA 5AQBA 1MX4A 1OY3D 3TWXA 3MDBC 4DX5D 2Y0BG 4K5BA 2L6BA
chains in the Genus database with same CATH superfamily
3HVEA 3TWSA 1EYHA 2LUHA 2XEEA 3PH0C 2EODA 3PREA 4QQ4A 2R5SA 3BUAA 2KZTA 3AJIA 1Q2ZA 3UIPC 3ZVZB 3CHSA 4JA9A 1E90A 1H6KA 3U66A 1Z3XA 3DEPA 3SZ7A 2LRIC 5DBKA 3TL5A 2PM7A 3G2TA 2F8XK 2UWJG 4CCGX 2JEKA 2LGLA 2WVIA 1PC2A 2CSYA 1MYOA 3DXMG 3CK8A 1TR4A 4GYOA 3UM0A 4O62A 2C0LA 4F1PA 2AXUA 2KGIA 2WXFA 4FJYA 3FP3A 2X38A 2WMNA 2RD0A 2MNZA 2BTDA 2GGFA 1VYXA 2M6MA 3MJWA 1SVXA 4ZHBA 3HCSA 2C0MA 5D1KB 3AAAC 3AG2E 3EUVA 2VP7A 2QY7A 1VFYA 4LJNA 2AN6A 5KH7A 2WB2A 2EGPA 3T6RA 3NB2A 4KZ0A 2F6NA 3FFLA 1NA0A 5LFAA 4LK9A 1QYMA 3M62A 5FQ6A 4B8AA 3DSWA 3FTUA 4J8EA 5ENQD 2H6GA 3JXIA 4C0MA 3C98A 2B0OE 3APDA 5H1VA 1WG0A 1QNFA 4EHMA 4TUMA 2LNIA 3DRAA 4L2LA 4RQIA 4EECA 3CGHA 2MNYA 4O6FA 1U2VG 2AWIA 4A0CD 1K1AA 3PUQA 4TUUA 1WIMA 4C9ZA 4UP5A 2V5FA 5G55A 3VLDA 2VNFA 2YINA 4PPEA 3T8MA 4DJAA 4I17A 3H7HA 5C11A 4IC3A 2YSMA 4A3VA 5EKQD 2JMIA 5ENNA 5ITZF 4NURA 5AYWD 2XRZA 4CDRA 3FDHA 2IO3C 2P9IG 3KSQA 4GCOA 2LAUA 2Y4UA 5LKTA 4BX9A 1BPOA 4WNFA 3BG0B 2LXMA 3NF1A 3MHSA 3EIQC 1IHBA 4HNAD 3LQIA 3DXKG 3EB5A 2M1RA 3SI5A 3DEOA 1N4QA 4F7AA 1RZ4A 4I7BA 2I50A 4U0UA 1RW2A 3T5VA 2EIME 1FP0A 2EIJE 4U8VD 3L1ZB 3PZ3A 5IY5E 3M63A 1ELRA 2KC7A 4JZYA 4A1GA 3N9QA 2KXPC 3GW4A 2YVRA 1V54E 4NN2A 3IXEA 4OAVB 4GMRA 3Q4AB 2E2EA 3HG0D 1H19A 2BKKB 3ULEG 4HOQA 1MHQA 4OVVA 3IHYA 4XX5A 3SFZA 4AOFA 2I1KA 2QYUA 4I6JA 3QZVA 1BORA 2I1JA 1WEMA 2IONA 4NRHB 2AW6A 5BV1A 3E33A 1UJKA 1TJCA 3D9IA 3SQVA 3K9IA 4AP4A 2E61A 5JMND 2DWZA 4APOA 3GYZA 3L22A 1MX4A 1INZA 2L6BA 3PNTB 2KIZA 5KJKA 3U3WA 1E7VA 2DSMA 2JRJA 4U04A 2EGMA 3SOWA 4CDMA 5B75A 3ABME 1H6OA 1ZBDB 2V8SE 3ASHA 1WE9A 3UM2A 1N54A 2LO6A 4WUYA 4A1SA 3LKUA 4V3KC 1O1SA 2R2LA 3DPLR 2MYOA 2H0DB 2WXQA 3Q15A 2ZETC 5BW8C 2KU3A 5G05B 4I2ZA 5B8DA 3U4TA 1LDKC 2L0BA 2UY1B 4CZ2D 2L5UA 5CHEE 4JB8P 3TWQA 3VTXA 3RPGB 1WEUA 4HOTA 3IKOB 3HXCA 1SZ9A 4MRUA 4BBQA 3MYVA 4ANXA 3QWPA 2Y1MA 3EHMA 3LEWA 1OWPA 4I43A 2KWJA 2BUGA 4FU3A 4PUCA 5BUZA 3L17A 3ML8A 3S7FA 3DSUA 2B6CA 3W9GA 3FUNA 4B7YC 4FK5A 2CSZA 1TYQG 3MV2B 2LGVA 4YDOA 3V2OA 3N9NA 4HQDA 1FCHA 2L0IA 4AY5A 3JQ0A 2Y1NA 1N4RA 2RFAA 3ASGA 5FZSA 5ENRD 4PS8A 5BV0A 3ONLA 4GTRA 5FQ8A 5LCWB 2HYZA 2ECJA 4LNUD 4KBQA 2YSJA 1AP7A 3SO8A 5KNGA 5JJ6A 4BETA 2L0TB 4LRZA 2M13A 3CVUA 4N3CA 3B7UX 4K5BA 3G2VA 3RIBA 5J08A 1X4IA 1FT1A 3NOGD 3LXUX 1Z5SC 4I1MA 4QF2A 1JM7A 3UKRG 1KPSB 3D9KA 5HRYA 4OGEA 3LY8A 2BKGA 1EDUA 3SD5A 3ZUVB 3ABKE 5ARFA 3CSFA 3CVQA 2VJFB 2DIWA 5AENA 1WILA 5FZQA 3V31A 4AY6A 3F6QA 3E4BA 3WXXA 4WNEA 2F8YA 5AIUA 2VPGA 1SA4A 4ACLA 3CHMA 3ZRHA 5H9MA 2X6FA 3GV4A 4NACA 3O33A 4EZJA 1O1RA 3Q49B 2XCBA 2LQ6A 2IQCA 2VSXE 3FEYA 4U0SA 2ETBA 2V5QC 1H0AA 2KATA 2CT2A 1IXVA 1MJ0A 3B7BA 3C6WA 4ANVA 4KYOB 5T4YA 2WXMA 4TRQA 4EPZA 1Z60A 2L9BA 5HQ8A 2KR4A 5B1AE 1BI8B 5AAOA 2P9UG 2QICA 3I5PA 4YBMA 3N9LA 3PZ2A 3ZN3A 5EIDA 5BXOA 4PS7A 4TKPB 3Q79A 4WWPA 5AQ9A 3ZW3A 4L9PA 5B3SE 2VTBB 4G23A 3L16A 4BX8A 2X3MA 2IO2C 3PURA 3DQVR 4XEIG 3ZYQA 3L82A 1OWOA 3TWXA 3SFXA 3CVXA 3JUIA 1E8WA 2L7PA 2CFUA 2LDRA 2MKEA 5D2MC 5LP0A 4ANUA 4GTPA 2DJAA 4NQ0A 5B79A 1FT2A 2ECWA 4GAAA 1OCZE 3MCXA 4B93B 4BWRA 2MD8C 1EPUA 2VSOE 2FUUA 2JLBA 2XQ0A 3G2WA 2LSUA 3QKYA 1UJJA 4ATGA 4GTMA 2IU1A 1MQSA 3UKUG 4HOSA 1FBVA 4WAFA 1UG3A 2KWOA 5G05C 5DINA 2J07A 2NC9A 2NXPA 3SY2A 2QC9A 4MS6A 3ABLE 2PUYA 3CLJA 1TN8A 3RPGC 1OUVA 4HI8A 5EIBE 2EXUA 3HCUA 1KLXA 1ELKA 2V4LA 3RAUA 1JWGA 4UUCA 4J6IA 1BD8A 5JHAA 2MRIA 2KYUA 5E75A 2DZNA 4JHJA 2VJEB 4Z0OA 5J3XA 4G2VA 3LJ3A 4KVOA 4GNGA 3RK6A 1KT1A 3ZNIA 5LKUA 3U5NA 1HF8A 2J4BA 3P1UA 5LCWC 2L75A 1KT0A 4N2SA 2I9CA 4UI9J 1MM3A 4RSYA 2NSZA 3UT7A 4GA2A 4GNFA 2VPDA 3R9MA 4F6RD 2VYIA 4DX7D 2FO7A 2KCKA 2OOEA 2R17C 3FUMA 4CGVA 3SBTB 5FWQA 1OCOE 4TV3A 4E6HA 3J5PA 3SOXA 2HDPA 2BEDA 3O4ZA 2KREA 4J8FA 4G25A 2VGEA 4XKBA 4GTVA 4LERA 3T8KA 4Y6WA 5EYLA 1F62A 3UM1A 2XS8A 3TAXA 2V4HC 3MV3B 1OCRE 5I3LA 3RRNB 2GRQB 3N9MA 4RG6A 3LRQA 1S70B 3DWLG 3FULA 3ZHEA 5A6CA 2DCPA 5EYAF 2J4DA 4Y6CA 5B1BE 2MIQA 1A17A 4B0ZA 3OTNA 4O60A 3N9OA 5ENOD 3DBSA 2D8UA 4YABA 1QZ2A 1OT8A 3CK9A 1UOHA 4FP7A 5KNHD 4H7YA 4URKA 2PNNA 3KSLA 5JJTA 3E30A 4HVBA 1JWFA 1TNYA 2DYSE 3Q75A 1T1HA 5LKZA 5KJNA 3APFA 3R9AB 4EBAA 3FEXA 2KWNA 5KJMA 3TXMA 1D8EA 1ZB1A 4BESA 3GL6A 2J9QA 4DX1A 4JD2G 2F37A 4F3VA 4A49A 3WG7E 3MDBC 2ZGGA 4Z68A 2K1JA 5G04C 5CBNA 4WWNA 1WGMA 4U95D 4AYCB 4WNDA 3FTWA 5JG6A 3FUJA 2G6QA 3ZPV1 2H6HA 4MLPA 1JCSA 4GZCA 4CT4A 1E8YA 4JXTA 4PH4B 2XPZA 4LG6A 2CRWA 3Q47B 2M63A 1LD8A 3SBSA 2VGXA 3RU0A 4JHRA 4GTQA 2K17A 1WFKA 2YHCA 5TABA 4BT9A 1WM5A 2L80A 2IF4A 3HXFA 3LPZA 3LVQE 4L23A 3HHMA 4AVXA 4EBAG 4AIFA 4DK5A 1N9AA 5SVXA 4ILGA 4GNEA 3JXJA 4N39A 1MZCA 3D9NA 1IQRA 4HBDA 3PUKA 3ULYA 3KQIA 3PEVB 1IQUA 3ZKJA 2GRLA 5FB0A 1BLXB 5AQ7A 4FJZA 4I7DA 3LS8A 3DWDA 3RSEG 3FU6A 2MA6A 4ZUXU 2P9LG 4R8PK 4JPSA 1H6PA 4G8KA 4AEZC 3I3NA 3KD7A 4GNDA 3R7RA 3B7RL 4GMLA 1U3DA 3HTKC 4L7XA 4J0UA 4CT0A 1JPLA 2PQNA 1ZU2A 2XCCA 4V3IA 2NAAA 1IHGA 4EZLA 3FM8C 3UQ3A 2KZTB 4FC8A 5AITA 1WY6A 4K5CA 1FPPA 4GYYA 1PAQA 3SUBA 4YNDA 5BPPA 4X3GA 4IC2A 2LXLA 4FHJA 4H9DA 5B76A 3ASLA 1N52A 5SVIA 5ARGA 3L1XA 5ENPD 2K16A 3ASFA 2WQ7A 5T8IA 4BERA 2XENA 4KZCA 4EQFA 4O1OA 2ZU6B 2RG8A 3PVLA 1H2TC 5CCMA 2KGGA 3APCA 4I7CA 2WM9A 3LDYA 4ANWA 1A5EA 4WA6A 1SZAA 4UI9K 4GB9A 1MX6A 2HO1A 4AXHA 2WXNA 4N3BA 5KH3A 2FFWA 2FEZA 2M85A 4P5OB 5C13A 2DBAA 3ZYKA 2RFMA 4GCNA 3TWWA 2E0IA 4CCAA 5FT9A 1UW4B 4XZ4A 5DKAA 3AU5A 3D9LA 3NBNB 2J8SD 2MT5A 4A4BA 1S64A 3OXGA 3PE4A 1TN7A 2KBXA 3O35A 4ACKA 2FULA 2ZISA 2PL2A 3AS8A 3FH8A 3QNKA 3PE3A 1IKND 5CRUA 3G2UA 4M7CA 4ZFHA 3ZPVE 1HO8A 3QJZA 5C1DA 1D9SA 5SVYA 3MA5A 1DCQA 1XGWA 2KE1A 2XEUA 4B89A 5DIZA 3ZXSA 4E85A 3FY4A 3AG3E 5FTPA 1KZOA 4LSZE 1W3BA 1XWHA 4BFRA 4YDYA 4YADA 2YUCA 4K5AB 2WMOA 1HG2A 3CVYA 3O47A 2ETAA 3RRMB 2WXKA 3C5RA 4HXIA 2LXHC 4W4UA 3GZ1A 2QJ0A 1NL4A 2CG2A 3O36A 2C2LA 3I4RB 2XRYA 4JEUA 2QIZA 4HRMB 2VGYA 3SFYA 4KT6B 4A4CA 3CK7A 3D9OA 2IY0C 5G2NA 3HCTA 4JVSA 4Q69A 1K1BA 4R2YA 1IYMA 3FHEA 4OYSA 4CDNA 2JABA 2XOCA 3HRAA 4U7EB 5D66A 3TWTA 3E2DA 2XS1A 2YHEA 5AJDA 1NA3A 4UWKA 2YQLA 3VK6A 4GTOA 3BEEA 3KEAA 3SF4A 2E6SA 2WXOA 3U5PA 3LY7A 4CEMA 4DX6D 4MSXA 3LCAA 3S2AA 5BXUA 2YQMA 3FUIA 1RMDA 3S7BA 3OXFA 2P9KG 4I9EA 3DSXA 2R59A 3P2BA 3EHQA 2Y1LE 3URZA 4KMOA 4JEHA 1Z2QA 2P57A 3AS5A 3ZNGA 4GB0A 5TRBA 4XIFA 5EYPF 2X6KA 1NFIE 2P9PG 4U8HA 1HU3A 3CQCB 1S0PA 5FINA 2HYED 2RR4A 3Q73A 2YU4A 2WXJA 1O1TA 3FTXA 4UWLA 4PTBA 3NQPA 2EILE 2HM8A 3CVNA 4IULA 2GRRB 5CBOA 4L2YA 2XEHA 3B13A 1JOCA 2WQHA 5AQBA 1X5BA 3C3OA 1EF1C 3FUEA 4RLYA 5FQ4A 2YHNA 3UMVA 4K03A 4FA6A 4R7EA 4MKTA 1TEZA 3ZTGA 4GZ5A 4R7LA 3UT4A 5G04B 4N5CA 2CRRA 1XNFA 3FU3A 2PM6A 4HFGA 4S3OB 2NYJA 2KKXA 4IRUA 1V87A 5FJYA 2IEJA 3AG1E 2JUNA 3B7TA 2J49A 3KEZA 2KCVA 3Q7AA 4V3LC 3QOUA 1H2VC 4LNBA 5LKXA 3UINC 1WEEA 5D0OD 1NP7A 3RKVA 4XI0A 3FUFA 2DX8A 3BQOA 4HRNA 3CVLA 1BI7B 4UI9B 2EIKE 2M3HA 3CVVA 3NZUA 2IFUA 1VD4A 3CV0A 4B8CB 5T3RA 2WXHA 2VSNA 3LYAA 1H2UA 2WXRA 3E37A 1ZBPA 1E8XA 4Z0RA 3CHQA 3VLFA 3CQGB 5CRVA 2YREA 3C5KA 1K2FA 4PS3A 4B86C 1JCQA 2XPYA 3BU8A 3TGOA 4G11A 2FSAA 2CKLB 1G25A 1G3NB 4LLBA 3D3MA 1DCEA 3ONKA 5CCLA 2E6RA 4L7TA 1FVHA 3ASNE 3MKQB 5CMWA 2YQ8A 3D9JA 4YVQC 1Z6UA 3VLEA 2FUIA 2IOLA 1WDYA 2LGKA 4J7WA 2XOZA 2YHOA 3QWWA 4AUQB 2Y0BG 3EHNA 5TDWA 2HR2A 4L1BA 3N71A 4GA0A 4ILIA 3Q9UC 4YBSA 4N3WA 2LXPC 3G2SA 3MGBA 2HE0A 5J90A 3KV6A 2YYRA 1MX2A 3OXLA 2KFTA 1E96B 2FI7A 1X4UA 1OXJA 2LV9A 4I1OB 3TWRA 5ANLA 2GW1A 5B78A 5KH9A 3EB6A 3D9HA 4OVUA 2X6HA 3PZ1A 3SNXA 3C3QA 5G0FA 1O5MA 2XP0A 2XZTG 4FADA 2GROB 5FIOA 3ZFWA 4WZ2A 2VPBA 3HYMB 4ZQLA 3EDTB 4CA1A 4FLBA 4CGWA 1TN6A 3C72A 3E34A 4G8LA 4JHKA 1D8DA 3ULQA 4U07A 4B94A 2EQXA 3X2QE 4DUIA 3LDZA 4H7XA 4UWFA 3RJVA 1HXIA 2IJGX 3PS6A 1HYIA 4ME2A 4I6GA 1HYJA 4HORA 2XOYA 4KVMA 1OWLA 3KNVA 3Q7FA 4N5QA 4UQXA 1CHCA 3FWVA 2XGOA 4ILHB 3FUDA 3U64A 2QFCA 3TJPA 5D1LB 1HE8A 2J09A 3QAQA 3JCKC 4GYWA 3ZIMA 1X81A 3HXBA 3UT8A 1WAO1 1OY3D 2F42A 2Y69E 4D10C 4UQZA 4JL0A 4WNGA 4JW1A 1SW6A 2GRNB 4HLEA 2BF0X 3ZYMA 2AJAA 4LKAA 1Z6TA 2I2OA 3MHHA 1OCCE 3FH5A 1KZPA 2OEVA 3ZPJA 2ILRA 4XE0A 2H0DA 2DVWA 3MZLB 2UY1A 2R03A 2CG3A 4Q6FA 4S3OC 2YNQA 2GRPB 4A3TA 5BT1A 1WEPA 2P9SG 3JUEA 2XB1A 5JA4D 2DYRE 3BG1B 3J5QB 3UX4A 5EDSA 3L6AA 5JHBA 4PDXA 2Y4TA 1Y8MA 3SHBA 1GW6A 4LCTA 3ASDA 4DI3A 5EX3A 1HH8A 2ZIRA 3FTVA 2AXZA 3NAWA 1WENA 4UI9C 4J8DA 2Y43A 2VSYA 3V79K 3UIOC 5EILA 1LF8A 3D9PA 2MHKA 4BEPA 3CEQA 3DSTA 2CSVA 4GU5A 3QC1A 3S7DA 4O1PA 2JMJA 2BAYA 3RO2A 3T7LA 3QK0A 2ZGDA 1QBQA 1V55E 2YURA 5TBNA 4AJWA 4GPKA 3IEGA 2OVFA 2ETCA 3JYSA 2KM4A 2OVBA 4UQYA 4FHKA 3PZ4A 3L11A 3FAOA 5LX8A 4A63B 4TXQA 2YT5A 4DPRA 3KS2A 2J08A 3ENEA 4ZDTA 5ANRA 2IOSA 3DPYA 4RG9A 4K0RA 4GZDA 3ZEFA 3AU4A 2IDAA 2VPEA 4J8YA 2GRMA 4F52B 2PQRA 2LN0A 4ABNA 3HVEB 2XPIA 5HI7A 2ECIA 3CHPA 2FO1E 1FVFA 3V43A 1N4SA 2VJFA 3FTSA 3L54A 4GTTA 4JC8A 5HS0A 3KV5A 3PEUB 3LY9A 3CIAA 3LJUX 1PY1A 1U6GB 4RVBA 4WZ3B 2L6JA 4Q94A 2D8SA 2OWAA 5KBAA 4HB5A 2WXPA 5EX0A 3ZHEB 3PRZA 4O64A 3KAEA 2R02A 4IYPA 1HS6A 3EIJA 3PLWA 2DZOA 2ONDA 3RO3A 1DC2A 4J8SA 2G43A 3O7AA 2MD7B 5D1MB 5CECB 3I2DA 1E4UA 3UTMA 3CVWA 2QYJA 4L58A 3ZU7B 1JUQA 4N3AA 2CONA 2P58C 4XI1A 2FD4A 3SOUA 3B7SA 3DSSA 4FULA 2VJ8A 4CYMD 3QWVA 3I4GA 1LTXA 3JQ1A 1YYHA 5H1UA 2VTBA 2RSDA 3FH7A 2PZIA 3QB2A 4I2WA 4BTAA 3O48A 2LGGA 2CFZA 2YW8A 2KKYA 3TXNA 1QQEA 5AARA 2I6HA 2R05A 2UZGA 1NI1A 4XI9A 4M3OA 4I1AA 1UN9A 1N87A 2ZXWE 5CEDB 3CKBA 3CVPA 1TJFA 4UP0A 1HFAA 2F6JA 1JCRA 1WEVA 2OCCE 4DLOA 3PNLB 5TDRA 1N0RA 2VGXB 4U8YD 2K4DA 1DNPA 2WQ6A 3ASOE 2ECTA 3EU9A 5AJLA 1S63A 2WXLA 5CMYA 5JJ7A 3IV0A 4W9RA 2LAIA 4FIPA 3EHRA 4BHWA 3ZYLA 3EU5A 4GPMA 2OV8A 4MVTA 3LVRE 3QARA 3UPVA 5HKPA 4LNGA 4MBGA 4BY6A 3CKCA 4GA1A 5A23A 2CKLA 2ECNA 4LEUA 1UN8A 3U5OA 3R7QA 2RKKA 4OGCA 3DPDA 3MKQA 1N11A 3KDEC 5D0QD 4I6EA 5G05J 3Q9NC 2WXIA 1BU9A 4N2QA 2H6FA 1B89A 2VJEA 3UUXA 1X4JA 2JMDA 4FJCA 3PHDA 3IHPA 4AP2A 2FBNA 3D9MA 3O70A 4LADB 1HG5A 3HXDA 3ZVVA 4U96D 4BT8A 2H6IA 1E8ZA 5FB1A 4XKCA 4X8QA 3O34A 1SA5A 3CHRA 2VQ2A 2CHWA 3UI2A 2Q7FA 5FZRA 4DLQA 3FU5A 5ENSD 2AVPA 2XGMA 3MEKA 5EN5D 2X6IA 4EZKA 4FO9A 3W9FA 3TG4A 3L9TA 4GZ3A 3GZ2A 3LQHA 3SGHA 3CHOA 4P29A 2CHXA 2F0YA 3U9WA 4FLHA 2LSVA 1TNOA 2MOWA 5M72A 4ATZD 1MBMA 4C48B 5KCMA 3S7JA 3MKRA 2LAHA 2EA6A 4GZ6A 5AQAA 3FEHA 5SVIB 4GMJA 2G45A 4OAUC 3FANA 3TWUA 3PDNA 5H7PA 5LCWJ 5CERB 4HRLA 4WWOA 1P5QA 2Y3AA 1WEQA 3E32A 3IHVA 5KJLA 1TNZA 1HZ4A 4UWHA 3NG2A 3V30A 3Q78A 1MM2A 2JM3A 3FUHA 4C0EA 1VDYA 4KXKB 3U5MA 2C2VS 4U63A 5FEYA 3HDXA 2KWKA 3FL2A 2OXQC 5FQ7A 3IBEA 3RRUA 2V0PA 4QF3A 2IQJA 4CRWA 1E7UA 2P2CP 4AV7A 4DRXE 1TNBA 1LD7A 2OEWA 2XEVA 3ESLA 3M99A 2QZAA 1HX8A 1WEWA 1LDJB 5BNWA 1NZNA 4BSXA 4JA7A 1ELWA 3ZGQA 3T9KA 1WEOA 5E76A 5KWDA 3L13A 3TG5A 4I9CA 3QDNA 3FUKA 5K3QA 1N0QA 3ZVYA 1K8KG 4N4FA 4G26A 4G1TA 2MA5A 4U0ZA 3FTZA 5AN8A 3NZSA 4YVOA 3ML9A 4F1SA 3AS4A 2PNXA 3PZDA 2AXVA 5A7DB 3ZXPA 2CHZA 3Q1DA 4DX5D 4DI4A 4YDEA 2A5EA 4YDWA 4AM9A 2RI7A 3LQJA 2WXGA 1Z3YA 2KCLA 3T5XA 4YAXA 3NOCD 4QFVA 5H1TA 4HLLA 3OAWA 4AYCA 1YCSB 4BSZB 1IYGA 4UWGA 3EJNA 2FF4A 1U3CA 4Q96A 5ENTD 3PUJA 3TWVA 5AIJA 3M7KA 3HXEA 4HOUA 3HIZA 1TNUA 4APFA 2XHEA 4WZ0A 1SQMA 1JM7B 4C9BB 3GZSA 5G04J 1N4PA 2ECVA 3B95A 3CSTA 3UXGA 3Q5MA 3L08A 2XGSA 2MUMA 3SHFA 2A4ZA 1N95A 3RTRB 1N94A 1Y6IA 1YA0A 3FTYA 1OWNA 3DSVA 5LOZA 3C3RA 3O37A 4G24A 4TXRA 4YBTA 5CEAA 4A55A 4GTSA 4BTBA 1WESA 3DDTA 2A5UA 3FU0A 5B77A 4TXPA 5FERA 3V2XA 5C2YA 4HS2A 3FJUB 4QQIA 2P9NG 3MX3A 2ECGA 3UM3A 1DVPA 4F53A 3ISMC 2WPVA 4YATA 4LUNU 1L5JA 3ESKA 3VTYA 4DX2A 1OWMA 2XZDG 4IN3B 2X6JA 1YMPA 1K3ZD 3CR3A 1AWCB 4NIKA 3N9PA 4YC9A 4HI9A 2L43A 2EINE 3LJNA 3AG4E
chains in the Genus database with same CATH topology
2A5EA 2P57A 2ZGGA 4A63B 4YDWA 3TWSA 2L7PA 2KKYA 4Z68A 3FM8C 2MKEA 4RLYA 5EN5D 5AARA 2XEEA 4LSZE 5CBNA 3Q9UC 3W9FA 3NOGD 4YDYA 2DJAA 3H7HA 3NOCD 4U95D 4QQ4A 4K5AB 4QFVA 1SW6A 4F6RD 3O47A 2ETAA 4DX7D 3AJIA 2HE0A 4HLLA 3C5RA 5CEDB 4K5CA 2EGMA 1YCSB 2AJAA 3DEPA 5HRYA 4BSZB 4OGEA 4J8YA 3SUBA 5ITZF 4B93B 1MX2A 2BKGA 2F8XK 4ATZD 4C48B 3ZUVB 4HRMB 5ENTD 2CRRA 4H9DA 4LG6A 5AQAA 1MYOA 3TWVA 3FEHA 5SVIB 2MYOA 4OAUC 2CRWA 3M7KA 3J5PA 2NYJA 3TWUA 1TR4A 3TWRA 2KKXA 5SVIA 1N0RA 5CERB 2FO1E 4HRLA 4U8YD 2LAUA 5ENPD 4BETA 4CZ2D 4Z0OA 2DVWA 4O62A 3KDEC 2JUNA 3D9HA 2VGEA 3V31A 1K1BA 4BERA 3F6QA 4F1PA 3EU9A 4JB8P 2XENA 5HS0A 3V30A 3T8KA 2JABA 3TWQA 1IHBA 2F8YA 2XOCA 2XP0A 4O1OA 2XZTG 3HRAA 3B95A 3EHRA 4HNAD 5D66A 3TWTA 2JM3A 5SVYA 3UXGA 3E2DA 3JUEA 5FIOA 3LJUX 5JA4D 3J5QB 5EYLA 3DEOA 3LVQE 2QC9A 4GPMA 2OWAA 5KBAA 2V4HC 3KEAA 1SVXA 4HB5A 4ZHBA 5SVXA 4HRNA 3LVRE 3LDYA 3JXJA 1BI7B 4DX6D 2IQJA 5HKPA 1A5EA 4HI8A 5BXUA 5EIBE 2EXUA 3AAAC 4HBDA 1S70B 1MX6A 2P2CP 4G8LA 4U8VD 4DRXE 2ETBA 2V5QC 3UI2A 3ZKJA 5CEAA 2FFWA 4UUCA 1IXVA 1MJ0A 3B7BA 2KXPC 4DUIA 3DDTA 2YVRA 4OGCA 3W9GA 1BLXB 5AQ7A 3V79K 3V2XA 1N11A 2RFMA 3EHQA 1QYMA 1BD8A 2DZOA 3IXEA 3TWWA 4GMRA 4QQIA 2Y1LE 4O60A 5EILA 4OAVB 3DWDA 3FJUB 3HG0D 1DC2A 2DZNA 2BKKB 4Z0RA 4BEPA 1BI8B 5ENOD 3Q9NC 3V2OA 5AAOA 4HQDA 2J8SD 5CECB 3NBNB 1BU9A 2CSVA 2D8UA 3ZNGA 2YREA 3PLWA 4G8KA 5ENQD 3UTMA 1OT8A 2KBXA 3T9KA 5EYPF 2QYJA 3JXIA 2RFAA 1UOHA 4O1PA 1NFIE 5ENRD 5KWDA 2XOYA 5KNHD 4DX2A 5EIDA 3ZU7B 2B0OE 2PNNA 5BXOA 1G3NB 2CONA 4N5QA 1WG0A 2ZGDA 5FINA 2RR4A 5AQ9A 1IKND 4U96D 2FD4A 2XZDG 5K3QA 1N0QA 4LNUD 4TUMA 1YMPA 1K3ZD 1AP7A 4ZFHA 5AN8A 1AWCB 4NIKA 4BESA 3SO8A 4CYMD 4DX1A 5KNGA 1YYHA 1D9SA 2E61A 1WDYA 1K1AA 5JMND 1DCQA 2DWZA 2ETCA 2F37A 4J7WA 4HI9A 2XEHA 5ENSD 5CBOA 2M13A 2XOZA 3LJNA 5AQBA 3Q1DA 1MX4A 1OY3D 3TWXA 3MDBC 4DX5D 2Y0BG 4K5BA 2L6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5E A;  2ZGG A;  4A63 B;  4YDW A;  3TWS A;  3FM8 C;  4Z68 A;  4RLY A;  5EN5 D;  5AAR A;  2XEE A;  4LSZ E;  5CBN A;  3Q9U C;  3W9F A;  3NOG D;  4YDY A;  3NOC D;  4U95 D;  4K5A B;  4QFV A;  1SW6 A;  4F6R D;  3O47 A;  2ETA A;  4DX7 D;  3AJI A;  2HE0 A;  4HLL A;  3C5R A;  5CED B;  4K5C A;  1YCS B;  2AJA A;  3DEP A;  5HRY A;  4BSZ B;  4J8Y A;  3SUB A;  5ITZ F;  4B93 B;  1MX2 A;  2BKG A;  2F8X K;  4ATZ D;  4C48 B;  3ZUV B;  4HRM B;  5ENT D;  2CRR A;  4LG6 A;  5AQA A;  1MYO A;  3TWV A;  3FEH A;  2MYO A;  4OAU C;  2CRW A;  3J5P A;  2NYJ A;  3TWU A;  1TR4 A;  3TWR A;  1N0R A;  5CER B;  2FO1 E;  4HRL A;  4U8Y D;  5ENP D;  4BET A;  4CZ2 D;  2DVW A;  3D9H A;  2VGE A;  3V31 A;  1K1B A;  4BER A;  3F6Q A;  4F1P A;  3EU9 A;  4JB8 P;  2XEN A;  5HS0 A;  3V30 A;  3T8K A;  2JAB A;  3TWQ A;  1IHB A;  2F8Y A;  4O1O A;  2XZT G;  3HRA A;  3B95 A;  3EHR A;  4HNA D;  5D66 A;  3TWT A;  3UXG A;  3JUE A;  5FIO A;  3LJU X;  5JA4 D;  3J5Q B;  5EYL A;  3DEO A;  3LVQ E;  2QC9 A;  4GPM A;  2OWA A;  5KBA A;  2V4H C;  3KEA A;  1SVX A;  4HB5 A;  4ZHB A;  4HRN A;  3LVR E;  3JXJ A;  1BI7 B;  4DX6 D;  2IQJ A;  5HKP A;  1A5E A;  4HI8 A;  5BXU A;  5EIB E;  3AAA C;  4HBD A;  1S70 B;  1MX6 A;  2P2C P;  4G8L A;  4U8V D;  4DRX E;  2ETB A;  2V5Q C;  3UI2 A;  3ZKJ A;  5CEA A;  4UUC A;  1IXV A;  1MJ0 A;  3B7B A;  2KXP C;  4DUI A;  3W9G A;  1BLX B;  5AQ7 A;  3V79 K;  3V2X A;  1N11 A;  2RFM A;  3EHQ A;  1QYM A;  1BD8 A;  2DZO A;  3IXE A;  3TWW A;  4GMR A;  4QQI A;  2Y1L E;  4O60 A;  5EIL A;  4OAV B;  3DWD A;  3HG0 D;  1DC2 A;  2DZN A;  2BKK B;  4BEP A;  1BI8 B;  5ENO D;  3Q9N C;  3V2O A;  5AAO A;  4HQD A;  2J8S D;  5CEC B;  3NBN B;  1BU9 A;  3ZNG A;  4G8K A;  5ENQ D;  3UTM A;  1OT8 A;  2KBX A;  3T9K A;  5EYP F;  2QYJ A;  3JXI A;  2RFA A;  1UOH A;  4O1P A;  1NFI E;  5ENR D;  5KWD A;  5KNH D;  4DX2 A;  5EID A;  3ZU7 B;  2B0O E;  2PNN A;  5BXO A;  1G3N B;  4N5Q A;  1WG0 A;  2ZGD A;  5FIN A;  5AQ9 A;  1IKN D;  4U96 D;  2XZD G;  1N0Q A;  4LNU D;  4TUM A;  1YMP A;  1K3Z D;  1AP7 A;  4ZFH A;  5AN8 A;  1AWC B;  4NIK A;  4BES A;  3SO8 A;  4CYM D;  4DX1 A;  5KNG A;  1YYH A;  1D9S A;  2P57 A;  1WDY A;  1K1A A;  5JMN D;  1DCQ A;  2DWZ A;  2ETC A;  2F37 A;  4J7W A;  4HI9 A;  2XEH A;  5ENS D;  5CBO A;  3LJN A;  5AQB A;  1MX4 A;  1OY3 D;  3TWX A;  3MDB C;  4DX5 D;  2Y0B G;  4K5B A;  2L6B A; 
#chains in the Genus database with same CATH topology
 3HVE A;  3TWS A;  1EYH A;  2LUH A;  2XEE A;  3PH0 C;  2EOD A;  3PRE A;  4QQ4 A;  2R5S A;  3BUA A;  2KZT A;  3AJI A;  1Q2Z A;  3UIP C;  3ZVZ B;  3CHS A;  4JA9 A;  1E90 A;  1H6K A;  3U66 A;  1Z3X A;  3DEP A;  3SZ7 A;  2LRI C;  5DBK A;  3TL5 A;  2PM7 A;  3G2T A;  2F8X K;  2UWJ G;  4CCG X;  2JEK A;  2LGL A;  2WVI A;  1PC2 A;  2CSY A;  1MYO A;  3DXM G;  3CK8 A;  1TR4 A;  4GYO A;  3UM0 A;  4O62 A;  2C0L A;  4F1P A;  2AXU A;  2KGI A;  2WXF A;  4FJY A;  3FP3 A;  2X38 A;  2WMN A;  2RD0 A;  2MNZ A;  2BTD A;  2GGF A;  1VYX A;  2M6M A;  3MJW A;  1SVX A;  4ZHB A;  3HCS A;  2C0M A;  5D1K B;  3AAA C;  3AG2 E;  3EUV A;  2VP7 A;  2QY7 A;  1VFY A;  4LJN A;  2AN6 A;  5KH7 A;  2WB2 A;  2EGP A;  3T6R A;  3NB2 A;  4KZ0 A;  2F6N A;  3FFL A;  1NA0 A;  5LFA A;  4LK9 A;  1QYM A;  3M62 A;  5FQ6 A;  4B8A A;  3DSW A;  3FTU A;  4J8E A;  5ENQ D;  2H6G A;  3JXI A;  4C0M A;  3C98 A;  2B0O E;  3APD A;  5H1V A;  1WG0 A;  1QNF A;  4EHM A;  4TUM A;  2LNI A;  3DRA A;  4L2L A;  4RQI A;  4EEC A;  3CGH A;  2MNY A;  4O6F A;  1U2V G;  2AWI A;  4A0C D;  1K1A A;  3PUQ A;  4TUU A;  1WIM A;  4C9Z A;  4UP5 A;  2V5F A;  5G55 A;  3VLD A;  2VNF A;  2YIN A;  4PPE A;  3T8M A;  4DJA A;  4I17 A;  3H7H A;  5C11 A;  4IC3 A;  2YSM A;  4A3V A;  5EKQ D;  2JMI A;  5ENN A;  5ITZ F;  4NUR A;  5AYW D;  2XRZ A;  4CDR A;  3FDH A;  2IO3 C;  2P9I G;  3KSQ A;  4GCO A;  2LAU A;  2Y4U A;  5LKT A;  4BX9 A;  1BPO A;  4WNF A;  3BG0 B;  2LXM A;  3NF1 A;  3MHS A;  3EIQ C;  1IHB A;  4HNA D;  3LQI A;  3DXK G;  3EB5 A;  2M1R A;  3SI5 A;  3DEO A;  1N4Q A;  4F7A A;  1RZ4 A;  4I7B A;  2I50 A;  4U0U A;  1RW2 A;  3T5V A;  2EIM E;  1FP0 A;  2EIJ E;  4U8V D;  3L1Z B;  3PZ3 A;  5IY5 E;  3M63 A;  1ELR A;  2KC7 A;  4JZY A;  4A1G A;  3N9Q A;  2KXP C;  3GW4 A;  2YVR A;  1V54 E;  4NN2 A;  3IXE A;  4OAV B;  4GMR A;  3Q4A B;  2E2E A;  3HG0 D;  1H19 A;  2BKK B;  3ULE G;  4HOQ A;  1MHQ A;  4OVV A;  3IHY A;  4XX5 A;  3SFZ A;  4AOF A;  2I1K A;  2QYU A;  4I6J A;  3QZV A;  1BOR A;  2I1J A;  1WEM A;  2ION A;  4NRH B;  2AW6 A;  5BV1 A;  3E33 A;  1UJK A;  1TJC A;  3D9I A;  3SQV A;  3K9I A;  4AP4 A;  2E61 A;  5JMN D;  2DWZ A;  4APO A;  3GYZ A;  3L22 A;  1MX4 A;  1INZ A;  2L6B A;  3PNT B;  2KIZ A;  5KJK A;  3U3W A;  1E7V A;  2DSM A;  2JRJ A;  4U04 A;  2EGM A;  3SOW A;  4CDM A;  5B75 A;  3ABM E;  1H6O A;  1ZBD B;  2V8S E;  3ASH A;  1WE9 A;  3UM2 A;  1N54 A;  2LO6 A;  4WUY A;  4A1S A;  3LKU A;  4V3K C;  1O1S A;  2R2L A;  3DPL R;  2MYO A;  2H0D B;  2WXQ A;  3Q15 A;  2ZET C;  5BW8 C;  2KU3 A;  5G05 B;  4I2Z A;  5B8D A;  3U4T A;  1LDK C;  2L0B A;  2UY1 B;  4CZ2 D;  2L5U A;  5CHE E;  4JB8 P;  3TWQ A;  3VTX A;  3RPG B;  1WEU A;  4HOT A;  3IKO B;  3HXC A;  1SZ9 A;  4MRU A;  4BBQ A;  3MYV A;  4ANX A;  3QWP A;  2Y1M A;  3EHM A;  3LEW A;  1OWP A;  4I43 A;  2KWJ A;  2BUG A;  4FU3 A;  4PUC A;  5BUZ A;  3L17 A;  3ML8 A;  3S7F A;  3DSU A;  2B6C A;  3W9G A;  3FUN A;  4B7Y C;  4FK5 A;  2CSZ A;  1TYQ G;  3MV2 B;  2LGV A;  4YDO A;  3V2O A;  3N9N A;  4HQD A;  1FCH A;  2L0I A;  4AY5 A;  3JQ0 A;  2Y1N A;  1N4R A;  2RFA A;  3ASG A;  5FZS A;  5ENR D;  4PS8 A;  5BV0 A;  3ONL A;  4GTR A;  5FQ8 A;  5LCW B;  2HYZ A;  2ECJ A;  4LNU D;  4KBQ A;  2YSJ A;  1AP7 A;  3SO8 A;  5KNG A;  5JJ6 A;  4BET A;  2L0T B;  4LRZ A;  2M13 A;  3CVU A;  4N3C A;  3B7U X;  4K5B A;  3G2V A;  3RIB A;  5J08 A;  1X4I A;  1FT1 A;  3NOG D;  3LXU X;  1Z5S C;  4I1M A;  4QF2 A;  1JM7 A;  3UKR G;  1KPS B;  3D9K A;  5HRY A;  4OGE A;  3LY8 A;  2BKG A;  1EDU A;  3SD5 A;  3ZUV B;  3ABK E;  5ARF A;  3CSF A;  3CVQ A;  2VJF B;  2DIW A;  5AEN A;  1WIL A;  5FZQ A;  3V31 A;  4AY6 A;  3F6Q A;  3E4B A;  3WXX A;  4WNE A;  2F8Y A;  5AIU A;  2VPG A;  1SA4 A;  4ACL A;  3CHM A;  3ZRH A;  5H9M A;  2X6F A;  3GV4 A;  4NAC A;  3O33 A;  4EZJ A;  1O1R A;  3Q49 B;  2XCB A;  2LQ6 A;  2IQC A;  2VSX E;  3FEY A;  4U0S A;  2ETB A;  2V5Q C;  1H0A A;  2KAT A;  2CT2 A;  1IXV A;  1MJ0 A;  3B7B A;  3C6W A;  4ANV A;  4KYO B;  5T4Y A;  2WXM A;  4TRQ A;  4EPZ A;  1Z60 A;  2L9B A;  5HQ8 A;  2KR4 A;  5B1A E;  1BI8 B;  5AAO A;  2P9U G;  2QIC A;  3I5P A;  4YBM A;  3N9L A;  3PZ2 A;  3ZN3 A;  5EID A;  5BXO A;  4PS7 A;  4TKP B;  3Q79 A;  4WWP A;  5AQ9 A;  3ZW3 A;  4L9P A;  5B3S E;  2VTB B;  4G23 A;  3L16 A;  4BX8 A;  2X3M A;  2IO2 C;  3PUR A;  3DQV R;  4XEI G;  3ZYQ A;  3L82 A;  1OWO A;  3TWX A;  3SFX A;  3CVX A;  3JUI A;  1E8W A;  2L7P A;  2CFU A;  2LDR A;  2MKE A;  5D2M C;  5LP0 A;  4ANU A;  4GTP A;  2DJA A;  4NQ0 A;  5B79 A;  1FT2 A;  2ECW A;  4GAA A;  1OCZ E;  3MCX A;  4B93 B;  4BWR A;  2MD8 C;  1EPU A;  2VSO E;  2FUU A;  2JLB A;  2XQ0 A;  3G2W A;  2LSU A;  3QKY A;  1UJJ A;  4ATG A;  4GTM A;  2IU1 A;  1MQS A;  3UKU G;  4HOS A;  1FBV A;  4WAF A;  1UG3 A;  2KWO A;  5G05 C;  5DIN A;  2J07 A;  2NC9 A;  2NXP A;  3SY2 A;  2QC9 A;  4MS6 A;  3ABL E;  2PUY A;  3CLJ A;  1TN8 A;  3RPG C;  1OUV A;  4HI8 A;  5EIB E;  2EXU A;  3HCU A;  1KLX A;  1ELK A;  2V4L A;  3RAU A;  1JWG A;  4UUC A;  4J6I A;  1BD8 A;  5JHA A;  2MRI A;  2KYU A;  5E75 A;  2DZN A;  4JHJ A;  2VJE B;  4Z0O A;  5J3X A;  4G2V A;  3LJ3 A;  4KVO A;  4GNG A;  3RK6 A;  1KT1 A;  3ZNI A;  5LKU A;  3U5N A;  1HF8 A;  2J4B A;  3P1U A;  5LCW C;  2L75 A;  1KT0 A;  4N2S A;  2I9C A;  4UI9 J;  1MM3 A;  4RSY A;  2NSZ A;  3UT7 A;  4GA2 A;  4GNF A;  2VPD A;  3R9M A;  4F6R D;  2VYI A;  4DX7 D;  2FO7 A;  2KCK A;  2OOE A;  2R17 C;  3FUM A;  4CGV A;  3SBT B;  5FWQ A;  1OCO E;  4TV3 A;  4E6H A;  3J5P A;  3SOX A;  2HDP A;  2BED A;  3O4Z A;  2KRE A;  4J8F A;  4G25 A;  2VGE A;  4XKB A;  4GTV A;  4LER A;  3T8K A;  4Y6W A;  5EYL A;  1F62 A;  3UM1 A;  2XS8 A;  3TAX A;  2V4H C;  3MV3 B;  1OCR E;  5I3L A;  3RRN B;  2GRQ B;  3N9M A;  4RG6 A;  3LRQ A;  1S70 B;  3DWL G;  3FUL A;  3ZHE A;  5A6C A;  2DCP A;  5EYA F;  2J4D A;  4Y6C A;  5B1B E;  2MIQ A;  1A17 A;  4B0Z A;  3OTN A;  4O60 A;  3N9O A;  5ENO D;  3DBS A;  2D8U A;  4YAB A;  1QZ2 A;  1OT8 A;  3CK9 A;  1UOH A;  4FP7 A;  5KNH D;  4H7Y A;  4URK A;  2PNN A;  3KSL A;  5JJT A;  3E30 A;  4HVB A;  1JWF A;  1TNY A;  2DYS E;  3Q75 A;  1T1H A;  5LKZ A;  5KJN A;  3APF A;  3R9A B;  4EBA A;  3FEX A;  2KWN A;  5KJM A;  3TXM A;  1D8E A;  1ZB1 A;  4BES A;  3GL6 A;  2J9Q A;  4DX1 A;  4JD2 G;  2F37 A;  4F3V A;  4A49 A;  3WG7 E;  3MDB C;  2ZGG A;  4Z68 A;  2K1J A;  5G04 C;  5CBN A;  4WWN A;  1WGM A;  4U95 D;  4AYC B;  4WND A;  3FTW A;  5JG6 A;  3FUJ A;  2G6Q A;  3ZPV 1;  2H6H A;  4MLP A;  1JCS A;  4GZC A;  4CT4 A;  1E8Y A;  4JXT A;  4PH4 B;  2XPZ A;  4LG6 A;  2CRW A;  3Q47 B;  2M63 A;  1LD8 A;  3SBS A;  2VGX A;  3RU0 A;  4JHR A;  4GTQ A;  2K17 A;  1WFK A;  2YHC A;  5TAB A;  4BT9 A;  1WM5 A;  2L80 A;  2IF4 A;  3HXF A;  3LPZ A;  3LVQ E;  4L23 A;  3HHM A;  4AVX A;  4EBA G;  4AIF A;  4DK5 A;  1N9A A;  5SVX A;  4ILG A;  4GNE A;  3JXJ A;  4N39 A;  1MZC A;  3D9N A;  1IQR A;  4HBD A;  3PUK A;  3ULY A;  3KQI A;  3PEV B;  1IQU A;  3ZKJ A;  2GRL A;  5FB0 A;  1BLX B;  5AQ7 A;  4FJZ A;  4I7D A;  3LS8 A;  3DWD A;  3RSE G;  3FU6 A;  2MA6 A;  4ZUX U;  2P9L G;  4R8P K;  4JPS A;  1H6P A;  4G8K A;  4AEZ C;  3I3N A;  3KD7 A;  4GND A;  3R7R A;  3B7R L;  4GML A;  1U3D A;  3HTK C;  4L7X A;  4J0U A;  4CT0 A;  1JPL A;  2PQN A;  1ZU2 A;  2XCC A;  4V3I A;  2NAA A;  1IHG A;  4EZL A;  3FM8 C;  3UQ3 A;  2KZT B;  4FC8 A;  5AIT A;  1WY6 A;  4K5C A;  1FPP A;  4GYY A;  1PAQ A;  3SUB A;  4YND A;  5BPP A;  4X3G A;  4IC2 A;  2LXL A;  4FHJ A;  4H9D A;  5B76 A;  3ASL A;  1N52 A;  5SVI A;  5ARG A;  3L1X A;  5ENP D;  2K16 A;  3ASF A;  2WQ7 A;  5T8I A;  4BER A;  2XEN A;  4KZC A;  4EQF A;  4O1O A;  2ZU6 B;  2RG8 A;  3PVL A;  1H2T C;  5CCM A;  2KGG A;  3APC A;  4I7C A;  2WM9 A;  3LDY A;  4ANW A;  1A5E A;  4WA6 A;  1SZA A;  4UI9 K;  4GB9 A;  1MX6 A;  2HO1 A;  4AXH A;  2WXN A;  4N3B A;  5KH3 A;  2FFW A;  2FEZ A;  2M85 A;  4P5O B;  5C13 A;  2DBA A;  3ZYK A;  2RFM A;  4GCN A;  3TWW A;  2E0I A;  4CCA A;  5FT9 A;  1UW4 B;  4XZ4 A;  5DKA A;  3AU5 A;  3D9L A;  3NBN B;  2J8S D;  2MT5 A;  4A4B A;  1S64 A;  3OXG A;  3PE4 A;  1TN7 A;  2KBX A;  3O35 A;  4ACK A;  2FUL A;  2ZIS A;  2PL2 A;  3AS8 A;  3FH8 A;  3QNK A;  3PE3 A;  1IKN D;  5CRU A;  3G2U A;  4M7C A;  4ZFH A;  3ZPV E;  1HO8 A;  3QJZ A;  5C1D A;  1D9S A;  5SVY A;  3MA5 A;  1DCQ A;  1XGW A;  2KE1 A;  2XEU A;  4B89 A;  5DIZ A;  3ZXS A;  4E85 A;  3FY4 A;  3AG3 E;  5FTP A;  1KZO A;  4LSZ E;  1W3B A;  1XWH A;  4BFR A;  4YDY A;  4YAD A;  2YUC A;  4K5A B;  2WMO A;  1HG2 A;  3CVY A;  3O47 A;  2ETA A;  3RRM B;  2WXK A;  3C5R A;  4HXI A;  2LXH C;  4W4U A;  3GZ1 A;  2QJ0 A;  1NL4 A;  2CG2 A;  3O36 A;  2C2L A;  3I4R B;  2XRY A;  4JEU A;  2QIZ A;  4HRM B;  2VGY A;  3SFY A;  4KT6 B;  4A4C A;  3CK7 A;  3D9O A;  2IY0 C;  5G2N A;  3HCT A;  4JVS A;  4Q69 A;  1K1B A;  4R2Y A;  1IYM A;  3FHE A;  4OYS A;  4CDN A;  2JAB A;  2XOC A;  3HRA A;  4U7E B;  5D66 A;  3TWT A;  3E2D A;  2XS1 A;  2YHE A;  5AJD A;  1NA3 A;  4UWK A;  2YQL A;  3VK6 A;  4GTO A;  3BEE A;  3KEA A;  3SF4 A;  2E6S A;  2WXO A;  3U5P A;  3LY7 A;  4CEM A;  4DX6 D;  4MSX A;  3LCA A;  3S2A A;  5BXU A;  2YQM A;  3FUI A;  1RMD A;  3S7B A;  3OXF A;  2P9K G;  4I9E A;  3DSX A;  2R59 A;  3P2B A;  3EHQ A;  2Y1L E;  3URZ A;  4KMO A;  4JEH A;  1Z2Q A;  2P57 A;  3AS5 A;  3ZNG A;  4GB0 A;  5TRB A;  4XIF A;  5EYP F;  2X6K A;  1NFI E;  2P9P G;  4U8H A;  1HU3 A;  3CQC B;  1S0P A;  5FIN A;  2HYE D;  2RR4 A;  3Q73 A;  2YU4 A;  2WXJ A;  1O1T A;  3FTX A;  4UWL A;  4PTB A;  3NQP A;  2EIL E;  2HM8 A;  3CVN A;  4IUL A;  2GRR B;  5CBO A;  4L2Y A;  2XEH A;  3B13 A;  1JOC A;  2WQH A;  5AQB A;  1X5B A;  3C3O A;  1EF1 C;  3FUE A;  4RLY A;  5FQ4 A;  2YHN A;  3UMV A;  4K03 A;  4FA6 A;  4R7E A;  4MKT A;  1TEZ A;  3ZTG A;  4GZ5 A;  4R7L A;  3UT4 A;  5G04 B;  4N5C A;  2CRR A;  1XNF A;  3FU3 A;  2PM6 A;  4HFG A;  4S3O B;  2NYJ A;  2KKX A;  4IRU A;  1V87 A;  5FJY A;  2IEJ A;  3AG1 E;  2JUN A;  3B7T A;  2J49 A;  3KEZ A;  2KCV A;  3Q7A A;  4V3L C;  3QOU A;  1H2V C;  4LNB A;  5LKX A;  3UIN C;  1WEE A;  5D0O D;  1NP7 A;  3RKV A;  4XI0 A;  3FUF A;  2DX8 A;  3BQO A;  4HRN A;  3CVL A;  1BI7 B;  4UI9 B;  2EIK E;  2M3H A;  3CVV A;  3NZU A;  2IFU A;  1VD4 A;  3CV0 A;  4B8C B;  5T3R A;  2WXH A;  2VSN A;  3LYA A;  1H2U A;  2WXR A;  3E37 A;  1ZBP A;  1E8X A;  4Z0R A;  3CHQ A;  3VLF A;  3CQG B;  5CRV A;  2YRE A;  3C5K A;  1K2F A;  4PS3 A;  4B86 C;  1JCQ A;  2XPY A;  3BU8 A;  3TGO A;  4G11 A;  2FSA A;  2CKL B;  1G25 A;  1G3N B;  4LLB A;  3D3M A;  1DCE A;  3ONK A;  5CCL A;  2E6R A;  4L7T A;  1FVH A;  3ASN E;  3MKQ B;  5CMW A;  2YQ8 A;  3D9J A;  4YVQ C;  1Z6U A;  3VLE A;  2FUI A;  2IOL A;  1WDY A;  2LGK A;  4J7W A;  2XOZ A;  2YHO A;  3QWW A;  4AUQ B;  2Y0B G;  3EHN A;  5TDW A;  2HR2 A;  4L1B A;  3N71 A;  4GA0 A;  4ILI A;  3Q9U C;  4YBS A;  4N3W A;  2LXP C;  3G2S A;  3MGB A;  2HE0 A;  5J90 A;  3KV6 A;  2YYR A;  1MX2 A;  3OXL A;  2KFT A;  1E96 B;  2FI7 A;  1X4U A;  1OXJ A;  2LV9 A;  4I1O B;  3TWR A;  5ANL A;  2GW1 A;  5B78 A;  5KH9 A;  3EB6 A;  3D9H A;  4OVU A;  2X6H A;  3PZ1 A;  3SNX A;  3C3Q A;  5G0F A;  1O5M A;  2XP0 A;  2XZT G;  4FAD A;  2GRO B;  5FIO A;  3ZFW A;  4WZ2 A;  2VPB A;  3HYM B;  4ZQL A;  3EDT B;  4CA1 A;  4FLB A;  4CGW A;  1TN6 A;  3C72 A;  3E34 A;  4G8L A;  4JHK A;  1D8D A;  3ULQ A;  4U07 A;  4B94 A;  2EQX A;  3X2Q E;  4DUI A;  3LDZ A;  4H7X A;  4UWF A;  3RJV A;  1HXI A;  2IJG X;  3PS6 A;  1HYI A;  4ME2 A;  4I6G A;  1HYJ A;  4HOR A;  2XOY A;  4KVM A;  1OWL A;  3KNV A;  3Q7F A;  4N5Q A;  4UQX A;  1CHC A;  3FWV A;  2XGO A;  4ILH B;  3FUD A;  3U64 A;  2QFC A;  3TJP A;  5D1L B;  1HE8 A;  2J09 A;  3QAQ A;  3JCK C;  4GYW A;  3ZIM A;  1X81 A;  3HXB A;  3UT8 A;  1WAO 1;  1OY3 D;  2F42 A;  2Y69 E;  4D10 C;  4UQZ A;  4JL0 A;  4WNG A;  4JW1 A;  1SW6 A;  2GRN B;  4HLE A;  2BF0 X;  3ZYM A;  2AJA A;  4LKA A;  1Z6T A;  2I2O A;  3MHH A;  1OCC E;  3FH5 A;  1KZP A;  2OEV A;  3ZPJ A;  2ILR A;  4XE0 A;  2H0D A;  2DVW A;  3MZL B;  2UY1 A;  2R03 A;  2CG3 A;  4Q6F A;  4S3O C;  2YNQ A;  2GRP B;  4A3T A;  5BT1 A;  1WEP A;  2P9S G;  3JUE A;  2XB1 A;  5JA4 D;  2DYR E;  3BG1 B;  3J5Q B;  3UX4 A;  5EDS A;  3L6A A;  5JHB A;  4PDX A;  2Y4T A;  1Y8M A;  3SHB A;  1GW6 A;  4LCT A;  3ASD A;  4DI3 A;  5EX3 A;  1HH8 A;  2ZIR A;  3FTV A;  2AXZ A;  3NAW A;  1WEN A;  4UI9 C;  4J8D A;  2Y43 A;  2VSY A;  3V79 K;  3UIO C;  5EIL A;  1LF8 A;  3D9P A;  2MHK A;  4BEP A;  3CEQ A;  3DST A;  2CSV A;  4GU5 A;  3QC1 A;  3S7D A;  4O1P A;  2JMJ A;  2BAY A;  3RO2 A;  3T7L A;  3QK0 A;  2ZGD A;  1QBQ A;  1V55 E;  2YUR A;  5TBN A;  4AJW A;  4GPK A;  3IEG A;  2OVF A;  2ETC A;  3JYS A;  2KM4 A;  2OVB A;  4UQY A;  4FHK A;  3PZ4 A;  3L11 A;  3FAO A;  5LX8 A;  4A63 B;  4TXQ A;  2YT5 A;  4DPR A;  3KS2 A;  2J08 A;  3ENE A;  4ZDT A;  5ANR A;  2IOS A;  3DPY A;  4RG9 A;  4K0R A;  4GZD A;  3ZEF A;  3AU4 A;  2IDA A;  2VPE A;  4J8Y A;  2GRM A;  4F52 B;  2PQR A;  2LN0 A;  4ABN A;  3HVE B;  2XPI A;  5HI7 A;  2ECI A;  3CHP A;  2FO1 E;  1FVF A;  3V43 A;  1N4S A;  2VJF A;  3FTS A;  3L54 A;  4GTT A;  4JC8 A;  5HS0 A;  3KV5 A;  3PEU B;  3LY9 A;  3CIA A;  3LJU X;  1PY1 A;  1U6G B;  4RVB A;  4WZ3 B;  2L6J A;  4Q94 A;  2D8S A;  2OWA A;  5KBA A;  4HB5 A;  2WXP A;  5EX0 A;  3ZHE B;  3PRZ A;  4O64 A;  3KAE A;  2R02 A;  4IYP A;  1HS6 A;  3EIJ A;  3PLW A;  2DZO A;  2OND A;  3RO3 A;  1DC2 A;  4J8S A;  2G43 A;  3O7A A;  2MD7 B;  5D1M B;  5CEC B;  3I2D A;  1E4U A;  3UTM A;  3CVW A;  2QYJ A;  4L58 A;  3ZU7 B;  1JUQ A;  4N3A A;  2CON A;  2P58 C;  4XI1 A;  2FD4 A;  3SOU A;  3B7S A;  3DSS A;  4FUL A;  2VJ8 A;  4CYM D;  3QWV A;  3I4G A;  1LTX A;  3JQ1 A;  1YYH A;  5H1U A;  2VTB A;  2RSD A;  3FH7 A;  2PZI A;  3QB2 A;  4I2W A;  4BTA A;  3O48 A;  2LGG A;  2CFZ A;  2YW8 A;  2KKY A;  3TXN A;  1QQE A;  5AAR A;  2I6H A;  2R05 A;  2UZG A;  1NI1 A;  4XI9 A;  4M3O A;  4I1A A;  1UN9 A;  1N87 A;  2ZXW E;  5CED B;  3CKB A;  3CVP A;  1TJF A;  4UP0 A;  1HFA A;  2F6J A;  1JCR A;  1WEV A;  2OCC E;  4DLO A;  3PNL B;  5TDR A;  1N0R A;  2VGX B;  4U8Y D;  2K4D A;  1DNP A;  2WQ6 A;  3ASO E;  2ECT A;  3EU9 A;  5AJL A;  1S63 A;  2WXL A;  5CMY A;  5JJ7 A;  3IV0 A;  4W9R A;  2LAI A;  4FIP A;  3EHR A;  4BHW A;  3ZYL A;  3EU5 A;  4GPM A;  2OV8 A;  4MVT A;  3LVR E;  3QAR A;  3UPV A;  5HKP A;  4LNG A;  4MBG A;  4BY6 A;  3CKC A;  4GA1 A;  5A23 A;  2CKL A;  2ECN A;  4LEU A;  1UN8 A;  3U5O A;  3R7Q A;  2RKK A;  4OGC A;  3DPD A;  3MKQ A;  1N11 A;  3KDE C;  5D0Q D;  4I6E A;  5G05 J;  3Q9N C;  2WXI A;  1BU9 A;  4N2Q A;  2H6F A;  1B89 A;  2VJE A;  3UUX A;  1X4J A;  2JMD A;  4FJC A;  3PHD A;  3IHP A;  4AP2 A;  2FBN A;  3D9M A;  3O70 A;  4LAD B;  1HG5 A;  3HXD A;  3ZVV A;  4U96 D;  4BT8 A;  2H6I A;  1E8Z A;  5FB1 A;  4XKC A;  4X8Q A;  3O34 A;  1SA5 A;  3CHR A;  2VQ2 A;  2CHW A;  3UI2 A;  2Q7F A;  5FZR A;  4DLQ A;  3FU5 A;  5ENS D;  2AVP A;  2XGM A;  3MEK A;  5EN5 D;  2X6I A;  4EZK A;  4FO9 A;  3W9F A;  3TG4 A;  3L9T A;  4GZ3 A;  3GZ2 A;  3LQH A;  3SGH A;  3CHO A;  4P29 A;  2CHX A;  2F0Y A;  3U9W A;  4FLH A;  2LSV A;  1TNO A;  2MOW A;  5M72 A;  4ATZ D;  1MBM A;  4C48 B;  5KCM A;  3S7J A;  3MKR A;  2LAH A;  2EA6 A;  4GZ6 A;  5AQA A;  3FEH A;  5SVI B;  4GMJ A;  2G45 A;  4OAU C;  3FAN A;  3TWU A;  3PDN A;  5H7P A;  5LCW J;  5CER B;  4HRL A;  4WWO A;  1P5Q A;  2Y3A A;  1WEQ A;  3E32 A;  3IHV A;  5KJL A;  1TNZ A;  1HZ4 A;  4UWH A;  3NG2 A;  3V30 A;  3Q78 A;  1MM2 A;  2JM3 A;  3FUH A;  4C0E A;  1VDY A;  4KXK B;  3U5M A;  2C2V S;  4U63 A;  5FEY A;  3HDX A;  2KWK A;  3FL2 A;  2OXQ C;  5FQ7 A;  3IBE A;  3RRU A;  2V0P A;  4QF3 A;  2IQJ A;  4CRW A;  1E7U A;  2P2C P;  4AV7 A;  4DRX E;  1TNB A;  1LD7 A;  2OEW A;  2XEV A;  3ESL A;  3M99 A;  2QZA A;  1HX8 A;  1WEW A;  1LDJ B;  5BNW A;  1NZN A;  4BSX A;  4JA7 A;  1ELW A;  3ZGQ A;  3T9K A;  1WEO A;  5E76 A;  5KWD A;  3L13 A;  3TG5 A;  4I9C A;  3QDN A;  3FUK A;  5K3Q A;  1N0Q A;  3ZVY A;  1K8K G;  4N4F A;  4G26 A;  4G1T A;  2MA5 A;  4U0Z A;  3FTZ A;  5AN8 A;  3NZS A;  4YVO A;  3ML9 A;  4F1S A;  3AS4 A;  2PNX A;  3PZD A;  2AXV A;  5A7D B;  3ZXP A;  2CHZ A;  3Q1D A;  4DX5 D;  4DI4 A;  4YDE A;  2A5E A;  4YDW A;  4AM9 A;  2RI7 A;  3LQJ A;  2WXG A;  1Z3Y A;  2KCL A;  3T5X A;  4YAX A;  3NOC D;  4QFV A;  5H1T A;  4HLL A;  3OAW A;  4AYC A;  1YCS B;  4BSZ B;  1IYG A;  4UWG A;  3EJN A;  2FF4 A;  1U3C A;  4Q96 A;  5ENT D;  3PUJ A;  3TWV A;  5AIJ A;  3M7K A;  3HXE A;  4HOU A;  3HIZ A;  1TNU A;  4APF A;  2XHE A;  4WZ0 A;  1SQM A;  1JM7 B;  4C9B B;  3GZS A;  5G04 J;  1N4P A;  2ECV A;  3B95 A;  3CST A;  3UXG A;  3Q5M A;  3L08 A;  2XGS A;  2MUM A;  3SHF A;  2A4Z A;  1N95 A;  3RTR B;  1N94 A;  1Y6I A;  1YA0 A;  3FTY A;  1OWN A;  3DSV A;  5LOZ A;  3C3R A;  3O37 A;  4G24 A;  4TXR A;  4YBT A;  5CEA A;  4A55 A;  4GTS A;  4BTB A;  1WES A;  3DDT A;  2A5U A;  3FU0 A;  5B77 A;  4TXP A;  5FER A;  3V2X A;  5C2Y A;  4HS2 A;  3FJU B;  4QQI A;  2P9N G;  3MX3 A;  2ECG A;  3UM3 A;  1DVP A;  4F53 A;  3ISM C;  2WPV A;  4YAT A;  4LUN U;  1L5J A;  3ESK A;  3VTY A;  4DX2 A;  1OWM A;  2XZD G;  4IN3 B;  2X6J A;  1YMP A;  1K3Z D;  3CR3 A;  1AWC B;  4NIK A;  3N9P A;  4YC9 A;  4HI9 A;  2L43 A;  2EIN E;  3LJN A;  3AG4 E; 
#chains in the Genus database with same CATH homology
 2A5E A;  2P57 A;  2ZGG A;  4A63 B;  4YDW A;  3TWS A;  2L7P A;  2KKY A;  4Z68 A;  3FM8 C;  2MKE A;  4RLY A;  5EN5 D;  5AAR A;  2XEE A;  4LSZ E;  5CBN A;  3Q9U C;  3W9F A;  3NOG D;  4YDY A;  2DJA A;  3H7H A;  3NOC D;  4U95 D;  4QQ4 A;  4K5A B;  4QFV A;  1SW6 A;  4F6R D;  3O47 A;  2ETA A;  4DX7 D;  3AJI A;  2HE0 A;  4HLL A;  3C5R A;  5CED B;  4K5C A;  2EGM A;  1YCS B;  2AJA A;  3DEP A;  5HRY A;  4BSZ B;  4OGE A;  4J8Y A;  3SUB A;  5ITZ F;  4B93 B;  1MX2 A;  2BKG A;  2F8X K;  4ATZ D;  4C48 B;  3ZUV B;  4HRM B;  5ENT D;  2CRR A;  4H9D A;  4LG6 A;  5AQA A;  1MYO A;  3TWV A;  3FEH A;  5SVI B;  2MYO A;  4OAU C;  2CRW A;  3M7K A;  3J5P A;  2NYJ A;  3TWU A;  1TR4 A;  3TWR A;  2KKX A;  5SVI A;  1N0R A;  5CER B;  2FO1 E;  4HRL A;  4U8Y D;  2LAU A;  5ENP D;  4BET A;  4CZ2 D;  4Z0O A;  2DVW A;  4O62 A;  3KDE C;  2JUN A;  3D9H A;  2VGE A;  3V31 A;  1K1B A;  4BER A;  3F6Q A;  4F1P A;  3EU9 A;  4JB8 P;  2XEN A;  5HS0 A;  3V30 A;  3T8K A;  2JAB A;  3TWQ A;  1IHB A;  2F8Y A;  2XOC A;  2XP0 A;  4O1O A;  2XZT G;  3HRA A;  3B95 A;  3EHR A;  4HNA D;  5D66 A;  3TWT A;  2JM3 A;  5SVY A;  3UXG A;  3E2D A;  3JUE A;  5FIO A;  3LJU X;  5JA4 D;  3J5Q B;  5EYL A;  3DEO A;  3LVQ E;  2QC9 A;  4GPM A;  2OWA A;  5KBA A;  2V4H C;  3KEA A;  1SVX A;  4HB5 A;  4ZHB A;  5SVX A;  4HRN A;  3LVR E;  3LDY A;  3JXJ A;  1BI7 B;  4DX6 D;  2IQJ A;  5HKP A;  1A5E A;  4HI8 A;  5BXU A;  5EIB E;  2EXU A;  3AAA C;  4HBD A;  1S70 B;  1MX6 A;  2P2C P;  4G8L A;  4U8V D;  4DRX E;  2ETB A;  2V5Q C;  3UI2 A;  3ZKJ A;  5CEA A;  2FFW A;  4UUC A;  1IXV A;  1MJ0 A;  3B7B A;  2KXP C;  4DUI A;  3DDT A;  2YVR A;  4OGC A;  3W9G A;  1BLX B;  5AQ7 A;  3V79 K;  3V2X A;  1N11 A;  2RFM A;  3EHQ A;  1QYM A;  1BD8 A;  2DZO A;  3IXE A;  3TWW A;  4GMR A;  4QQI A;  2Y1L E;  4O60 A;  5EIL A;  4OAV B;  3DWD A;  3FJU B;  3HG0 D;  1DC2 A;  2DZN A;  2BKK B;  4Z0R A;  4BEP A;  1BI8 B;  5ENO D;  3Q9N C;  3V2O A;  5AAO A;  4HQD A;  2J8S D;  5CEC B;  3NBN B;  1BU9 A;  2CSV A;  2D8U A;  3ZNG A;  2YRE A;  3PLW A;  4G8K A;  5ENQ D;  3UTM A;  1OT8 A;  2KBX A;  3T9K A;  5EYP F;  2QYJ A;  3JXI A;  2RFA A;  1UOH A;  4O1P A;  1NFI E;  5ENR D;  5KWD A;  2XOY A;  5KNH D;  4DX2 A;  5EID A;  3ZU7 B;  2B0O E;  2PNN A;  5BXO A;  1G3N B;  2CON A;  4N5Q A;  1WG0 A;  2ZGD A;  5FIN A;  2RR4 A;  5AQ9 A;  1IKN D;  4U96 D;  2FD4 A;  2XZD G;  5K3Q A;  1N0Q A;  4LNU D;  4TUM A;  1YMP A;  1K3Z D;  1AP7 A;  4ZFH A;  5AN8 A;  1AWC B;  4NIK A;  4BES A;  3SO8 A;  4CYM D;  4DX1 A;  5KNG A;  1YYH A;  1D9S A;  2E61 A;  1WDY A;  1K1A A;  5JMN D;  1DCQ A;  2DWZ A;  2ETC A;  2F37 A;  4J7W A;  4HI9 A;  2XEH A;  5ENS D;  5CBO A;  2M13 A;  2XOZ A;  3LJN A;  5AQB A;  3Q1D A;  1MX4 A;  1OY3 D;  3TWX A;  3MDB C;  4DX5 D;  2Y0B G;  4K5B A;  2L6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...