2B0OE

Crystal structure of uplc1 gap domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
264
Chain Sequence
b'DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UPLC1
publication title Structural analysis of GAP and ankyrin domains of UPLC1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 82
structure length 264
sequence length 265
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2b0oE02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2b0oE01
5D66A 3FEHA 1MX6A 3HG0D 1NFIE 2ETCA 2V4HC 4F1PA 4HQDA 3TWTA 1BD8A 1N0QA 4BERA 2XENA 1DCQA 1MJ0A 2P2CP 5ENPD 5BXUA 5CEDB 3J5PA 5ENRD 2XZDG 5AQAA 1TR4A 5JMND 2NYJA 4CZ2D 1MX2A 2HE0A 2MYOA 4TUMA 5FIOA 4J8YA 4DX6D 5JA4D 5EIBE 2DVWA 3AJIA 5EN5D 3V31A 3SUBA 1N11A 4UUCA 4YDWA 4HNAD 5AN8A 3DEPA 5CBNA 3KEAA 4DX2A 3NBNB 3FM8C 5EYPF 2BKKB 1A5EA 1DC2A 2PNNA 3T8KA 4ZFHA 4K5AB 2Y1LE 4F6RD 2QYJA 4DX7D 1D9SA 2BKGA 4ZHBA 5CECB 4QQIA 3EHQA 2AJAA 5KNHD 3TWVA 1IHBA 4BSZB 3NOCD 4J7WA 5AAOA 4GMRA 1N0RA 3T9KA 2VGEA 2XZTG 3ZNGA 2RFMA 5EIDA 2ZGGA 3JXJA 4K5BA 3TWXA 3LVQE 4DUIA 4BESA 5HS0A 3EU9A 3Q9UC 3LVRE 3O47A 4G8KA 4B93B 5CEAA 3UI2A 4K5CA 4BETA 4DX1A 2RFAA 5KBAA 1SW6A 2KBXA 5AQ9A 3C5RA 3DEOA 3NOGD 3V30A 1IKND 3D9HA 2L6BA 3HRAA 3TWQA 3DWDA 4DRXE 4LG6A 3ZKJA 2CRRA 5AQ7A 3JXIA 4A63B 4ATZD 3LJUX 3ZU7B 5CERB 2QC9A 2V5QC 3ZUVB 3J5QB 2FO1E 3Q9NC 5FINA 3W9FA 1YCSB 1OT8A 4G8LA 5ENQD 2F8YA 4RLYA 4NIKA 4BEPA 4HRMB 2P57A 3JUEA 1IXVA 5CBOA 3SO8A 2IQJA 4U8VD 3EHRA 5EYLA 3TWUA 3V2XA 4JB8P 2CRWA 1YYHA 2A5EA 2XEHA 1QYMA 3F6QA 1BU9A 1BI7B 1WDYA 4HRLA 2Y0BG 3UXGA 2DZNA 4LNUD 4Z68A 4OAUC 1SVXA 3MDBC 4QFVA 1BI8B 4O1PA 3LJNA 5AQBA 4HB5A 4HRNA 1WG0A 2JABA 4U8YD 4HI9A 5AARA 5ITZF 4HLLA 5ENSD 2F8XK 2XEEA 4GPMA 5HKPA 1YMPA 2ZGDA 1OY3D 4O1OA 3UTMA 3TWSA 1AWCB 4CYMD 3B95A 3TWRA 1UOHA 4C48B 2ETBA 2J8SD 4O60A 3V79K 1BLXB 1K1AA 2F37A 3IXEA 5ENOD 3AAAC 4HBDA 5KNGA 4LSZE 4YDYA 4DX5D 1G3NB 1S70B 3W9GA 4U96D 5KWDA 1AP7A 1MYOA 3TWWA 3V2OA 1MX4A 4HI8A 5EILA 2KXPC 2B0OE 2DWZA 1K1BA 2ETAA 5HRYA 4U95D 1K3ZD 2DZOA 5ENTD 5BXOA 4OAVB 4N5QA 3B7BA 2OWAA
chains in the Genus database with same CATH superfamily
4BHWA 4UI9B 4ANVA 2IJGX 1NA3A 4HQDA 3FUHA 2E6RA 1WE9A 3ML8A 2R5SA 4WWOA 2L9BA 2XS8A 3U64A 3V31A 2Y4TA 4W4UA 4YDWA 4C0MA 3LEWA 4KXKB 2VPGA 2KC7A 2R59A 4BX9A 5JHBA 1HG2A 4F6RD 1S63A 4RG6A 3SHBA 1E7VA 2WXRA 2V4LA 5AJLA 3ZTGA 4CGWA 2RG8A 5FERA 2IY0C 5KJNA 2P9LG 2VGEA 3OXGA 2KWKA 3Q9UC 2KBXA 1ELWA 2IOSA 2MOWA 4I6GA 3ZPVE 1XGWA 4FHKA 3ZHEA 3L16A 4I2WA 4ATZD 2V5QC 3C6WA 3W9FA 2OEWA 3LKUA 5AJDA 3RAUA 2YQ8A 4AVXA 2HDPA 2YHCA 3SO8A 4J8SA 4GMJA 2MHKA 4U8HA 2VJ8A 1BU9A 2DIWA 4B7YC 5D1KB 2LQ6A 2KREA 3M62A 3MDBC 3E2DA 4A49A 3CV0A 2ZU6B 3C72A 2XP0A 2IF4A 2K4DA 3NAWA 5FJYA 2QICA 3MCXA 2NSZA 3QB2A 1QZ2A 4Y6CA 2I50A 3Q15A 2AXUA 3EIJA 5CCMA 3HTKC 4J6IA 4U07A 1EYHA 3FP3A 4M7CA 4N2SA 2VJFB 4GNFA 3Q1DA 4GU5A 4W9RA 4BTBA 1Y8MA 2YREA 5G2NA 2I1JA 3QWWA 4FU3A 4P5OB 4UI9K 4IC3A 4U63A 3S2AA 2YINA 2QFCA 3IKOB 2GRNB 3ZRHA 4MSXA 3UIPC 2BEDA 4I7CA 1H2TC 2KCKA 2WXMA 5LKTA 4BFRA 4N4FA 3OTNA 4I6EA 2BKGA 1FBVA 3RSEG 2DYSE 3CQGB 3QAQA 5DBKA 4BWRA 5BNWA 1PC2A 4WA6A 2EODA 2XGMA 3TWXA 3ABME 4G8KA 3RPGB 3UI2A 2LSUA 3TXMA 4BETA 2JMJA 3RO3A 5BV1A 3UT4A 4YATA 4LG6A 2FUIA 4F52B 3CHRA 3ULEG 1NI1A 3QJZA 4RVBA 2VJFA 3SOUA 2MUMA 2ECWA 3FTWA 5KJLA 4LK9A 2A4ZA 1HH8A 5FB0A 3ESLA 4U7EB 2FF4A 2MIQA 1QYMA 5C13A 4Z68A 2CSYA 1FVHA 3T6RA 3LJNA 4HB5A 5ITZF 3MYVA 3FTUA 3D3MA 4AEZC 3N71A 1YMPA 3CHOA 4TKPB 2XOCA 3UINC 3FFLA 3TG5A 4DJAA 3LY7A 3U9WA 3P2BA 5G0FA 1OWOA 2CFUA 5FQ6A 2CONA 1H0AA 4AIFA 2B0OE 4L9PA 3X2QE 2H6HA 2OXQC 4QF2A 4YABA 2XCBA 3QKYA 1UG3A 2E0IA 3B7TA 3FU3A 1DCQA 1MJ0A 2KYUA 4GA2A 1O5MA 5AQAA 1WENA 1TJCA 3QWPA 4J8YA 4DX6D 1S64A 2GGFA 2ILRA 3CLJA 1CHCA 4A0CD 4RQIA 3IHYA 3U5OA 4JHKA 4G26A 3D9MA 1D9SA 2HYZA 5B8DA 4GCNA 3UQ3A 5AAOA 3KS2A 2ZXWE 2F42A 5FZSA 4XE0A 3AG4E 5KBAA 3KSLA 3MHHA 3FU0A 1D8DA 3N9PA 3HRAA 1WEEA 3D9JA 2OV8A 3ZYQA 2M3HA 2NAAA 3QDNA 2UZGA 4LERA 1JPLA 4AYCA 1OWNA 3ZXPA 1TN7A 1X5BA 4RLYA 2V8SE 5G04J 3JUEA 2LRIC 4KMOA 1BI7B 1WM5A 3HCSA 3DWLG 1V55E 4DK5A 4WWNA 5A6CA 3FUFA 2PM6A 2XHEA 1WG0A 3MGBA 4M3OA 3G2WA 3LPZA 3PZ1A 4RG9A 4V3LC 4JXTA 1E8ZA 1UOHA 2Y4UA 2J07A 1WILA 1K1AA 3IXEA 5C1DA 4IC2A 4UI9J 1U2VG 1K3ZD 2VQ2A 2Y3AA 3CVPA 2XGOA 4A63B 5T8IA 3Q47B 4WNDA 4ANWA 2YQMA 3HXDA 4DLQA 3SFXA 1TNUA 4LNGA 2CSZA 1N0QA 4KYOB 3DXKG 4D10C 2H0DB 1HXIA 1TN8A 5EIBE 3EHNA 4I6JA 2KATA 3D9NA 1ZBDB 4H7YA 3U3WA 5ARFA 2H6IA 2YSMA 4WZ3B 2PNNA 2LAIA 3ESKA 3ULYA 1JCSA 1H2VC 5B75A 3HXCA 2PNXA 4J7WA 1HE8A 1H6KA 4GNDA 4HOSA 4EZKA 3ZNIA 3LQJA 5D2MC 2KGIA 2EIME 5HS0A 3QZVA 2XCCA 1WEVA 3CR3A 3C5RA 1IKND 1WGMA 2VPEA 3KV6A 5EX0A 5I3LA 3ZUVB 5B78A 2EIJE 2FO1E 2RD0A 3U5PA 3E30A 2L5UA 1D8EA 1IXVA 2LDRA 2IQJA 5EYLA 4DLOA 3TXNA 4I1OB 2P9NG 4HXIA 4RSYA 5D1LB 3CIAA 5AENA 3KQIA 4WUYA 3ASOE 2LAHA 1VYXA 3EHMA 4ZDTA 5FTPA 3DSXA 3HVEB 2G45A 2F37A 3W9GA 2X6HA 2EXUA 3VLFA 3IEGA 3HCTA 2ECTA 2X6JA 5BXOA 4OGEA 2VGXB 2I6HA 2J08A 2KZTB 4GZ6A 2FD4A 2EGMA 3SBTB 3DPLR 2PUYA 5H1TA 5TRBA 4FJZA 1OCCE 3TG4A 5DINA 2I9CA 5CRVA 5CBNA 3NBNB 1EDUA 3R7RA 4CDNA 2IEJA 4AY5A 4K5AB 1X4UA 4JD2G 2M63A 3SFYA 1WY6A 4GMRA 4N5CA 1HF8A 2M1RA 4B93B 2YVRA 2KIZA 3HVEA 5AQ9A 1LDJB 2XEUA 1N4SA 3KV5A 3JXIA 3O7AA 3LY8A 4XI9A 4B0ZA 3UM2A 2VGXA 3RPGC 3DBSA 3GL6A 4R8PK 3EHRA 4I1MA 3MHSA 4JEHA 4GYYA 4LNUD 3JYSA 1N52A 3SNXA 4B86C 1L5JA 4U8YD 2X6IA 3DSTA 4MS6A 4XKBA 3R9MA 5ENSD 2XEEA 2OVBA 2WVIA 1OY3D 3BG1B 4C0EA 3L08A 4TRQA 3B95A 5KJKA 4JA7A 2Y1MA 2J8SD 2P9PG 5H7PA 3CHMA 3AAAC 5AITA 5D0OD 3E34A 4XZ4A 1OWMA 3CSTA 3S7JA 5TDWA 1Q2ZA 3I3NA 4OAVB 3D9LA 3FH5A 4F1PA 5BUZA 4N3WA 2VSOE 2XENA 1FT1A 4WNFA 3NG2A 2HE0A 4TUMA 4A3TA 2NXPA 2YYRA 2CKLB 4B8CB 3AG2E 2VSNA 2IO2C 4HNAD 4J8EA 3HXFA 4NQ0A 1HU3A 2OCCE 3LS8A 5A23A 2KKYA 1A17A 3TJPA 4EQFA 3UT8A 4KVMA 5CMWA 3O70A 1UN9A 4DI4A 2EIKE 2GRPB 3RRNB 2CT2A 2EILE 2PZIA 3TAXA 1G25A 2YQLA 2YHNA 1WEWA 4QQIA 3EHQA 5B77A 4ACKA 2L43A 4H9DA 2FI7A 4OVUA 3KAEA 4U0UA 3B13A 3PEVB 2AVPA 1OCOE 3O47A 3URZA 2PM7A 3N9QA 3C3OA 5JJ6A 2CG3A 2K1JA 1TN6A 1UN8A 2GRLA 2FEZA 1MQSA 4YVQC 4EPZA 1YCSB 2WXIA 2GRQB 5FEYA 2MA5A 3LRQA 1U6GB 1U3DA 3TWUA 3N9NA 2YHEA 3CGHA 1U3CA 1YYHA 3ASNE 3F6QA 4NN2A 2KU3A 3G2VA 2CKLA 1OCRE 2WMOA 4AV7A 4O1PA 5T4YA 1JOCA 4HORA 1IYMA 3ZPJA 3ZFWA 1TYQG 4B94A 3PVLA 4BX8A 3CVYA 3UTMA 2D8UA 5FQ8A 2ETBA 2P9IG 5KNGA 3HIZA 1LD8A 4GZDA 3D9PA 3O33A 2FO7A 3V2OA 1NZNA 3IHVA 2NYJA 3QWVA 3ONKA 5LP0A 4I43A 3PHDA 3S7FA 4Q96A 4TXQA 3LDYA 3ZYKA 4G1TA 2A5UA 4KT6B 5D1MB 3Q75A 1WEQA 3M7KA 3AJIA 4CDRA 4A1SA 1O1TA 3DEPA 4FA6A 5M72A 4PPEA 4YNDA 2GROB 3NB2A 4HOQA 2X3MA 2J4BA 5CRUA 3I4RB 1O1RA 4CEMA 3DPDA 2WXJA 1WEMA 3UPVA 1IHBA 4ANXA 1XNFA 3B7RL 3U5NA 2EQXA 5G05B 2RFMA 1KT0A 1JCQA 1LTXA 5J3XA 1FCHA 2IU1A 4AY6A 2VP7A 3FY4A 3RJVA 1Z60A 4X3GA 1E8WA 4N3BA 1QQEA 3U66A 3L11A 4L7XA 3P1UA 3DSSA 5B3SE 3ZEFA 2E6SA 3CVQA 2CFZA 4OVVA 2XEHA 3O48A 4UQXA 3UXGA 1V54E 3FANA 3MEKA 3PUKA 3CVWA 4HRNA 2VPBA 2X6KA 3B7SA 2AXZA 4G2VA 2IQCA 2IDAA 3L13A 4HBDA 4LUNU 4LLBA 3ASLA 4XI1A 3L1ZB 4HI8A 3FUIA 2C0LA 4U95D 1NA0A 5ENTD 4HFGA 1JWFA 3HDXA 1W3BA 1BPOA 1TNOA 5AIJA 2V4HC 3NZSA 4BERA 4FIPA 4PUCA 1OWPA 2LXMA 4BY6A 4AJWA 4F1SA 5CEDB 3MX3A 4A3VA 3SOXA 1TR4A 5JMND 2K17A 3PNLB 4CZ2D 2ECNA 2LGVA 4UP5A 2OEVA 5EN5D 4XX5A 3CVXA 3GV4A 2YNQA 5AN8A 3FM8C 3OAWA 3CHSA 3KEAA 2YW8A 5CHEE 2BKKB 3T8KA 4AYCB 3NF1A 4GAAA 2K16A 3ASDA 3SQVA 5KNHD 4V3KC 3Q49B 3GZ1A 1Z3YA 3E4BA 4BESA 1WEOA 3EU9A 1Z6UA 2P9KG 3Q79A 3ASGA 4XEIG 3AU5A 2HYED 2YHOA 4BEPA 1MM2A 2L75A 5FWQA 4GZ3A 3MZLB 2YURA 4J0UA 1DCEA 2VJEB 2VYIA 2VPDA 3N9LA 4B8AA 4GTOA 4S3OC 4FLHA 2QJ0A 5LKUA 2BF0X 4L2LA 4GA0A 4CGVA 5HKPA 5FT9A 2ZETC 4J8FA 2G43A 4C9ZA 3JQ1A 1HO8A 2C0MA 3AS4A 4QQ4A 1RZ4A 5CCLA 4LSZE 4YDYA 1TNBA 4DX5D 2J09A 3AU4A 3FUDA 3EIQC 3O4ZA 5K3QA 4L7TA 2YSJA 2JUNA 2LXLA 2JEKA 1FPPA 2L6JA 2M6MA 2F0YA 2VGYA 4GYWA 2MRIA 5ANRA 2YUCA 4EECA 3FUKA 2VSXE 4LNBA 3DSWA 1O1SA 3ZYLA 3SUBA 1N11A 3CVLA 2FSAA 1ZB1A 5EYAF 4AP2A 2VJEA 3ABKE 3ZPV1 5EX3A 5CECB 3FU5A 3TWVA 1N0RA 1B89A 3FTVA 2XZTG 5SVIB 4XKCA 3DXMG 3PUJA 4LADB 3JXJA 1ELKA 1LD7A 3LVQE 5BPPA 1N9AA 2XOYA 3QARA 2KKXA 1S0PA 4CCAA 3SD5A 3LJUX 4G11A 3V43A 4LJNA 2RKKA 4KZCA 1RW2A 3RRUA 3O36A 3Q5MA 4MBGA 3UT7A 3SOWA 1Y6IA 4U8VD 3CEQA 2F6NA 1IYGA 5FQ4A 5HQ8A 1TNYA 4GTTA 3UM0A 3L9TA 4GTMA 4J8DA 3D9OA 3D9IA 4WWPA 1N4QA 2XPZA 3ZW3A 5DKAA 1KPSB 2UWJG 1IQUA 4Q94A 2R17C 3BU8A 4GPKA 3UM3A 4ILGA 4C48B 3APDA 3L1XA 2KM4A 4O60A 1T1HA 1JUQA 1G3NB 2KR4A 4MVTA 3RRMB 2KXPC 2XPYA 5SVIA 3ZGQA 4L2YA 3BEEA 3N9OA 3CVNA 2DJAA 3UKRG 3KSQA 1MX6A 5SVXA 5KCMA 4AOFA 4R2YA 5SVYA 3T8MA 2CHXA 3VK6A 5E75A 3IBEA 3EJNA 2XPIA 2WMNA 3S7DA 4K0RA 4JZYA 2MYOA 4HOTA 3L22A 3UMVA 2DVWA 1H6PA 3SBSA 3CK7A 3UIOC 4N3CA 2KWJA 4URKA 4AM9A 5D0QD 1Z2QA 5B76A 1Z6TA 4GCOA 5B79A 4ATGA 2L7PA 3I2DA 2AJAA 3HYMB 3LXUX 3FDHA 5FB1A 3Q7FA 3FUMA 3ISMC 3RK6A 2BAYA 4EBAA 3ZYMA 3E32A 4JHJA 3ENEA 2PL2A 3L54A 3VTXA 3RO2A 4I9CA 2JMIA 2MD7B 3DWDA 4EHMA 3ABLE 5AQ7A 4F53A 5C2YA 4FC8A 5G05C 1X81A 2CSVA 2LSVA 4BT9A 1INZA 1F62A 2EGPA 1FVFA 4H7XA 4GYOA 3Q73A 4GZ5A 1ZBPA 2ECIA 4FLBA 2DSMA 3GZ2A 3Q78A 2A5EA 4JL0A 2CG2A 2B6CA 3PNTB 3LDZA 4UQZA 4YDEA 3N9MA 1SVXA 3ASHA 2KFTA 3MJWA 5AARA 3BQOA 2F8XK 3OXLA 2ZGDA 2VNFA 1IHGA 3ONLA 4HS2A 1AWCB 4S3OB 4CYMD 1N54A 3GW4A 3V79K 5ENOD 4FADA 1N94A 3G2UA 3TWWA 4F3VA 3PE3A 2MD8C 2DWZA 5HRYA 4ZUXU 2DZOA 4UWGA 4N5QA 2OWAA 1NL4A 3FEHA 3SI5A 3HG0D 3HXEA 2R03A 3E33A 4YBSA 4GA1A 2XRZA 3CVUA 3PEUB 2LGLA 4A55A 4E6HA 1FT2A 3CK8A 4UP0A 2WXHA 1SZAA 3I4GA 1E4UA 4Q69A 4WNGA 3PDNA 4CT4A 1FP0A 4UWFA 3PH0C 3CK9A 5CMYA 4LKAA 4JVSA 2QYJA 2WQ6A 4WNEA 3NOCD 4GTRA 4MRUA 4JEUA 2ZGGA 2H6GA 4XI0A 4IRUA 3ZVYA 3JUIA 3FEXA 3R7QA 5B1BE 4A1GA 4GTPA 4FP7A 2ZISA 1SW6A 1N4RA 3FEYA 1ZU2A 2CRRA 2QIZA 2WPVA 3UUXA 2QC9A 3QK0A 2ECJA 2RSDA 3UX4A 2F8YA 2DX8A 4A4BA 2E61A 2JRJA 3JCKC 2HM8A 3DSVA 1VDYA 3O35A 3CVVA 3FHEA 3QNKA 5ANLA 2DZNA 4P29A 4QFVA 3TL5A 1K2FA 4GB0A 2KCLA 4O64A 4GB9A 4GPMA 1N87A 1QNFA 5C11A 1HG5A 1NP7A 1UJJA 3PRZA 1JCRA 1BLXB 1VFYA 2HR2A 1MHQA 4U96D 4GNGA 1IQRA 4WAFA 2RI7A 1MX4A 5EILA 1E96B 2JLBA 3PREA 4MLPA 1NFIE 2ETCA 3FL2A 2AWIA 3O37A 2MT5A 1HYIA 2GRMA 4NRHB 4YVOA 4E85A 3J5PA 3MKRA 3Q7AA 1QBQA 5JA4D 2X38A 4G25A 5DIZA 2DYRE 4BBQA 1N4PA 5IY5E 1UW4B 3R9AB 3PZDA 2Q7FA 1RMDA 4DX7D 5HI7A 4FULA 4ZHBA 4FHJA 3PURA 2FUUA 1OUVA 4EZJA 2WXFA 4PS3A 1TNZA 3QC1A 1DNPA 3UKUG 4K5BA 3KD7A 4DUIA 4TV3A 4YC9A 3HCUA 4B89A 4UWLA 3PZ4A 3GZSA 3T5XA 5CERB 3RKVA 4TUUA 3APFA 3J5QB 5LKZA 3DRAA 4N2QA 3SF4A 4NIKA 1KZOA 2J49A 1PY1A 5AYWD 2CRWA 1SA4A 3NZUA 4PS8A 3AG3E 3FTSA 2Y0BG 4WZ2A 1SA5A 2P9SG 2WXOA 2WXQA 4YADA 4YAXA 3PUQA 4HI9A 1JM7B 1KZPA 4HLLA 3TWSA 4OYSA 4V3IA 3VLDA 3M63A 2VSYA 2I1KA 2E2EA 3CHQA 1HFAA 4F7AA 1MYOA 4G24A 2WXLA 2V5FA 1K1BA 3TGOA 3C5KA 3L6AA 4NURA 4I2ZA 1WIMA 3FH8A 3T7LA 3E37A 4QF3A 4PTBA 4EZLA 2KGGA 2YU4A 4KVOA 5BXUA 3L17A 1SQMA 3ULQA 5ENRD 5TBNA 2MA6A 3CQCB 1MX2A 2WQHA 3M99A 4BT8A 3WXXA 4U0SA 1EF1C 4IYPA 4UUCA 2GW1A 2LNIA 5H1VA 4BSXA 2L0BA 5EYPF 4Q6FA 2L80A 2MKEA 3ZVZB 4ZFHA 3LY9A 4YBMA 4XIFA 1HX8A 2XEVA 4BSZB 4EBAG 4KZ0A 2QZAA 2QYUA 3T9KA 1JM7A 3ZNGA 3CKCA 5BV0A 4N3AA 1WESA 5J08A 3FWVA 2RFAA 3AG1E 3DEOA 3NOGD 1E7UA 4JHRA 4OGCA 3IHPA 4ME2A 4O6FA 3JQ0A 4CT0A 3OXFA 2XQ0A 2DBAA 3Q9NC 2Y43A 4UWHA 1OWLA 2XS1A 5LCWB 4GNEA 2V0PA 2P57A 2CHZA 4L1BA 1N95A 4L58A 5LX8A 4A4CA 2XRYA 2AN6A 2ECGA 4CRWA 1MM3A 2XGSA 1WDYA 2J9QA 5H1UA 3KDEC 2LAUA 1BI8B 1K8KG 5AQBA 2PQRA 2X6FA 4U0ZA 4LRZA 4O1OA 4UWKA 3TWRA 5JHAA 1WEPA 4ANUA 2KWOA 2R2LA 2ZIRA 4U04A 2LUHA 5G55A 4ZQLA 3PS6A 1YA0A 1UJKA 1BORA 3L82A 5B1AE 4FJCA 4WZ0A 2ECVA 2XB1A 5TDRA 2P2CP 4DPRA 3ML9A 2AW6A 4ILHB 1XWHA 5LFAA 5KH3A 1MBMA 5JJ7A 3SY2A 4DX2A 3FUJA 2P9UG 4I9EA 1A5EA 1DC2A 2WQ7A 4Z0RA 1WFKA 3C3RA 4IN3B 3SFZA 3CSFA 4Y6WA 2MNZA 4JPSA 4TXPA 4AUQB 1HYJA 4YBTA 1SZ9A 3HXBA 4GMLA 4HOUA 3APCA 4DI3A 1H19A 2C2VS 4DX1A 5TABA 3FJUB 3D9HA 2L6BA 1ELRA 1TEZA 5EDSA 4DRXE 3MV2B 4AXHA 3G2TA 4LCTA 3BG0B 3ZN3A 5LOZA 3PE4A 3HHMA 5BT1A 2KWNA 4R7EA 3PLWA 5ENQD 3MV3B 3FAOA 2BTDA 2WXGA 2NC9A 2ONDA 4CDMA 2I2OA 3LJ3A 3RU0A 5ARGA 5G04C 3RTRB 2JM3A 3KEZA 4X8QA 5EKQD 3WG7E 1E8XA 2LO6A 3FULA 4C9BB 4MKTA 5FZQA 3SHFA 3DSUA 3SGHA 4HVBA 3EU5A 2L0TB 1Z5SC 5KJMA 2M13A 4GTQA 4I7BA 3MKQB 1GW6A 4FJYA 5FZRA 2OOEA 4TXRA 2C2LA 1S70B 1AP7A 3C3QA 2P58C 3ZIMA 4PS7A 4UI9C 3DPYA 5LKXA 2ETAA 1OCZE 3H7HA 2Y69E 5D66A 1WEUA 3DQVR 3PZ2A 1BD8A 2J4DA 3S7BA 2LN0A 2Y1NA 4R7LA 4APOA 3LCAA 5BW8C 4YDOA 2BUGA 1OXJA 3B7UX 5FIOA 4GZCA 4NACA 4N39A 4GTSA 2FBNA 2WM9A 3K9IA 3BUAA 2LGGA 2IFUA 3QOUA 5T3RA 5ENNA 4BTAA 5J90A 3T5VA 2G6QA 3KNVA 2PQNA 3MKQA 2LV9A 2H0DA 2WB2A 2YT5A 4I1AA 3FTYA 2RR4A 3MA5A 2WXKA 3EB5A 4LEUA 5JJTA 3EDTB 3I5PA 3TWQA 2WXPA 5G05J 2CHWA 4PDXA 1TJFA 3SZ7A 2AXVA 3G2SA 5H9MA 4I17A 4GTVA 2UY1B 4G8LA 2IO3C 3O34A 3EB6A 5CBOA 1H2UA 2EA6A 2WXNA 3GYZA 1JWGA 4ABNA 1HS6A 4FO9A 4OAUC 4Z0OA 3DDTA 2MNYA 3ZXSA 4ACLA 2D8SA 2LXPC 2FULA 2R02A 1LF8A 1H6OA 1KLXA 3RIBA 4IULA 3FTXA 3U4TA 4FK5A 5KWDA 3VTYA 3IV0A 3D9KA 1PAQA 3FTZA 1V87A 2OVFA 3UM1A 2EINE 3ASFA 3B7BA 5KH9A 3TWTA 2HO1A 2F6JA 5JG6A 2VTBB 3FUEA 1KT1A 4JA9A 5ENPD 2JMDA 4JC8A 2XZDG 3FH7A 3LYAA 2DCPA 2UY1A 1WAO1 3ZVVA 4CCGX 4KBQA 2GRRB 3Q4AB 2Y1LE 4UQYA 3NQPA 5A7DB 3C98A 5EIDA 2KZTA 3FUNA 2KE1A 2XOZA 1LDKC 4O62A 1DVPA 4I7DA 1HZ4A 4APFA 3LVRE 3PZ3A 5CEAA 4K5CA 4JW1A 3V30A 1X4JA 3AS8A 3ZKJA 5LCWJ 2LXHC 3LQHA 5E76A 2IOLA 5KH7A 1E8YA 3ZU7B 1VD4A 4PH4B 2QY7A 5FQ7A 3U5MA 5FINA 1OT8A 4HLEA 2R05A 2IONA 1EPUA 4HRMB 1P5QA 4L23A 2KCVA 4K03A 3FU6A 2VTBA 2LGKA 3V2XA 4JB8P 3AS5A 2FFWA 3CKBA 4HRLA 3EUVA 5G04B 2M85A 4ILIA 4G23A 2JABA 5AIUA 1E90A 1X4IA 5LCWC 2H6FA 3LQIA 4CA1A 3VLEA 3CHPA 1MZCA 3ZHEB 4AP4A 2L0IA 1Z3XA
chains in the Genus database with same CATH topology
5D66A 3FEHA 1MX6A 3HG0D 1NFIE 2ETCA 2V4HC 4F1PA 4HQDA 3TWTA 2YREA 5SVXA 1BD8A 5SVYA 1N0QA 4BERA 2XENA 1DCQA 1MJ0A 3LDYA 2P2CP 5ENPD 5BXUA 5CEDB 2FD4A 3J5PA 2EGMA 5ENRD 2XZDG 5AQAA 1TR4A 5JMND 2NYJA 4CZ2D 1MX2A 2HE0A 2MYOA 4TUMA 5FIOA 4J8YA 4DX6D 5JA4D 3M7KA 5EIBE 2DVWA 3AJIA 5EN5D 3V31A 3SUBA 1N11A 4UUCA 4YDWA 4HNAD 5AN8A 3DEPA 5CBNA 3KEAA 4DX2A 3NBNB 3FM8C 5EYPF 2KKYA 2BKKB 1A5EA 1DC2A 2PNNA 3T8KA 2MKEA 4ZFHA 4K5AB 2Y1LE 4Z0RA 4F6RD 2QYJA 4DX7D 1D9SA 2BKGA 4ZHBA 5CECB 4QQIA 3EHQA 2L7PA 2AJAA 5KNHD 3TWVA 1IHBA 4BSZB 3NOCD 4J7WA 4H9DA 5AAOA 4GMRA 1N0RA 3T9KA 2VGEA 2XZTG 3ZNGA 2RFMA 5EIDA 5SVIB 2ZGGA 2XOZA 4O62A 3JXJA 4K5BA 3TWXA 3LVQE 4DUIA 4BESA 5HS0A 3EU9A 3Q9UC 3LVRE 3O47A 4G8KA 4B93B 2YVRA 5CEAA 3UI2A 4K5CA 2RR4A 4BETA 4DX1A 2RFAA 5KBAA 1SW6A 2XOYA 2KBXA 5AQ9A 2KKXA 3C5RA 3DEOA 3NOGD 3V30A 1IKND 3FJUB 3D9HA 2L6BA 3HRAA 3TWQA 3DWDA 4DRXE 4LG6A 4OGCA 3ZKJA 2CRRA 5AQ7A 3JXIA 4A63B 2CSVA 4ATZD 3LJUX 3ZU7B 5CERB 2QC9A 2V5QC 3ZUVB 3J5QB 2FO1E 3Q9NC 5FINA 3W9FA 3PLWA 1YCSB 1OT8A 4G8LA 5ENQD 2F8YA 4RLYA 4NIKA 4BEPA 4HRMB 2P57A 3JUEA 1IXVA 5CBOA 2E61A 3SO8A 2IQJA 4U8VD 3EHRA 5EYLA 2JM3A 3TWUA 3V2XA 4JB8P 2CRWA 2JUNA 1YYHA 2A5EA 2XEHA 1QYMA 3F6QA 1BU9A 1BI7B 2FFWA 1WDYA 4HRLA 2Y0BG 3UXGA 2DZNA 4LNUD 4Z68A 4OAUC 4Z0OA 1SVXA 3KDEC 2LAUA 4QFVA 3E2DA 3MDBC 3DDTA 1BI8B 4O1PA 3LJNA 5AQBA 4HB5A 4HRNA 1WG0A 2JABA 4U8YD 4HI9A 5AARA 5ITZF 2XP0A 4HLLA 5ENSD 2F8XK 2XEEA 4GPMA 5HKPA 1YMPA 2M13A 2ZGDA 1OY3D 4O1OA 3UTMA 2XOCA 3TWSA 1AWCB 2D8UA 4CYMD 3B95A 3TWRA 1UOHA 4C48B 2ETBA 2J8SD 4O60A 3V79K 1BLXB 1K1AA 2F37A 3IXEA 5ENOD 3AAAC 4HBDA 5KNGA 4QQ4A 4LSZE 4YDYA 4DX5D 1G3NB 1S70B 3W9GA 4U96D 5KWDA 1AP7A 1MYOA 2EXUA 3TWWA 3V2OA 1MX4A 4HI8A 5EILA 2CONA 2KXPC 2B0OE 2DWZA 5K3QA 1K1BA 2ETAA 5HRYA 5SVIA 4U95D 1K3ZD 2DZOA 5ENTD 5BXOA 4OAVB 2DJAA 4N5QA 3B7BA 3H7HA 4OGEA 2OWAA 3Q1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D66 A;  3FEH A;  1MX6 A;  3HG0 D;  1NFI E;  2ETC A;  2V4H C;  4F1P A;  4HQD A;  3TWT A;  1BD8 A;  1N0Q A;  4BER A;  2XEN A;  1DCQ A;  1MJ0 A;  2P2C P;  5ENP D;  5BXU A;  5CED B;  3J5P A;  5ENR D;  2XZD G;  5AQA A;  1TR4 A;  5JMN D;  2NYJ A;  4CZ2 D;  1MX2 A;  2HE0 A;  2MYO A;  4TUM A;  5FIO A;  4J8Y A;  4DX6 D;  5JA4 D;  5EIB E;  2DVW A;  3AJI A;  5EN5 D;  3V31 A;  3SUB A;  1N11 A;  4UUC A;  4YDW A;  4HNA D;  5AN8 A;  3DEP A;  5CBN A;  3KEA A;  4DX2 A;  3NBN B;  3FM8 C;  5EYP F;  2BKK B;  1A5E A;  1DC2 A;  2PNN A;  3T8K A;  4ZFH A;  4K5A B;  2Y1L E;  4F6R D;  2QYJ A;  4DX7 D;  1D9S A;  2BKG A;  4ZHB A;  5CEC B;  4QQI A;  3EHQ A;  2AJA A;  5KNH D;  3TWV A;  1IHB A;  4BSZ B;  3NOC D;  4J7W A;  5AAO A;  4GMR A;  1N0R A;  3T9K A;  2VGE A;  2XZT G;  3ZNG A;  2RFM A;  5EID A;  2ZGG A;  3JXJ A;  4K5B A;  3TWX A;  3LVQ E;  4DUI A;  4BES A;  5HS0 A;  3EU9 A;  3Q9U C;  3LVR E;  3O47 A;  4G8K A;  4B93 B;  5CEA A;  3UI2 A;  4K5C A;  4BET A;  4DX1 A;  2RFA A;  5KBA A;  1SW6 A;  2KBX A;  5AQ9 A;  3C5R A;  3DEO A;  3NOG D;  3V30 A;  1IKN D;  3D9H A;  2L6B A;  3HRA A;  3TWQ A;  3DWD A;  4DRX E;  4LG6 A;  3ZKJ A;  2CRR A;  5AQ7 A;  3JXI A;  4A63 B;  4ATZ D;  3LJU X;  3ZU7 B;  5CER B;  2QC9 A;  2V5Q C;  3ZUV B;  3J5Q B;  2FO1 E;  3Q9N C;  5FIN A;  3W9F A;  1YCS B;  1OT8 A;  4G8L A;  5ENQ D;  2F8Y A;  4RLY A;  4NIK A;  4BEP A;  4HRM B;  2P57 A;  3JUE A;  1IXV A;  5CBO A;  3SO8 A;  2IQJ A;  4U8V D;  3EHR A;  5EYL A;  3TWU A;  3V2X A;  4JB8 P;  2CRW A;  1YYH A;  2A5E A;  2XEH A;  1QYM A;  3F6Q A;  1BU9 A;  1BI7 B;  1WDY A;  4HRL A;  2Y0B G;  3UXG A;  2DZN A;  4LNU D;  4Z68 A;  4OAU C;  1SVX A;  3MDB C;  4QFV A;  1BI8 B;  4O1P A;  3LJN A;  5AQB A;  4HB5 A;  4HRN A;  1WG0 A;  2JAB A;  4U8Y D;  4HI9 A;  5AAR A;  5ITZ F;  4HLL A;  5ENS D;  2F8X K;  2XEE A;  4GPM A;  5HKP A;  1YMP A;  2ZGD A;  1OY3 D;  4O1O A;  3UTM A;  3TWS A;  1AWC B;  4CYM D;  3B95 A;  3TWR A;  1UOH A;  4C48 B;  2ETB A;  2J8S D;  4O60 A;  3V79 K;  1BLX B;  1K1A A;  2F37 A;  3IXE A;  5ENO D;  3AAA C;  4HBD A;  5KNG A;  4LSZ E;  4YDY A;  4DX5 D;  1G3N B;  1S70 B;  3W9G A;  4U96 D;  5KWD A;  1AP7 A;  1MYO A;  3TWW A;  3V2O A;  1MX4 A;  4HI8 A;  5EIL A;  2KXP C;  2B0O E;  2DWZ A;  1K1B A;  2ETA A;  5HRY A;  4U95 D;  1K3Z D;  2DZO A;  5ENT D;  5BXO A;  4OAV B;  4N5Q A;  3B7B A;  2OWA A; 
#chains in the Genus database with same CATH topology
 4BHW A;  4UI9 B;  4ANV A;  2IJG X;  1NA3 A;  4HQD A;  3FUH A;  2E6R A;  1WE9 A;  3ML8 A;  2R5S A;  4WWO A;  2L9B A;  2XS8 A;  3U64 A;  3V31 A;  2Y4T A;  4W4U A;  4YDW A;  4C0M A;  3LEW A;  4KXK B;  2VPG A;  2KC7 A;  2R59 A;  4BX9 A;  5JHB A;  1HG2 A;  4F6R D;  1S63 A;  4RG6 A;  3SHB A;  1E7V A;  2WXR A;  2V4L A;  5AJL A;  3ZTG A;  4CGW A;  2RG8 A;  5FER A;  2IY0 C;  5KJN A;  2P9L G;  2VGE A;  3OXG A;  2KWK A;  3Q9U C;  2KBX A;  1ELW A;  2IOS A;  2MOW A;  4I6G A;  3ZPV E;  1XGW A;  4FHK A;  3ZHE A;  3L16 A;  4I2W A;  4ATZ D;  2V5Q C;  3C6W A;  3W9F A;  2OEW A;  3LKU A;  5AJD A;  3RAU A;  2YQ8 A;  4AVX A;  2HDP A;  2YHC A;  3SO8 A;  4J8S A;  4GMJ A;  2MHK A;  4U8H A;  2VJ8 A;  1BU9 A;  2DIW A;  4B7Y C;  5D1K B;  2LQ6 A;  2KRE A;  3M62 A;  3MDB C;  3E2D A;  4A49 A;  3CV0 A;  2ZU6 B;  3C72 A;  2XP0 A;  2IF4 A;  2K4D A;  3NAW A;  5FJY A;  2QIC A;  3MCX A;  2NSZ A;  3QB2 A;  1QZ2 A;  4Y6C A;  2I50 A;  3Q15 A;  2AXU A;  3EIJ A;  5CCM A;  3HTK C;  4J6I A;  4U07 A;  1EYH A;  3FP3 A;  4M7C A;  4N2S A;  2VJF B;  4GNF A;  3Q1D A;  4GU5 A;  4W9R A;  4BTB A;  1Y8M A;  2YRE A;  5G2N A;  2I1J A;  3QWW A;  4FU3 A;  4P5O B;  4UI9 K;  4IC3 A;  4U63 A;  3S2A A;  2YIN A;  2QFC A;  3IKO B;  2GRN B;  3ZRH A;  4MSX A;  3UIP C;  2BED A;  4I7C A;  1H2T C;  2KCK A;  2WXM A;  5LKT A;  4BFR A;  4N4F A;  3OTN A;  4I6E A;  2BKG A;  1FBV A;  3RSE G;  2DYS E;  3CQG B;  3QAQ A;  5DBK A;  4BWR A;  5BNW A;  1PC2 A;  4WA6 A;  2EOD A;  2XGM A;  3TWX A;  3ABM E;  4G8K A;  3RPG B;  3UI2 A;  2LSU A;  3TXM A;  4BET A;  2JMJ A;  3RO3 A;  5BV1 A;  3UT4 A;  4YAT A;  4LG6 A;  2FUI A;  4F52 B;  3CHR A;  3ULE G;  1NI1 A;  3QJZ A;  4RVB A;  2VJF A;  3SOU A;  2MUM A;  2ECW A;  3FTW A;  5KJL A;  4LK9 A;  2A4Z A;  1HH8 A;  5FB0 A;  3ESL A;  4U7E B;  2FF4 A;  2MIQ A;  1QYM A;  5C13 A;  4Z68 A;  2CSY A;  1FVH A;  3T6R A;  3LJN A;  4HB5 A;  5ITZ F;  3MYV A;  3FTU A;  3D3M A;  4AEZ C;  3N71 A;  1YMP A;  3CHO A;  4TKP B;  2XOC A;  3UIN C;  3FFL A;  3TG5 A;  4DJA A;  3LY7 A;  3U9W A;  3P2B A;  5G0F A;  1OWO A;  2CFU A;  5FQ6 A;  2CON A;  1H0A A;  4AIF A;  2B0O E;  4L9P A;  3X2Q E;  2H6H A;  2OXQ C;  4QF2 A;  4YAB A;  2XCB A;  3QKY A;  1UG3 A;  2E0I A;  3B7T A;  3FU3 A;  1DCQ A;  1MJ0 A;  2KYU A;  4GA2 A;  1O5M A;  5AQA A;  1WEN A;  1TJC A;  3QWP A;  4J8Y A;  4DX6 D;  1S64 A;  2GGF A;  2ILR A;  3CLJ A;  1CHC A;  4A0C D;  4RQI A;  3IHY A;  3U5O A;  4JHK A;  4G26 A;  3D9M A;  1D9S A;  2HYZ A;  5B8D A;  4GCN A;  3UQ3 A;  5AAO A;  3KS2 A;  2ZXW E;  2F42 A;  5FZS A;  4XE0 A;  3AG4 E;  5KBA A;  3KSL A;  3MHH A;  3FU0 A;  1D8D A;  3N9P A;  3HRA A;  1WEE A;  3D9J A;  2OV8 A;  3ZYQ A;  2M3H A;  2NAA A;  3QDN A;  2UZG A;  4LER A;  1JPL A;  4AYC A;  1OWN A;  3ZXP A;  1TN7 A;  1X5B A;  4RLY A;  2V8S E;  5G04 J;  3JUE A;  2LRI C;  4KMO A;  1BI7 B;  1WM5 A;  3HCS A;  3DWL G;  1V55 E;  4DK5 A;  4WWN A;  5A6C A;  3FUF A;  2PM6 A;  2XHE A;  1WG0 A;  3MGB A;  4M3O A;  3G2W A;  3LPZ A;  3PZ1 A;  4RG9 A;  4V3L C;  4JXT A;  1E8Z A;  1UOH A;  2Y4U A;  2J07 A;  1WIL A;  1K1A A;  3IXE A;  5C1D A;  4IC2 A;  4UI9 J;  1U2V G;  1K3Z D;  2VQ2 A;  2Y3A A;  3CVP A;  2XGO A;  4A63 B;  5T8I A;  3Q47 B;  4WND A;  4ANW A;  2YQM A;  3HXD A;  4DLQ A;  3SFX A;  1TNU A;  4LNG A;  2CSZ A;  1N0Q A;  4KYO B;  3DXK G;  4D10 C;  2H0D B;  1HXI A;  1TN8 A;  5EIB E;  3EHN A;  4I6J A;  2KAT A;  3D9N A;  1ZBD B;  4H7Y A;  3U3W A;  5ARF A;  2H6I A;  2YSM A;  4WZ3 B;  2PNN A;  2LAI A;  3ESK A;  3ULY A;  1JCS A;  1H2V C;  5B75 A;  3HXC A;  2PNX A;  4J7W A;  1HE8 A;  1H6K A;  4GND A;  4HOS A;  4EZK A;  3ZNI A;  3LQJ A;  5D2M C;  2KGI A;  2EIM E;  5HS0 A;  3QZV A;  2XCC A;  1WEV A;  3CR3 A;  3C5R A;  1IKN D;  1WGM A;  2VPE A;  3KV6 A;  5EX0 A;  5I3L A;  3ZUV B;  5B78 A;  2EIJ E;  2FO1 E;  2RD0 A;  3U5P A;  3E30 A;  2L5U A;  1D8E A;  1IXV A;  2LDR A;  2IQJ A;  5EYL A;  4DLO A;  3TXN A;  4I1O B;  2P9N G;  4HXI A;  4RSY A;  5D1L B;  3CIA A;  5AEN A;  3KQI A;  4WUY A;  3ASO E;  2LAH A;  1VYX A;  3EHM A;  4ZDT A;  5FTP A;  3DSX A;  3HVE B;  2G45 A;  2F37 A;  3W9G A;  2X6H A;  2EXU A;  3VLF A;  3IEG A;  3HCT A;  2ECT A;  2X6J A;  5BXO A;  4OGE A;  2VGX B;  2I6H A;  2J08 A;  2KZT B;  4GZ6 A;  2FD4 A;  2EGM A;  3SBT B;  3DPL R;  2PUY A;  5H1T A;  5TRB A;  4FJZ A;  1OCC E;  3TG4 A;  5DIN A;  2I9C A;  5CRV A;  5CBN A;  3NBN B;  1EDU A;  3R7R A;  4CDN A;  2IEJ A;  4AY5 A;  4K5A B;  1X4U A;  4JD2 G;  2M63 A;  3SFY A;  1WY6 A;  4GMR A;  4N5C A;  1HF8 A;  2M1R A;  4B93 B;  2YVR A;  2KIZ A;  3HVE A;  5AQ9 A;  1LDJ B;  2XEU A;  1N4S A;  3KV5 A;  3JXI A;  3O7A A;  3LY8 A;  4XI9 A;  4B0Z A;  3UM2 A;  2VGX A;  3RPG C;  3DBS A;  3GL6 A;  4R8P K;  3EHR A;  4I1M A;  3MHS A;  4JEH A;  4GYY A;  4LNU D;  3JYS A;  1N52 A;  3SNX A;  4B86 C;  1L5J A;  4U8Y D;  2X6I A;  3DST A;  4MS6 A;  4XKB A;  3R9M A;  5ENS D;  2XEE A;  2OVB A;  2WVI A;  1OY3 D;  3BG1 B;  4C0E A;  3L08 A;  4TRQ A;  3B95 A;  5KJK A;  4JA7 A;  2Y1M A;  2J8S D;  2P9P G;  5H7P A;  3CHM A;  3AAA C;  5AIT A;  5D0O D;  3E34 A;  4XZ4 A;  1OWM A;  3CST A;  3S7J A;  5TDW A;  1Q2Z A;  3I3N A;  4OAV B;  3D9L A;  3FH5 A;  4F1P A;  5BUZ A;  4N3W A;  2VSO E;  2XEN A;  1FT1 A;  4WNF A;  3NG2 A;  2HE0 A;  4TUM A;  4A3T A;  2NXP A;  2YYR A;  2CKL B;  4B8C B;  3AG2 E;  2VSN A;  2IO2 C;  4HNA D;  4J8E A;  3HXF A;  4NQ0 A;  1HU3 A;  2OCC E;  3LS8 A;  5A23 A;  2KKY A;  1A17 A;  3TJP A;  4EQF A;  3UT8 A;  4KVM A;  5CMW A;  3O70 A;  1UN9 A;  4DI4 A;  2EIK E;  2GRP B;  3RRN B;  2CT2 A;  2EIL E;  2PZI A;  3TAX A;  1G25 A;  2YQL A;  2YHN A;  1WEW A;  4QQI A;  3EHQ A;  5B77 A;  4ACK A;  2L43 A;  4H9D A;  2FI7 A;  4OVU A;  3KAE A;  4U0U A;  3B13 A;  3PEV B;  2AVP A;  1OCO E;  3O47 A;  3URZ A;  2PM7 A;  3N9Q A;  3C3O A;  5JJ6 A;  2CG3 A;  2K1J A;  1TN6 A;  1UN8 A;  2GRL A;  2FEZ A;  1MQS A;  4YVQ C;  4EPZ A;  1YCS B;  2WXI A;  2GRQ B;  5FEY A;  2MA5 A;  3LRQ A;  1U6G B;  1U3D A;  3TWU A;  3N9N A;  2YHE A;  3CGH A;  1U3C A;  1YYH A;  3ASN E;  3F6Q A;  4NN2 A;  2KU3 A;  3G2V A;  2CKL A;  1OCR E;  2WMO A;  4AV7 A;  4O1P A;  5T4Y A;  1JOC A;  4HOR A;  1IYM A;  3ZPJ A;  3ZFW A;  1TYQ G;  4B94 A;  3PVL A;  4BX8 A;  3CVY A;  3UTM A;  2D8U A;  5FQ8 A;  2ETB A;  2P9I G;  5KNG A;  3HIZ A;  1LD8 A;  4GZD A;  3D9P A;  3O33 A;  2FO7 A;  3V2O A;  1NZN A;  3IHV A;  2NYJ A;  3QWV A;  3ONK A;  5LP0 A;  4I43 A;  3PHD A;  3S7F A;  4Q96 A;  4TXQ A;  3LDY A;  3ZYK A;  4G1T A;  2A5U A;  4KT6 B;  5D1M B;  3Q75 A;  1WEQ A;  3M7K A;  3AJI A;  4CDR A;  4A1S A;  1O1T A;  3DEP A;  4FA6 A;  5M72 A;  4PPE A;  4YND A;  2GRO B;  3NB2 A;  4HOQ A;  2X3M A;  2J4B A;  5CRU A;  3I4R B;  1O1R A;  4CEM A;  3DPD A;  2WXJ A;  1WEM A;  3UPV A;  1IHB A;  4ANX A;  1XNF A;  3B7R L;  3U5N A;  2EQX A;  5G05 B;  2RFM A;  1KT0 A;  1JCQ A;  1LTX A;  5J3X A;  1FCH A;  2IU1 A;  4AY6 A;  2VP7 A;  3FY4 A;  3RJV A;  1Z60 A;  4X3G A;  1E8W A;  4N3B A;  1QQE A;  3U66 A;  3L11 A;  4L7X A;  3P1U A;  3DSS A;  5B3S E;  3ZEF A;  2E6S A;  3CVQ A;  2CFZ A;  4OVV A;  2XEH A;  3O48 A;  4UQX A;  3UXG A;  1V54 E;  3FAN A;  3MEK A;  3PUK A;  3CVW A;  4HRN A;  2VPB A;  2X6K A;  3B7S A;  2AXZ A;  4G2V A;  2IQC A;  2IDA A;  3L13 A;  4HBD A;  4LUN U;  4LLB A;  3ASL A;  4XI1 A;  3L1Z B;  4HI8 A;  3FUI A;  2C0L A;  4U95 D;  1NA0 A;  5ENT D;  4HFG A;  1JWF A;  3HDX A;  1W3B A;  1BPO A;  1TNO A;  5AIJ A;  2V4H C;  3NZS A;  4BER A;  4FIP A;  4PUC A;  1OWP A;  2LXM A;  4BY6 A;  4AJW A;  4F1S A;  5CED B;  3MX3 A;  4A3V A;  3SOX A;  1TR4 A;  5JMN D;  2K17 A;  3PNL B;  4CZ2 D;  2ECN A;  2LGV A;  4UP5 A;  2OEV A;  5EN5 D;  4XX5 A;  3CVX A;  3GV4 A;  2YNQ A;  5AN8 A;  3FM8 C;  3OAW A;  3CHS A;  3KEA A;  2YW8 A;  5CHE E;  2BKK B;  3T8K A;  4AYC B;  3NF1 A;  4GAA A;  2K16 A;  3ASD A;  3SQV A;  5KNH D;  4V3K C;  3Q49 B;  3GZ1 A;  1Z3Y A;  3E4B A;  4BES A;  1WEO A;  3EU9 A;  1Z6U A;  2P9K G;  3Q79 A;  3ASG A;  4XEI G;  3AU5 A;  2HYE D;  2YHO A;  4BEP A;  1MM2 A;  2L75 A;  5FWQ A;  4GZ3 A;  3MZL B;  2YUR A;  4J0U A;  1DCE A;  2VJE B;  2VYI A;  2VPD A;  3N9L A;  4B8A A;  4GTO A;  4S3O C;  4FLH A;  2QJ0 A;  5LKU A;  2BF0 X;  4L2L A;  4GA0 A;  4CGV A;  5HKP A;  5FT9 A;  2ZET C;  4J8F A;  2G43 A;  4C9Z A;  3JQ1 A;  1HO8 A;  2C0M A;  3AS4 A;  4QQ4 A;  1RZ4 A;  5CCL A;  4LSZ E;  4YDY A;  1TNB A;  4DX5 D;  2J09 A;  3AU4 A;  3FUD A;  3EIQ C;  3O4Z A;  5K3Q A;  4L7T A;  2YSJ A;  2JUN A;  2LXL A;  2JEK A;  1FPP A;  2L6J A;  2M6M A;  2F0Y A;  2VGY A;  4GYW A;  2MRI A;  5ANR A;  2YUC A;  4EEC A;  3FUK A;  2VSX E;  4LNB A;  3DSW A;  1O1S A;  3ZYL A;  3SUB A;  1N11 A;  3CVL A;  2FSA A;  1ZB1 A;  5EYA F;  4AP2 A;  2VJE A;  3ABK E;  3ZPV 1;  5EX3 A;  5CEC B;  3FU5 A;  3TWV A;  1N0R A;  1B89 A;  3FTV A;  2XZT G;  5SVI B;  4XKC A;  3DXM G;  3PUJ A;  4LAD B;  3JXJ A;  1ELK A;  1LD7 A;  3LVQ E;  5BPP A;  1N9A A;  2XOY A;  3QAR A;  2KKX A;  1S0P A;  4CCA A;  3SD5 A;  3LJU X;  4G11 A;  3V43 A;  4LJN A;  2RKK A;  4KZC A;  1RW2 A;  3RRU A;  3O36 A;  3Q5M A;  4MBG A;  3UT7 A;  3SOW A;  1Y6I A;  4U8V D;  3CEQ A;  2F6N A;  1IYG A;  5FQ4 A;  5HQ8 A;  1TNY A;  4GTT A;  3UM0 A;  3L9T A;  4GTM A;  4J8D A;  3D9O A;  3D9I A;  4WWP A;  1N4Q A;  2XPZ A;  3ZW3 A;  5DKA A;  1KPS B;  2UWJ G;  1IQU A;  4Q94 A;  2R17 C;  3BU8 A;  4GPK A;  3UM3 A;  4ILG A;  4C48 B;  3APD A;  3L1X A;  2KM4 A;  4O60 A;  1T1H A;  1JUQ A;  1G3N B;  2KR4 A;  4MVT A;  3RRM B;  2KXP C;  2XPY A;  5SVI A;  3ZGQ A;  4L2Y A;  3BEE A;  3N9O A;  3CVN A;  2DJA A;  3UKR G;  3KSQ A;  1MX6 A;  5SVX A;  5KCM A;  4AOF A;  4R2Y A;  5SVY A;  3T8M A;  2CHX A;  3VK6 A;  5E75 A;  3IBE A;  3EJN A;  2XPI A;  2WMN A;  3S7D A;  4K0R A;  4JZY A;  2MYO A;  4HOT A;  3L22 A;  3UMV A;  2DVW A;  1H6P A;  3SBS A;  3CK7 A;  3UIO C;  4N3C A;  2KWJ A;  4URK A;  4AM9 A;  5D0Q D;  1Z2Q A;  5B76 A;  1Z6T A;  4GCO A;  5B79 A;  4ATG A;  2L7P A;  3I2D A;  2AJA A;  3HYM B;  3LXU X;  3FDH A;  5FB1 A;  3Q7F A;  3FUM A;  3ISM C;  3RK6 A;  2BAY A;  4EBA A;  3ZYM A;  3E32 A;  4JHJ A;  3ENE A;  2PL2 A;  3L54 A;  3VTX A;  3RO2 A;  4I9C A;  2JMI A;  2MD7 B;  3DWD A;  4EHM A;  3ABL E;  5AQ7 A;  4F53 A;  5C2Y A;  4FC8 A;  5G05 C;  1X81 A;  2CSV A;  2LSV A;  4BT9 A;  1INZ A;  1F62 A;  2EGP A;  1FVF A;  4H7X A;  4GYO A;  3Q73 A;  4GZ5 A;  1ZBP A;  2ECI A;  4FLB A;  2DSM A;  3GZ2 A;  3Q78 A;  2A5E A;  4JL0 A;  2CG2 A;  2B6C A;  3PNT B;  3LDZ A;  4UQZ A;  4YDE A;  3N9M A;  1SVX A;  3ASH A;  2KFT A;  3MJW A;  5AAR A;  3BQO A;  2F8X K;  3OXL A;  2ZGD A;  2VNF A;  1IHG A;  3ONL A;  4HS2 A;  1AWC B;  4S3O B;  4CYM D;  1N54 A;  3GW4 A;  3V79 K;  5ENO D;  4FAD A;  1N94 A;  3G2U A;  3TWW A;  4F3V A;  3PE3 A;  2MD8 C;  2DWZ A;  5HRY A;  4ZUX U;  2DZO A;  4UWG A;  4N5Q A;  2OWA A;  1NL4 A;  3FEH A;  3SI5 A;  3HG0 D;  3HXE A;  2R03 A;  3E33 A;  4YBS A;  4GA1 A;  2XRZ A;  3CVU A;  3PEU B;  2LGL A;  4A55 A;  4E6H A;  1FT2 A;  3CK8 A;  4UP0 A;  2WXH A;  1SZA A;  3I4G A;  1E4U A;  4Q69 A;  4WNG A;  3PDN A;  4CT4 A;  1FP0 A;  4UWF A;  3PH0 C;  3CK9 A;  5CMY A;  4LKA A;  4JVS A;  2QYJ A;  2WQ6 A;  4WNE A;  3NOC D;  4GTR A;  4MRU A;  4JEU A;  2ZGG A;  2H6G A;  4XI0 A;  4IRU A;  3ZVY A;  3JUI A;  3FEX A;  3R7Q A;  5B1B E;  4A1G A;  4GTP A;  4FP7 A;  2ZIS A;  1SW6 A;  1N4R A;  3FEY A;  1ZU2 A;  2CRR A;  2QIZ A;  2WPV A;  3UUX A;  2QC9 A;  3QK0 A;  2ECJ A;  2RSD A;  3UX4 A;  2F8Y A;  2DX8 A;  4A4B A;  2E61 A;  2JRJ A;  3JCK C;  2HM8 A;  3DSV A;  1VDY A;  3O35 A;  3CVV A;  3FHE A;  3QNK A;  5ANL A;  2DZN A;  4P29 A;  4QFV A;  3TL5 A;  1K2F A;  4GB0 A;  2KCL A;  4O64 A;  4GB9 A;  4GPM A;  1N87 A;  1QNF A;  5C11 A;  1HG5 A;  1NP7 A;  1UJJ A;  3PRZ A;  1JCR A;  1BLX B;  1VFY A;  2HR2 A;  1MHQ A;  4U96 D;  4GNG A;  1IQR A;  4WAF A;  2RI7 A;  1MX4 A;  5EIL A;  1E96 B;  2JLB A;  3PRE A;  4MLP A;  1NFI E;  2ETC A;  3FL2 A;  2AWI A;  3O37 A;  2MT5 A;  1HYI A;  2GRM A;  4NRH B;  4YVO A;  4E85 A;  3J5P A;  3MKR A;  3Q7A A;  1QBQ A;  5JA4 D;  2X38 A;  4G25 A;  5DIZ A;  2DYR E;  4BBQ A;  1N4P A;  5IY5 E;  1UW4 B;  3R9A B;  3PZD A;  2Q7F A;  1RMD A;  4DX7 D;  5HI7 A;  4FUL A;  4ZHB A;  4FHJ A;  3PUR A;  2FUU A;  1OUV A;  4EZJ A;  2WXF A;  4PS3 A;  1TNZ A;  3QC1 A;  1DNP A;  3UKU G;  4K5B A;  3KD7 A;  4DUI A;  4TV3 A;  4YC9 A;  3HCU A;  4B89 A;  4UWL A;  3PZ4 A;  3GZS A;  3T5X A;  5CER B;  3RKV A;  4TUU A;  3APF A;  3J5Q B;  5LKZ A;  3DRA A;  4N2Q A;  3SF4 A;  4NIK A;  1KZO A;  2J49 A;  1PY1 A;  5AYW D;  2CRW A;  1SA4 A;  3NZU A;  4PS8 A;  3AG3 E;  3FTS A;  2Y0B G;  4WZ2 A;  1SA5 A;  2P9S G;  2WXO A;  2WXQ A;  4YAD A;  4YAX A;  3PUQ A;  4HI9 A;  1JM7 B;  1KZP A;  4HLL A;  3TWS A;  4OYS A;  4V3I A;  3VLD A;  3M63 A;  2VSY A;  2I1K A;  2E2E A;  3CHQ A;  1HFA A;  4F7A A;  1MYO A;  4G24 A;  2WXL A;  2V5F A;  1K1B A;  3TGO A;  3C5K A;  3L6A A;  4NUR A;  4I2Z A;  1WIM A;  3FH8 A;  3T7L A;  3E37 A;  4QF3 A;  4PTB A;  4EZL A;  2KGG A;  2YU4 A;  4KVO A;  5BXU A;  3L17 A;  1SQM A;  3ULQ A;  5ENR D;  5TBN A;  2MA6 A;  3CQC B;  1MX2 A;  2WQH A;  3M99 A;  4BT8 A;  3WXX A;  4U0S A;  1EF1 C;  4IYP A;  4UUC A;  2GW1 A;  2LNI A;  5H1V A;  4BSX A;  2L0B A;  5EYP F;  4Q6F A;  2L80 A;  2MKE A;  3ZVZ B;  4ZFH A;  3LY9 A;  4YBM A;  4XIF A;  1HX8 A;  2XEV A;  4BSZ B;  4EBA G;  4KZ0 A;  2QZA A;  2QYU A;  3T9K A;  1JM7 A;  3ZNG A;  3CKC A;  5BV0 A;  4N3A A;  1WES A;  5J08 A;  3FWV A;  2RFA A;  3AG1 E;  3DEO A;  3NOG D;  1E7U A;  4JHR A;  4OGC A;  3IHP A;  4ME2 A;  4O6F A;  3JQ0 A;  4CT0 A;  3OXF A;  2XQ0 A;  2DBA A;  3Q9N C;  2Y43 A;  4UWH A;  1OWL A;  2XS1 A;  5LCW B;  4GNE A;  2V0P A;  2P57 A;  2CHZ A;  4L1B A;  1N95 A;  4L58 A;  5LX8 A;  4A4C A;  2XRY A;  2AN6 A;  2ECG A;  4CRW A;  1MM3 A;  2XGS A;  1WDY A;  2J9Q A;  5H1U A;  3KDE C;  2LAU A;  1BI8 B;  1K8K G;  5AQB A;  2PQR A;  2X6F A;  4U0Z A;  4LRZ A;  4O1O A;  4UWK A;  3TWR A;  5JHA A;  1WEP A;  4ANU A;  2KWO A;  2R2L A;  2ZIR A;  4U04 A;  2LUH A;  5G55 A;  4ZQL A;  3PS6 A;  1YA0 A;  1UJK A;  1BOR A;  3L82 A;  5B1A E;  4FJC A;  4WZ0 A;  2ECV A;  2XB1 A;  5TDR A;  2P2C P;  4DPR A;  3ML9 A;  2AW6 A;  4ILH B;  1XWH A;  5LFA A;  5KH3 A;  1MBM A;  5JJ7 A;  3SY2 A;  4DX2 A;  3FUJ A;  2P9U G;  4I9E A;  1A5E A;  1DC2 A;  2WQ7 A;  4Z0R A;  1WFK A;  3C3R A;  4IN3 B;  3SFZ A;  3CSF A;  4Y6W A;  2MNZ A;  4JPS A;  4TXP A;  4AUQ B;  1HYJ A;  4YBT A;  1SZ9 A;  3HXB A;  4GML A;  4HOU A;  3APC A;  4DI3 A;  1H19 A;  2C2V S;  4DX1 A;  5TAB A;  3FJU B;  3D9H A;  2L6B A;  1ELR A;  1TEZ A;  5EDS A;  4DRX E;  3MV2 B;  4AXH A;  3G2T A;  4LCT A;  3BG0 B;  3ZN3 A;  5LOZ A;  3PE4 A;  3HHM A;  5BT1 A;  2KWN A;  4R7E A;  3PLW A;  5ENQ D;  3MV3 B;  3FAO A;  2BTD A;  2WXG A;  2NC9 A;  2OND A;  4CDM A;  2I2O A;  3LJ3 A;  3RU0 A;  5ARG A;  5G04 C;  3RTR B;  2JM3 A;  3KEZ A;  4X8Q A;  5EKQ D;  3WG7 E;  1E8X A;  2LO6 A;  3FUL A;  4C9B B;  4MKT A;  5FZQ A;  3SHF A;  3DSU A;  3SGH A;  4HVB A;  3EU5 A;  2L0T B;  1Z5S C;  5KJM A;  2M13 A;  4GTQ A;  4I7B A;  3MKQ B;  1GW6 A;  4FJY A;  5FZR A;  2OOE A;  4TXR A;  2C2L A;  1S70 B;  1AP7 A;  3C3Q A;  2P58 C;  3ZIM A;  4PS7 A;  4UI9 C;  3DPY A;  5LKX A;  2ETA A;  1OCZ E;  3H7H A;  2Y69 E;  5D66 A;  1WEU A;  3DQV R;  3PZ2 A;  1BD8 A;  2J4D A;  3S7B A;  2LN0 A;  2Y1N A;  4R7L A;  4APO A;  3LCA A;  5BW8 C;  4YDO A;  2BUG A;  1OXJ A;  3B7U X;  5FIO A;  4GZC A;  4NAC A;  4N39 A;  4GTS A;  2FBN A;  2WM9 A;  3K9I A;  3BUA A;  2LGG A;  2IFU A;  3QOU A;  5T3R A;  5ENN A;  4BTA A;  5J90 A;  3T5V A;  2G6Q A;  3KNV A;  2PQN A;  3MKQ A;  2LV9 A;  2H0D A;  2WB2 A;  2YT5 A;  4I1A A;  3FTY A;  2RR4 A;  3MA5 A;  2WXK A;  3EB5 A;  4LEU A;  5JJT A;  3EDT B;  3I5P A;  3TWQ A;  2WXP A;  5G05 J;  2CHW A;  4PDX A;  1TJF A;  3SZ7 A;  2AXV A;  3G2S A;  5H9M A;  4I17 A;  4GTV A;  2UY1 B;  4G8L A;  2IO3 C;  3O34 A;  3EB6 A;  5CBO A;  1H2U A;  2EA6 A;  2WXN A;  3GYZ A;  1JWG A;  4ABN A;  1HS6 A;  4FO9 A;  4OAU C;  4Z0O A;  3DDT A;  2MNY A;  3ZXS A;  4ACL A;  2D8S A;  2LXP C;  2FUL A;  2R02 A;  1LF8 A;  1H6O A;  1KLX A;  3RIB A;  4IUL A;  3FTX A;  3U4T A;  4FK5 A;  5KWD A;  3VTY A;  3IV0 A;  3D9K A;  1PAQ A;  3FTZ A;  1V87 A;  2OVF A;  3UM1 A;  2EIN E;  3ASF A;  3B7B A;  5KH9 A;  3TWT A;  2HO1 A;  2F6J A;  5JG6 A;  2VTB B;  3FUE A;  1KT1 A;  4JA9 A;  5ENP D;  2JMD A;  4JC8 A;  2XZD G;  3FH7 A;  3LYA A;  2DCP A;  2UY1 A;  1WAO 1;  3ZVV A;  4CCG X;  4KBQ A;  2GRR B;  3Q4A B;  2Y1L E;  4UQY A;  3NQP A;  5A7D B;  3C98 A;  5EID A;  2KZT A;  3FUN A;  2KE1 A;  2XOZ A;  1LDK C;  4O62 A;  1DVP A;  4I7D A;  1HZ4 A;  4APF A;  3LVR E;  3PZ3 A;  5CEA A;  4K5C A;  4JW1 A;  3V30 A;  1X4J A;  3AS8 A;  3ZKJ A;  5LCW J;  2LXH C;  3LQH A;  5E76 A;  2IOL A;  5KH7 A;  1E8Y A;  3ZU7 B;  1VD4 A;  4PH4 B;  2QY7 A;  5FQ7 A;  3U5M A;  5FIN A;  1OT8 A;  4HLE A;  2R05 A;  2ION A;  1EPU A;  4HRM B;  1P5Q A;  4L23 A;  2KCV A;  4K03 A;  3FU6 A;  2VTB A;  2LGK A;  3V2X A;  4JB8 P;  3AS5 A;  2FFW A;  3CKB A;  4HRL A;  3EUV A;  5G04 B;  2M85 A;  4ILI A;  4G23 A;  2JAB A;  5AIU A;  1E90 A;  1X4I A;  5LCW C;  2H6F A;  3LQI A;  4CA1 A;  3VLE A;  3CHP A;  1MZC A;  3ZHE B;  4AP4 A;  2L0I A;  1Z3X A; 
#chains in the Genus database with same CATH homology
 5D66 A;  3FEH A;  1MX6 A;  3HG0 D;  1NFI E;  2ETC A;  2V4H C;  4F1P A;  4HQD A;  3TWT A;  2YRE A;  5SVX A;  1BD8 A;  5SVY A;  1N0Q A;  4BER A;  2XEN A;  1DCQ A;  1MJ0 A;  3LDY A;  2P2C P;  5ENP D;  5BXU A;  5CED B;  2FD4 A;  3J5P A;  2EGM A;  5ENR D;  2XZD G;  5AQA A;  1TR4 A;  5JMN D;  2NYJ A;  4CZ2 D;  1MX2 A;  2HE0 A;  2MYO A;  4TUM A;  5FIO A;  4J8Y A;  4DX6 D;  5JA4 D;  3M7K A;  5EIB E;  2DVW A;  3AJI A;  5EN5 D;  3V31 A;  3SUB A;  1N11 A;  4UUC A;  4YDW A;  4HNA D;  5AN8 A;  3DEP A;  5CBN A;  3KEA A;  4DX2 A;  3NBN B;  3FM8 C;  5EYP F;  2KKY A;  2BKK B;  1A5E A;  1DC2 A;  2PNN A;  3T8K A;  2MKE A;  4ZFH A;  4K5A B;  2Y1L E;  4Z0R A;  4F6R D;  2QYJ A;  4DX7 D;  1D9S A;  2BKG A;  4ZHB A;  5CEC B;  4QQI A;  3EHQ A;  2L7P A;  2AJA A;  5KNH D;  3TWV A;  1IHB A;  4BSZ B;  3NOC D;  4J7W A;  4H9D A;  5AAO A;  4GMR A;  1N0R A;  3T9K A;  2VGE A;  2XZT G;  3ZNG A;  2RFM A;  5EID A;  5SVI B;  2ZGG A;  2XOZ A;  4O62 A;  3JXJ A;  4K5B A;  3TWX A;  3LVQ E;  4DUI A;  4BES A;  5HS0 A;  3EU9 A;  3Q9U C;  3LVR E;  3O47 A;  4G8K A;  4B93 B;  2YVR A;  5CEA A;  3UI2 A;  4K5C A;  2RR4 A;  4BET A;  4DX1 A;  2RFA A;  5KBA A;  1SW6 A;  2XOY A;  2KBX A;  5AQ9 A;  2KKX A;  3C5R A;  3DEO A;  3NOG D;  3V30 A;  1IKN D;  3FJU B;  3D9H A;  2L6B A;  3HRA A;  3TWQ A;  3DWD A;  4DRX E;  4LG6 A;  4OGC A;  3ZKJ A;  2CRR A;  5AQ7 A;  3JXI A;  4A63 B;  2CSV A;  4ATZ D;  3LJU X;  3ZU7 B;  5CER B;  2QC9 A;  2V5Q C;  3ZUV B;  3J5Q B;  2FO1 E;  3Q9N C;  5FIN A;  3W9F A;  3PLW A;  1YCS B;  1OT8 A;  4G8L A;  5ENQ D;  2F8Y A;  4RLY A;  4NIK A;  4BEP A;  4HRM B;  2P57 A;  3JUE A;  1IXV A;  5CBO A;  2E61 A;  3SO8 A;  2IQJ A;  4U8V D;  3EHR A;  5EYL A;  2JM3 A;  3TWU A;  3V2X A;  4JB8 P;  2CRW A;  2JUN A;  1YYH A;  2A5E A;  2XEH A;  1QYM A;  3F6Q A;  1BU9 A;  1BI7 B;  2FFW A;  1WDY A;  4HRL A;  2Y0B G;  3UXG A;  2DZN A;  4LNU D;  4Z68 A;  4OAU C;  4Z0O A;  1SVX A;  3KDE C;  2LAU A;  4QFV A;  3E2D A;  3MDB C;  3DDT A;  1BI8 B;  4O1P A;  3LJN A;  5AQB A;  4HB5 A;  4HRN A;  1WG0 A;  2JAB A;  4U8Y D;  4HI9 A;  5AAR A;  5ITZ F;  2XP0 A;  4HLL A;  5ENS D;  2F8X K;  2XEE A;  4GPM A;  5HKP A;  1YMP A;  2M13 A;  2ZGD A;  1OY3 D;  4O1O A;  3UTM A;  2XOC A;  3TWS A;  1AWC B;  2D8U A;  4CYM D;  3B95 A;  3TWR A;  1UOH A;  4C48 B;  2ETB A;  2J8S D;  4O60 A;  3V79 K;  1BLX B;  1K1A A;  2F37 A;  3IXE A;  5ENO D;  3AAA C;  4HBD A;  5KNG A;  4QQ4 A;  4LSZ E;  4YDY A;  4DX5 D;  1G3N B;  1S70 B;  3W9G A;  4U96 D;  5KWD A;  1AP7 A;  1MYO A;  2EXU A;  3TWW A;  3V2O A;  1MX4 A;  4HI8 A;  5EIL A;  2CON A;  2KXP C;  2B0O E;  2DWZ A;  5K3Q A;  1K1B A;  2ETA A;  5HRY A;  5SVI A;  4U95 D;  1K3Z D;  2DZO A;  5ENT D;  5BXO A;  4OAV B;  2DJA A;  4N5Q A;  3B7B A;  3H7H A;  4OGE A;  2OWA A;  3Q1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...