2B0OE

Crystal structure of uplc1 gap domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
264
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UPLC1
publication title Structural analysis of GAP and ankyrin domains of UPLC1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 82
structure length 264
sequence length 265
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2b0oE02
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2b0oE01
1N0RA 4QQIA 4LNUD 5KNHD 4U96D 3FEHA 3LVQE 4BESA 4O1PA 2VGEA 5ENSD 1MYOA 1BD8A 4ZHBA 1IKND 1S70B 5CECB 3TWVA 2XZTG 3ZKJA 3EHQA 4LSZE 4G8LA 3C5RA 5AARA 3DEPA 3J5PA 2DZOA 1OY3D 4HI8A 2KXPC 2NYJA 2KBXA 3EU9A 4BETA 3DEOA 3LVRE 3J5QB 4HRMB 4HB5A 5ENOD 2J8SD 5AQAA 3AJIA 3UI2A 1K1BA 5ENRD 1D9SA 4OAUC 4HNAD 5CBNA 4F1PA 3JUEA 4O1OA 1MJ0A 3TWWA 5EYPF 3LJNA 4GPMA 4U8YD 5JMND 4DUIA 1N11A 2XENA 4JB8P 1OT8A 1BLXB 4A63B 2DVWA 1BI8B 2V5QC 3NBNB 4YDYA 1MX4A 4K5CA 5ITZF 4J8YA 5CEDB 2P2CP 4NIKA 2ETBA 4BSZB 3JXIA 5JA4D 3NOGD 5CERB 3FM8C 5EIBE 2JABA 2OWAA 4DX1A 2A5EA 1AP7A 2XEEA 1DCQA 2DZNA 1YCSB 1MX2A 2QC9A 2FO1E 2Y1LE 4C48B 2CRWA 4O60A 3TWUA 3ZNGA 5AQ7A 5ENQD 5BXUA 2RFAA 4RLYA 3D9HA 2F37A 2ZGGA 2V4HC 3HG0D 4N5QA 2ETAA 3TWRA 4ATZD 5AAOA 3AAAC 1BU9A 3MDBC 3JXJA 4HLLA 4BERA 4ZFHA 3V79K 3SUBA 4BEPA 3W9FA 1WDYA 4TUMA 3UXGA 5CBOA 2PNNA 5EILA 1G3NB 2BKGA 3B95A 3V30A 1K1AA 3TWSA 3V2XA 5HS0A 1WG0A 1SW6A 1K3ZD 1A5EA 4K5AB 4OAVB 1TR4A 3KEAA 2P57A 3TWTA 2AJAA 2HE0A 5EN5D 3B7BA 5AQBA 3TWQA 3NOCD 3ZUVB 3O47A 4UUCA 4QFVA 1N0QA 5KNGA 2L6BA 1YMPA 1NFIE 2F8YA 1IXVA 1YYHA 3ZU7B 5ENTD 4CZ2D 2BKKB 3IXEA 1DC2A 4J7WA 2RFMA 4GMRA 3Q9NC 4HRNA 2B0OE 4HQDA 4YDWA 3V2OA 2Y0BG 4K5BA 4LG6A 5AN8A 5AQ9A 5HRYA 4DX7D 5KWDA 2F8XK 1SVXA 2ETCA 5HKPA 4U8VD 4DX5D 3T9KA 5FIOA 4F6RD 5BXOA 5ENPD 4U95D 1IHBA 4B93B 3Q9UC 1UOHA 4G8KA 2XEHA 3SO8A 4HRLA 2IQJA 3UTMA 3TWXA 3T8KA 4Z68A 2QYJA 5EYLA 1AWCB 3V31A 2ZGDA 4DX2A 4DX6D 3W9GA 4HBDA 4CYMD 5FINA 2CRRA 2XZDG 3HRAA 1MX6A 1QYMA 5CEAA 3DWDA 3LJUX 5EIDA 5D66A 4DRXE 3EHRA 1BI7B 4HI9A 2MYOA 3F6QA 5KBAA 2DWZA
chains in the Genus database with same CATH superfamily
4QQIA 2RR4A 3SHBA 3ZKJA 4MBGA 4CRWA 5AARA 3DSWA 2M3HA 3Q79A 5EX3A 4EZKA 4HB5A 5G05J 3UI2A 4M7CA 5CBNA 4C9ZA 3DXKG 4O1OA 3IBEA 3TWWA 3ZHEB 1O1RA 3UKUG 3I2DA 3O35A 2WXQA 2I1JA 3CEQA 4FULA 3FANA 2JLBA 4IN3B 2WMOA 3HHMA 4J8YA 5C1DA 2X6FA 4I9CA 2XEUA 2K4DA 4N3WA 1Z5SC 2YHCA 2BAYA 3U5OA 2Y1LE 2VTBB 4O60A 3TWUA 1IHGA 3D9KA 4WZ0A 3V79K 2NAAA 4PTBA 2EGPA 2R5SA 4UWGA 4WZ2A 1EF1C 4HOQA 1E8XA 4JHRA 5A7DB 3CVPA 3B7UX 4FC8A 5KH9A 2J08A 3ONLA 4NRHB 1WY6A 2IFUA 5AJDA 4I2WA 2DBAA 4U8VD 3O70A 2AXUA 4F6RD 3CVNA 1NP7A 1IHBA 4G8KA 2M13A 3ASNE 5LCWC 3TWXA 2QYJA 3VTXA 3ZRHA 1ELRA 3TXMA 3O48A 4DRXE 4M3OA 3S7DA 4ZQLA 4C0MA 1IQUA 5KBAA 4IULA 3NB2A 2VSXE 5SVIB 1OCOE 1WFKA 2V0PA 4CCGX 2C2VS 4KZCA 4A0CD 2H6HA 3M63A 3O33A 2L43A 3EU9A 5BW8C 3BUAA 4F1PA 3LKUA 4UQYA 1PC2A 4UP0A 4LKAA 4U8YD 3QK0A 4JC8A 3FULA 1H19A 1VDYA 4UWKA 1H2UA 3DSSA 1CHCA 3NQPA 4TXRA 4B8AA 3JYSA 3LQJA 3L1XA 2XRYA 4IYPA 5ENQD 3O7AA 3C3RA 4GA2A 5BV0A 1JM7A 4GZCA 4PH4B 3GZ1A 4R8PK 3FU5A 4A1GA 4J0UA 5EILA 2D8SA 1G3NB 2BKGA 3EU5A 3N9OA 4AY5A 2P9LG 3P2BA 4PUCA 3FUMA 3APFA 5HS0A 1SW6A 3MGBA 1V87A 3AS8A 3L17A 4V3KC 3O47A 4FHKA 1E7VA 4YDEA 4NURA 4YVQC 1DC2A 4B86C 2VPEA 4R7EA 5G2NA 4HQDA 2ZXWE 2PNXA 2G43A 1UN8A 2KU3A 2WPVA 1HFAA 5FTPA 3DWLG 5BT1A 3AU4A 3FL2A 5FEYA 4FO9A 4AOFA 3S7BA 4JL0A 3C6WA 1JWGA 5J90A 3G2SA 3RRNB 2XCCA 1LDJB 3H7HA 3FTVA 4U96D 1E7UA 3I5PA 3LQIA 1IKND 2WXMA 1JPLA 4A1SA 3M99A 1WEPA 4BSXA 3BG0B 1OY3D 3N9LA 2NYJA 2KBXA 2XS8A 4K03A 3J5QB 4J8SA 2ONDA 3JQ1A 1D8EA 3HTKC 3UM3A 3LY7A 3B13A 1MJ0A 1L5JA 4DUIA 1UJJA 4JB8P 4XIFA 3KSLA 2DVWA 1BI8B 4I6EA 3ZVVA 5T3RA 4O6FA 4K5CA 1JCSA 4FJYA 4PS3A 3ABME 1NA3A 3D9PA 5JA4D 2XGSA 3FUIA 3ZYLA 4XI1A 2X3MA 3E32A 2WXIA 2ZIRA 2L0BA 5FQ4A 5T4YA 2V4HC 4O62A 3FUDA 4BHWA 3W9FA 4TUMA 3ASLA 1KT0A 2JMJA 2JMIA 3AS4A 3TWSA 4LCTA 1K3ZD 4YATA 4URKA 2MA6A 4G2VA 1UN9A 5TDWA 4Q96A 2FUIA 3PVLA 2UZGA 1HE8A 2KIZA 3LDZA 3HXEA 3C72A 4BBQA 1MQSA 4L2YA 4PPEA 3ZYQA 1HG5A 3UQ3A 3SHFA 3N9MA 3HVEB 3ULYA 2XGMA 1JOCA 4YBMA 3U5MA 2IDAA 3RIBA 3T8KA 3D9NA 3UX4A 4LADB 2XS1A 3DPYA 4XI0A 2P9UG 4BFRA 1FT1A 4O64A 2DWZA 4UI9C 4ME2A 3GW4A 4O1PA 3P1UA 2AWIA 3C5RA 4GZ5A 2KXPC 5LCWB 2KC7A 4A3TA 3LY8A 2J8SD 1MM3A 3L1ZB 1W3BA 5ENRD 3G2WA 3DQVR 4XEIG 4A4CA 3UUXA 3PREA 1FCHA 4GPMA 4A49A 2LAIA 2Y43A 3TG5A 3QZVA 3CHRA 1EPUA 3O34A 4UI9K 5CEDB 2I1KA 3B7TA 3KV5A 4GTQA 4EBAG 3E4BA 3GZSA 2L6JA 4I2ZA 5LOZA 1HU3A 2HYZA 4A3VA 2XQ0A 5CMWA 2Y1MA 4EZJA 3SOWA 3IHPA 3B95A 3HCTA 2IJGX 2J9QA 1TR4A 4JVSA 5AIUA 3IHYA 5KJKA 3GV4A 3MCXA 1N0QA 3SOXA 3RK6A 3UT7A 1IXVA 3U66A 3RAUA 3PDNA 3WXXA 3Q7FA 2KWJA 2KREA 2CG2A 2F42A 3NZUA 3V2OA 4HOUA 5C11A 2YHEA 2YQLA 3ULQA 4OVUA 2HM8A 3VLEA 4GA1A 4KXKB 1E8ZA 2Y4UA 5BV1A 3V31A 3MEKA 5H7PA 3W9GA 4CCAA 2XZDG 4FP7A 3HRAA 1MX6A 3S7JA 2YUCA 1HX8A 3RPGC 1PY1A 3EHRA 3FU6A 2XOYA 3TL5A 2JM3A 1KPSB 4HOSA 4OVVA 2GRMA 2WXJA 4PS7A 2KCVA 5ENSD 2E6RA 1BD8A 5CECB 3FTXA 1ELWA 4BETA 3QDNA 3FU3A 3DEOA 3CVYA 3JUIA 2FI7A 1H6OA 4YNDA 1D9SA 3QJZA 2CSZA 2VPGA 1TNOA 4UI9J 4ILGA 3HCSA 3TXNA 3KEZA 3PZ4A 3FTUA 5D1KB 3ZGQA 2DYSE 4LERA 3UMVA 4U63A 4B8CB 5ITZF 3X2QE 2CG3A 2CKLA 5CERB 1AP7A 3C5KA 2QY7A 4AJWA 4U7EB 5AQ7A 3FUKA 1INZA 2KYUA 5TBNA 3ONKA 1H2TC 4HLLA 3TAXA 3S2AA 2X6HA 4MVTA 2BEDA 4FADA 3AU5A 2ECNA 4J8EA 5B3SE 2YW8A 2B6CA 5LFAA 5DBKA 5A6CA 2YSMA 2UWJG 3N9QA 2LO6A 4CT4A 3PE3A 2NC9A 5HI7A 4KYOB 4HXIA 3ZUVB 4AXHA 1K2FA 4U8HA 1SZAA 2HO1A 3WG7E 2BKKB 4I1AA 4G1TA 3C98A 3Q9NC 1WEMA 3AG4E 2Y0BG 4G26A 2UY1B 1SVXA 5HKPA 2V5FA 3ASFA 2GROB 4WNGA 4GNEA 1TN8A 4HRLA 2LUHA 4BT8A 4AVXA 2VJFB 2GRPB 2QJ0A 5FINA 3NG2A 5D66A 4TV3A 3PZDA 2V4LA 2L0IA 4GU5A 3TWVA 1TEZA 2XZTG 4ANXA 2KR4A 3CK8A 3D9OA 4ANVA 3HXDA 2YNQA 3OXLA 4HRMB 2VJ8A 3FY4A 2Q7FA 5AJLA 3AJIA 4GAAA 2ZISA 3QWPA 2DSMA 2KKYA 4I9EA 3AS5A 3PRZA 4UI9B 2L0TB 4Q69A 2MT5A 3FH5A 4ZDTA 3FM8C 4DX1A 3MV2B 3MYVA 3OXGA 5AITA 5SVYA 1MX2A 3FU0A 2XGOA 3VTYA 4MRUA 2QFCA 2Y3AA 5DIZA 3ASGA 4PDXA 3D9HA 3RU0A 4ACLA 4ATGA 3Q49B 1K1AA 2BUGA 2KCKA 3FAOA 3KEAA 4I43A 4GTSA 3CHOA 5AIJA 1OXJA 2WXGA 4AYCB 3BG1B 3MZLB 1IYGA 2J4DA 3B7RL 3QAQA 4UQXA 2EQXA 1ZBPA 4DK5A 2IY0C 5JJTA 3CLJA 1TYQG 2XPIA 1JWFA 2CHZA 3QB2A 3CSFA 1NA0A 2KM4A 3OTNA 3Q9UC 3ZEFA 5HQ8A 4FA6A 4F53A 5B77A 2OCCE 4EQFA 2I6HA 2KCLA 4YVOA 3DWDA 2E61A 5EX0A 1OCCE 4L23A 4L1BA 3U64A 4S3OC 3QC1A 3FEHA 4ZHBA 4ILHB 5C2YA 3Q1DA 3ZXSA 3J5PA 3SFYA 5FB1A 1UW4B 3NZSA 4RQIA 5FQ8A 2KWNA 2M1RA 1LF8A 3RPGB 1RW2A 4W4UA 3KQIA 1OT8A 3NBNB 3Q75A 4AEZC 4ABNA 2IO2C 2VSYA 2OXQC 4ANWA 4GA0A 5EIBE 3U4TA 3L6AA 1WE9A 4EHMA 4XZ4A 1N9AA 4X3GA 2CRWA 5B78A 5D0OD 3CGHA 5AAOA 3APDA 4G23A 1ZBDB 2VYIA 2J49A 3FTWA 3ENEA 1X4IA 2PNNA 2MOWA 4APOA 4I1OB 3ZN3A 1A5EA 2GRLA 4MKTA 3DPLR 1QQEA 1WEQA 3B7BA 3LCAA 3NOCD 1WEOA 3E37A 1NFIE 4GYYA 3FUHA 2ECIA 3ZU7B 5G55A 3AG1E 4CZ2D 3MV3B 3RRMB 5T8IA 1JUQA 1SA4A 1XGWA 1TJFA 2EILE 1OCRE 4L2LA 2VSNA 4WWPA 4CDRA 5I3LA 1Z60A 3IKOB 1UOHA 2FBNA 4FJZA 3O37A 1D8DA 2XEHA 4E85A 2IQJA 5LP0A 1B89A 4DX2A 4JEHA 2OVFA 2A4ZA 2CHXA 3SNXA 4L9PA 2E2EA 4D10C 2J09A 4Q94A 3KNVA 2KKXA 2OEVA 1FVHA 2OV8A 3SFZA 3FWVA 1MYOA 3D3MA 1HG2A 1HF8A 2VJEB 4RSYA 2YQMA 4LSZE 3UT4A 3ZIMA 1HS6A 4DI4A 3Q5MA 3GL6A 1SQMA 4OGCA 4I6GA 2GW1A 2EIME 4DPRA 4B89A 4DLQA 5EYPF 2CSVA 2H0DA 5JMND 2RSDA 2FF4A 2VGYA 4U0UA 2RKKA 5KH7A 2MRIA 4GMJA 5JHBA 5LCWJ 2EA6A 3TG4A 3EB5A 4UQZA 2R17C 4AUQB 4TKPB 3DPDA 2KZTB 1ZB1A 2DZNA 1TN6A 4TXPA 4N5CA 4RLYA 4WAFA 1E96B 2WXFA 4ATZD 3C3OA 3R7QA 3ZHEA 3JQ0A 5JJ6A 2MIQA 4LUNU 1EYHA 4U0SA 1PAQA 3UIOC 3FP3A 4I17A 1OWOA 2ZU6B 5FQ6A 1WEWA 1WAO1 1NL4A 1VYXA 2ZETC 2VTBA 4A4BA 3EUVA 2WXOA 5B8DA 3EHMA 2F6NA 4HORA 2KWKA 2YVRA 2YT5A 2L5UA 4DX7D 1UJKA 5KWDA 4OGEA 1U3CA 4Z0OA 4GTPA 4L7TA 2PZIA 1WM5A 1Y8MA 4GNDA 1MZCA 3UM0A 2PM6A 4MSXA 5ANRA 3M7KA 3N9PA 3U5NA 2XB1A 1KT1A 3RJVA 3BEEA 3G2TA 3ISMC 3EB6A 4U04A 1LD8A 1LDKC 2MYOA 4HS2A 4GB9A 3LS8A 2IOLA 2IU1A 1S70B 2OVBA 3PS6A 3EHQA 3Q73A 4G8LA 2H6IA 2LV9A 1K8KG 2ECVA 2WXKA 3FUNA 5ENOD 5AQAA 4JHKA 1N52A 4XKBA 4L58A 4J8FA 4JPSA 4C9BB 1ZU2A 5CHEE 5G04C 3L13A 4WNFA 4S3OB 3ZPV1 5SVIA 4MLPA 4F52B 4J6IA 3G2UA 2VNFA 2ETBA 4BSZB 4GYOA 4JZYA 3FEXA 2P9NG 3RRUA 2QC9A 4KZ0A 2L75A 1BPOA 4BTBA 4P5OB 1O1TA 2RFAA 3C3QA 4YBTA 2ETAA 2DYRE 2E0IA 4JEUA 3IV0A 4BEPA 4QF2A 1KLXA 2VSOE 5FERA 4AV7A 3AG3E 4DLOA 3PNTB 2VGXB 3ZPJA 3FUJA 4NQ0A 3SF4A 3VLFA 5K3QA 3U9WA 5KNGA 3MKQB 4N39A 2BF0X 3D9MA 5ENTD 2JUNA 2M63A 3PUJA 3Q4AB 1VFYA 4GMRA 2E6SA 2HDPA 1V55E 4HRNA 1N94A 3U5PA 2MD8C 3CVLA 4W9RA 5AN8A 4FIPA 2F8XK 5B76A 3BU8A 3PZ3A 2IF4A 1KZOA 5FIOA 2RI7A 5BXOA 3RTRB 5ENPD 4H7YA 4GCOA 2WXPA 4JD2G 2GRRB 1XNFA 2CRRA 1VD4A 3L54A 3ZVYA 1Q2ZA 3SZ7A 1QBQA 5EIDA 4HLEA 4XI9A 3ZYKA 2YREA 5EDSA 2FUUA 5LKXA 1N0RA 2YU4A 3LVQE 3FJUB 4U07A 3K9IA 1HZ4A 5CRUA 2KE1A 5D2MC 3FH7A 2KGIA 3KV6A 5FJYA 5BUZA 3L08A 3CHMA 1N4SA 2YSJA 3VLDA 1N11A 3EIJA 3ML9A 3LDYA 2D8UA 1MX4A 1BORA 3LXUX 2YURA 2P2CP 4NACA 5D0QD 1WENA 2OWAA 5FT9A 1NI1A 2FO1E 2NXPA 4C48B 4ACKA 4A55A 5G04J 3HG0D 3FEYA 2L7PA 1E8WA 2LN0A 2EXUA 4WWOA 3E2DA 1WDYA 3FTZA 5KJLA 1XWHA 2VQ2A 2IO3C 2YHNA 4L7XA 2P57A 1OWMA 2H6GA 4LLBA 2IEJA 3LJ3A 4UWHA 3SQVA 1WILA 4AIFA 2CT2A 1WEUA 5JHAA 4GB0A 1IYMA 3ASDA 4GMLA 4FK5A 5B79A 1WGMA 1O5MA 4KVMA 2KWOA 3JCKC 1S64A 1N54A 1T1HA 1DCEA 2KGGA 3EJNA 2F0YA 3UTMA 4CDMA 5E76A 5EYLA 3UKRG 3T5VA 2ZGDA 3R9AB 3R7RA 2C0MA 4TRQA 1OWNA 4GTTA 3L22A 2G6QA 1Z2QA 4HVBA 4LNUD 4G25A 3HVEA 4B7YC 3L82A 5TRBA 3ABKE 4IC2A 4JW1A 2RG8A 3KD7A 2LSUA 3PEUB 4BX8A 1HYIA 4E6HA 2EIJE 1JM7B 3R9MA 3MHHA 2I50A 3PH0C 1N4PA 3HXBA 2I9CA 3RKVA 5JG6A 3DDTA 2LXPC 4G24A 2FFWA 3ABLE 3UM1A 3QWVA 4LNGA 4GPKA 3Q7AA 2LGVA 2R59A 4UWFA 2KATA 2MD7B 3TWRA 3CKBA 3PUQA 1OCZE 4Z0RA 3ZNIA 5H1TA 4FLHA 4JHJA 4IC3A 4I1MA 4UWLA 5G04B 5KH3A 4GZ6A 4YAXA 1KZPA 1P5QA 3ZTGA 3V2XA 3T5XA 4GNFA 4QQ4A 3HXFA 2P58C 5G0FA 4BTAA 4QF3A 2PL2A 4GNGA 3I3NA 3VK6A 3PE4A 1N87A 4LRZA 5HRYA 5H1UA 2ETCA 2MA5A 5FZQA 3FTYA 2CHWA 2HYED 3OAWA 1S0PA 3CR3A 2K17A 1Z3YA 2Y1NA 4DJAA 3SD5A 1YA0A 3PURA 4B94A 4WNEA 2ILRA 3T7LA 2IQCA 2CFZA 4U0ZA 4BESA 4I7DA 4JA7A 5EYAF 4Y6WA 3CV0A 1FBVA 4PS8A 5BPPA 3T6RA 2WQ6A 1SZ9A 1ELKA 4AP4A 2VP7A 4BWRA 2R2LA 1E8YA 4C0EA 5FB0A 2YINA 4RG6A 3CIAA 3IEGA 4GZDA 1OUVA 2QIZA 4F7AA 5FQ7A 3JXIA 3PLWA 3ZPVE 2A5EA 2XPZA 2WB2A 4H9DA 2Y69E 2MUMA 3G2VA 4LJNA 5B1AE 2ECWA 3ZYMA 4CGWA 2F37A 3OXFA 3UIPC 3CVUA 4EECA 2LDRA 1N4RA 5CBOA 3APCA 3HXCA 2WQ7A 4YABA 3V30A 2DIWA 4YADA 4AM9A 5CMYA 2XCBA 2DCPA 2K1JA 2FO7A 2OOEA 4BY6A 2AJAA 2VPBA 2A5UA 4GCNA 4QFVA 2LXLA 5KJNA 2HR2A 5CRVA 3HYMB 1H6KA 2RFMA 3GYZA 2DX8A 2JMDA 5E75A 2P9SG 3TGOA 1JCQA 1LD7A 4EZLA 3O4ZA 3SI5A 2CONA 3SBSA 2GGFA 2YHOA 4HFGA 3CK7A 1TNZA 3KAEA 4B93B 2AVPA 4KT6B 3QWWA 4X8QA 3MHSA 1S63A 3CSTA 2IONA 4CYMD 2WMNA 1G25A 4CT0A 5G05B 3FHEA 1DVPA 3KS2A 2CSYA 3F6QA 1E4UA 2UY1A 3BQOA 2H6FA 4KMOA 3PEVB 5ARFA 3UINC 3NAWA 1O1SA 4WZ3B 4LEUA 4YBSA 5KCMA 2G45A 4TUUA 3NF1A 2PQNA 4HOTA 4BX9A 3I4GA 4NN2A 2VJFA 2PM7A 2X38A 3PUKA 5DKAA 4OAUC 2P9KG 3QKYA 1EDUA 2LAHA 3ULEG 2XENA 1FT2A 1OWLA 5A23A 3QNKA 1U2VG 3LY9A 1JCRA 2XOCA 2JABA 5FWQA 2ECTA 1X81A 2LGGA 2K16A 2AXZA 3FFLA 2JEKA 1DNPA 4KVOA 2LXMA 4CGVA 2L9BA 2ZGGA 2C0LA 4GTOA 2WXHA 1Y6IA 3SUBA 4ZFHA 3T8MA 2V8SE 2JRJA 5BNWA 2R03A 1WG0A 2EODA 1U3DA 3TWQA 1LTXA 3RSEG 3Q78A 2FULA 5D1MB 5AYWD 3FUEA 1GW6A 4EBAA 2WXLA 3ZW3A 4N3BA 4KBQA 5LKZA 2B0OE 5AQ9A 4CEMA 1WEEA 2XP0A 4V3LC 3Q47B 2WQHA 4U95D 3EHNA 4AYCA 4JXTA 1A17A 4Z68A 1RZ4A 1TJCA 3L11A 4HBDA 3MA5A 4APFA 2Y4TA 3LRQA 4FU3A 3HDXA 2LQ6A 4R7LA 3ASHA 3SOUA 4MS6A 3KDEC 4GTMA 1FVFA 4DI3A 4FLBA 3MJWA 4GTRA 2MNZA 2CKLB 2EINE 4HI8A 3TJPA 2R02A 3PZ1A 4OYSA 2LXHC 3CK9A 3L9TA 1Z6UA 3DXMG 2L80A 2GRQB 4A63B 4EPZA 2LGLA 5SVXA 4RVBA 3DSUA 3QARA 4XKCA 1N95A 2LAUA 5ENNA 3DRAA 4NIKA 4YDOA 3NOGD 2XEVA 5C13A 3CHPA 4AY6A 1TNUA 4FHJA 4BT9A 2ECJA 2PQRA 3MX3A 2OEWA 2P9IG 5BXUA 1SA5A 3CQCB 3AAAC 1BU9A 4Q6FA 5LKUA 4BERA 2AXVA 4ZUXU 3FH8A 3UXGA 3E34A 4IRUA 2MNYA 2LGKA 3FDHA 3UM2A 1U6GB 4OAVB 4UP5A 5EN5D 5AQBA 2WXNA 3HCUA 3B7SA 1YYHA 2LSVA 5J08A 4LNBA 3V43A 2EGMA 3GZ2A 2GRNB 3D9JA 2LNIA 2QICA 2XHEA 1X4UA 4DX5D 3T9KA 3RO3A 3SO8A 1Z6TA 2AW6A 1H2VC 5D1LB 3ZFWA 1TNYA 3IHVA 1TNBA 1X5BA 5CEAA 3LQHA 1N4QA 3E33A 4HI9A 5H9MA 2IOSA 4N3CA 5AENA 5KNHD 3SBTB 2NSZA 1HYJA 2FSAA 1WIMA 4Y6CA 2DZOA 3LVRE 3CVXA 5B1BE 1K1BA 2X6KA 3M62A 4HNAD 5IY5E 4WA6A 3JUEA 4F3VA 3ESKA 4J8DA 5EKQD 2BTDA 3LJNA 3O36A 2MHKA 4N4FA 2LRIC 3DSXA 3LYAA 3AG2E 4YDYA 2F6JA 3CHQA 2M85A 2VJEA 3E30A 3SGHA 5KJMA 4I6JA 4B0ZA 2WXRA 2XEEA 2EIKE 3CVVA 2J07A 2DJAA 3ZNGA 3D9IA 2J4BA 1HH8A 3PZ2A 2YYRA 1F62A 1H0AA 2I2OA 2KFTA 4RG9A 1WEVA 3HIZA 2FD4A 5FZSA 4K5AB 4K0RA 4LK9A 2KZTA 3TWTA 5FZRA 4UUCA 1OWPA 4JA9A 5M72A 4ANUA 1MHQA 4J7WA 4XX5A 1Z3XA 5DINA 3I4RB 5ARGA 4K5BA 2X6IA 4LG6A 5TABA 2AN6A 2XPYA 2C2LA 3FTSA 3SY2A 3EDTB 3CKCA 3ESLA 2XOZA 3FUFA 4N3AA 2ECGA 1MBMA 1MM2A 1AWCB 2X6JA 2PUYA 5H1VA 2VPDA 2QZAA 2XRZA 4F1SA 1RMDA 1H6PA 5G05C 2P9PG 3PHDA 1BI7B 2WVIA 3MKRA 3S7FA 3N9NA 3LEWA 5J3XA 1QNFA 3UPVA 2VGEA 5LKTA 4ILIA 4GZ3A 3DEPA 4GTVA 1QZ2A 2CFUA 3ZXPA 1BLXB 5JJ7A 2M6MA 3L16A 2V5QC 4N2SA 3U3WA 3RO2A 3CVQA 3CHSA 4FJCA 1DCQA 4I7BA 1NZNA 1YCSB 3KSQA 3DSVA 3DBSA 2FEZA 4WNDA 4XE0A 4N5QA 1X4JA 3MDBC 1FPPA 3JXJA 5ANLA 3ML8A 4CDNA 1IQRA 1TN7A 1FP0A 3ZVZB 4GYWA 3URZA 2R05A 1UG3A 3EIQC 3ASOE 4CA1A 3CQGB 3QOUA 4YC9A 2HE0A 3PNLB 3UT8A 2L6BA 1YMPA 2F8YA 5LX8A 2YQ8A 3Q15A 3N71A 3D9LA 3IXEA 4P29A 4V3IA 2WM9A 3DSTA 2MKEA 5B75A 4G11A 2QYUA 1HO8A 4WWNA 4YDWA 3CVWA 5TDRA 4WUYA 3LPZA 5CCLA 4H7XA 2VGXA 4R2YA 1V54E 4AP2A 5CCMA 1WESA 2RD0A 3SFXA 1HXIA 3MKQA 4DX6D 4TXQA 1QYMA 1E90A 4N2QA 3LJUX 2H0DB 4I7CA
chains in the Genus database with same CATH topology
1N0RA 4QQIA 4LNUD 5KNHD 4U96D 3FEHA 3FJUB 4BESA 3LVQE 3KDEC 4O1PA 2VGEA 5ENSD 1MYOA 1BD8A 4ZHBA 1IKND 1S70B 5CECB 2RR4A 3TWVA 3Q1DA 5SVIB 2XZTG 3ZKJA 3EHQA 4LSZE 4G8LA 3C5RA 5AARA 3DEPA 3J5PA 2DZOA 1OY3D 4HI8A 2KXPC 2NYJA 2KBXA 3EU9A 4BETA 3DEOA 3LVRE 4OGCA 3J5QB 4HRMB 4HB5A 5ENOD 2J8SD 5AQAA 3AJIA 3UI2A 1K1BA 5ENRD 1D9SA 4OAUC 4HNAD 5CBNA 4F1PA 3JUEA 4O1OA 1MJ0A 3TWWA 5EYPF 2CSVA 3LJNA 4GPMA 2KKYA 4U8YD 5JMND 4DUIA 1N11A 2XENA 4JB8P 1OT8A 1BLXB 4A63B 5SVXA 2DVWA 1BI8B 2V5QC 3LDYA 2D8UA 3NBNB 3DDTA 4YDYA 5SVIA 1MX4A 4K5CA 2LAUA 5ITZF 2FFWA 4J8YA 5CEDB 2P2CP 4NIKA 2ETBA 4BSZB 3JXIA 5JA4D 3NOGD 5CERB 2XOCA 3FM8C 3PLWA 5EIBE 2JABA 2OWAA 4DX1A 2A5EA 1AP7A 2XEEA 1DCQA 2DZNA 1YCSB 5SVYA 1MX2A 4H9DA 2QC9A 2FO1E 2Y1LE 4C48B 2CRWA 4O60A 3TWUA 3ZNGA 5AQ7A 5ENQD 2DJAA 5BXUA 2RFAA 4RLYA 3D9HA 2F37A 2ZGGA 2V4HC 3HG0D 4N5QA 2ETAA 3TWRA 4ATZD 5AAOA 2L7PA 4O62A 3AAAC 1BU9A 3MDBC 3JXJA 4Z0RA 4HLLA 4BERA 4ZFHA 3V79K 2EXUA 4BEPA 3W9FA 3E2DA 3SUBA 1WDYA 4TUMA 3UXGA 5CBOA 2PNNA 5EILA 1G3NB 2BKGA 3B95A 3V30A 1K1AA 3TWSA 2FD4A 3V2XA 5HS0A 1WG0A 1SW6A 1K3ZD 1A5EA 4K5AB 4OAVB 1TR4A 3KEAA 2P57A 4QQ4A 5K3QA 3TWTA 2AJAA 2HE0A 5EN5D 3B7BA 5AQBA 3TWQA 3NOCD 3ZUVB 3O47A 4UUCA 4QFVA 1N0QA 5KNGA 2L6BA 1YMPA 1NFIE 2F8YA 1IXVA 1YYHA 3ZU7B 5ENTD 4CZ2D 2BKKB 2JUNA 3IXEA 1DC2A 4J7WA 2RFMA 4GMRA 2MKEA 3Q9NC 2EGMA 4HRNA 2YVRA 2B0OE 4HQDA 4YDWA 3V2OA 2Y0BG 4K5BA 4LG6A 5AN8A 5AQ9A 5HRYA 4DX7D 5KWDA 2F8XK 4OGEA 1SVXA 2ETCA 4Z0OA 5HKPA 2CONA 2XP0A 4U8VD 2XOZA 4DX5D 3T9KA 5FIOA 4F6RD 5BXOA 5ENPD 4U95D 1IHBA 4B93B 3Q9UC 1UOHA 4G8KA 2M13A 2XEHA 3SO8A 4HRLA 2IQJA 3UTMA 3TWXA 3T8KA 4Z68A 2QYJA 5EYLA 1AWCB 3V31A 2ZGDA 4DX2A 4DX6D 3W9GA 4HBDA 4CYMD 3M7KA 5FINA 2CRRA 2XZDG 3HRAA 1MX6A 1QYMA 5CEAA 3DWDA 2E61A 3LJUX 5EIDA 5D66A 4DRXE 2KKXA 3EHRA 1BI7B 4HI9A 2XOYA 2MYOA 2JM3A 3F6QA 2YREA 5KBAA 2DWZA 3H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0R A;  4QQI A;  4LNU D;  5KNH D;  4U96 D;  3FEH A;  3LVQ E;  4BES A;  4O1P A;  2VGE A;  5ENS D;  1MYO A;  1BD8 A;  4ZHB A;  1IKN D;  1S70 B;  5CEC B;  3TWV A;  2XZT G;  3ZKJ A;  3EHQ A;  4LSZ E;  4G8L A;  3C5R A;  5AAR A;  3DEP A;  3J5P A;  2DZO A;  1OY3 D;  4HI8 A;  2KXP C;  2NYJ A;  2KBX A;  3EU9 A;  4BET A;  3DEO A;  3LVR E;  3J5Q B;  4HRM B;  4HB5 A;  5ENO D;  2J8S D;  5AQA A;  3AJI A;  3UI2 A;  1K1B A;  5ENR D;  1D9S A;  4OAU C;  4HNA D;  5CBN A;  4F1P A;  3JUE A;  4O1O A;  1MJ0 A;  3TWW A;  5EYP F;  3LJN A;  4GPM A;  4U8Y D;  5JMN D;  4DUI A;  1N11 A;  2XEN A;  4JB8 P;  1OT8 A;  1BLX B;  4A63 B;  2DVW A;  1BI8 B;  2V5Q C;  3NBN B;  4YDY A;  1MX4 A;  4K5C A;  5ITZ F;  4J8Y A;  5CED B;  2P2C P;  4NIK A;  2ETB A;  4BSZ B;  3JXI A;  5JA4 D;  3NOG D;  5CER B;  3FM8 C;  5EIB E;  2JAB A;  2OWA A;  4DX1 A;  2A5E A;  1AP7 A;  2XEE A;  1DCQ A;  2DZN A;  1YCS B;  1MX2 A;  2QC9 A;  2FO1 E;  2Y1L E;  4C48 B;  2CRW A;  4O60 A;  3TWU A;  3ZNG A;  5AQ7 A;  5ENQ D;  5BXU A;  2RFA A;  4RLY A;  3D9H A;  2F37 A;  2ZGG A;  2V4H C;  3HG0 D;  4N5Q A;  2ETA A;  3TWR A;  4ATZ D;  5AAO A;  3AAA C;  1BU9 A;  3MDB C;  3JXJ A;  4HLL A;  4BER A;  4ZFH A;  3V79 K;  3SUB A;  4BEP A;  3W9F A;  1WDY A;  4TUM A;  3UXG A;  5CBO A;  2PNN A;  5EIL A;  1G3N B;  2BKG A;  3B95 A;  3V30 A;  1K1A A;  3TWS A;  3V2X A;  5HS0 A;  1WG0 A;  1SW6 A;  1K3Z D;  1A5E A;  4K5A B;  4OAV B;  1TR4 A;  3KEA A;  2P57 A;  3TWT A;  2AJA A;  2HE0 A;  5EN5 D;  3B7B A;  5AQB A;  3TWQ A;  3NOC D;  3ZUV B;  3O47 A;  4UUC A;  4QFV A;  1N0Q A;  5KNG A;  2L6B A;  1YMP A;  1NFI E;  2F8Y A;  1IXV A;  1YYH A;  3ZU7 B;  5ENT D;  4CZ2 D;  2BKK B;  3IXE A;  1DC2 A;  4J7W A;  2RFM A;  4GMR A;  3Q9N C;  4HRN A;  2B0O E;  4HQD A;  4YDW A;  3V2O A;  2Y0B G;  4K5B A;  4LG6 A;  5AN8 A;  5AQ9 A;  5HRY A;  4DX7 D;  5KWD A;  2F8X K;  1SVX A;  2ETC A;  5HKP A;  4U8V D;  4DX5 D;  3T9K A;  5FIO A;  4F6R D;  5BXO A;  5ENP D;  4U95 D;  1IHB A;  4B93 B;  3Q9U C;  1UOH A;  4G8K A;  2XEH A;  3SO8 A;  4HRL A;  2IQJ A;  3UTM A;  3TWX A;  3T8K A;  4Z68 A;  2QYJ A;  5EYL A;  1AWC B;  3V31 A;  2ZGD A;  4DX2 A;  4DX6 D;  3W9G A;  4HBD A;  4CYM D;  5FIN A;  2CRR A;  2XZD G;  3HRA A;  1MX6 A;  1QYM A;  5CEA A;  3DWD A;  3LJU X;  5EID A;  5D66 A;  4DRX E;  3EHR A;  1BI7 B;  4HI9 A;  2MYO A;  3F6Q A;  5KBA A;  2DWZ A; 
#chains in the Genus database with same CATH topology
 4QQI A;  2RR4 A;  3SHB A;  3ZKJ A;  4MBG A;  4CRW A;  5AAR A;  3DSW A;  2M3H A;  3Q79 A;  5EX3 A;  4EZK A;  4HB5 A;  5G05 J;  3UI2 A;  4M7C A;  5CBN A;  4C9Z A;  3DXK G;  4O1O A;  3IBE A;  3TWW A;  3ZHE B;  1O1R A;  3UKU G;  3I2D A;  3O35 A;  2WXQ A;  2I1J A;  3CEQ A;  4FUL A;  3FAN A;  2JLB A;  4IN3 B;  2WMO A;  3HHM A;  4J8Y A;  5C1D A;  2X6F A;  4I9C A;  2XEU A;  2K4D A;  4N3W A;  1Z5S C;  2YHC A;  2BAY A;  3U5O A;  2Y1L E;  2VTB B;  4O60 A;  3TWU A;  1IHG A;  3D9K A;  4WZ0 A;  3V79 K;  2NAA A;  4PTB A;  2EGP A;  2R5S A;  4UWG A;  4WZ2 A;  1EF1 C;  4HOQ A;  1E8X A;  4JHR A;  5A7D B;  3CVP A;  3B7U X;  4FC8 A;  5KH9 A;  2J08 A;  3ONL A;  4NRH B;  1WY6 A;  2IFU A;  5AJD A;  4I2W A;  2DBA A;  4U8V D;  3O70 A;  2AXU A;  4F6R D;  3CVN A;  1NP7 A;  1IHB A;  4G8K A;  2M13 A;  3ASN E;  5LCW C;  3TWX A;  2QYJ A;  3VTX A;  3ZRH A;  1ELR A;  3TXM A;  3O48 A;  4DRX E;  4M3O A;  3S7D A;  4ZQL A;  4C0M A;  1IQU A;  5KBA A;  4IUL A;  3NB2 A;  2VSX E;  5SVI B;  1OCO E;  1WFK A;  2V0P A;  4CCG X;  2C2V S;  4KZC A;  4A0C D;  2H6H A;  3M63 A;  3O33 A;  2L43 A;  3EU9 A;  5BW8 C;  3BUA A;  4F1P A;  3LKU A;  4UQY A;  1PC2 A;  4UP0 A;  4LKA A;  4U8Y D;  3QK0 A;  4JC8 A;  3FUL A;  1H19 A;  1VDY A;  4UWK A;  1H2U A;  3DSS A;  1CHC A;  3NQP A;  4TXR A;  4B8A A;  3JYS A;  3LQJ A;  3L1X A;  2XRY A;  4IYP A;  5ENQ D;  3O7A A;  3C3R A;  4GA2 A;  5BV0 A;  1JM7 A;  4GZC A;  4PH4 B;  3GZ1 A;  4R8P K;  3FU5 A;  4A1G A;  4J0U A;  5EIL A;  2D8S A;  1G3N B;  2BKG A;  3EU5 A;  3N9O A;  4AY5 A;  2P9L G;  3P2B A;  4PUC A;  3FUM A;  3APF A;  5HS0 A;  1SW6 A;  3MGB A;  1V87 A;  3AS8 A;  3L17 A;  4V3K C;  3O47 A;  4FHK A;  1E7V A;  4YDE A;  4NUR A;  4YVQ C;  1DC2 A;  4B86 C;  2VPE A;  4R7E A;  5G2N A;  4HQD A;  2ZXW E;  2PNX A;  2G43 A;  1UN8 A;  2KU3 A;  2WPV A;  1HFA A;  5FTP A;  3DWL G;  5BT1 A;  3AU4 A;  3FL2 A;  5FEY A;  4FO9 A;  4AOF A;  3S7B A;  4JL0 A;  3C6W A;  1JWG A;  5J90 A;  3G2S A;  3RRN B;  2XCC A;  1LDJ B;  3H7H A;  3FTV A;  4U96 D;  1E7U A;  3I5P A;  3LQI A;  1IKN D;  2WXM A;  1JPL A;  4A1S A;  3M99 A;  1WEP A;  4BSX A;  3BG0 B;  1OY3 D;  3N9L A;  2NYJ A;  2KBX A;  2XS8 A;  4K03 A;  3J5Q B;  4J8S A;  2OND A;  3JQ1 A;  1D8E A;  3HTK C;  3UM3 A;  3LY7 A;  3B13 A;  1MJ0 A;  1L5J A;  4DUI A;  1UJJ A;  4JB8 P;  4XIF A;  3KSL A;  2DVW A;  1BI8 B;  4I6E A;  3ZVV A;  5T3R A;  4O6F A;  4K5C A;  1JCS A;  4FJY A;  4PS3 A;  3ABM E;  1NA3 A;  3D9P A;  5JA4 D;  2XGS A;  3FUI A;  3ZYL A;  4XI1 A;  2X3M A;  3E32 A;  2WXI A;  2ZIR A;  2L0B A;  5FQ4 A;  5T4Y A;  2V4H C;  4O62 A;  3FUD A;  4BHW A;  3W9F A;  4TUM A;  3ASL A;  1KT0 A;  2JMJ A;  2JMI A;  3AS4 A;  3TWS A;  4LCT A;  1K3Z D;  4YAT A;  4URK A;  2MA6 A;  4G2V A;  1UN9 A;  5TDW A;  4Q96 A;  2FUI A;  3PVL A;  2UZG A;  1HE8 A;  2KIZ A;  3LDZ A;  3HXE A;  3C72 A;  4BBQ A;  1MQS A;  4L2Y A;  4PPE A;  3ZYQ A;  1HG5 A;  3UQ3 A;  3SHF A;  3N9M A;  3HVE B;  3ULY A;  2XGM A;  1JOC A;  4YBM A;  3U5M A;  2IDA A;  3RIB A;  3T8K A;  3D9N A;  3UX4 A;  4LAD B;  2XS1 A;  3DPY A;  4XI0 A;  2P9U G;  4BFR A;  1FT1 A;  4O64 A;  2DWZ A;  4UI9 C;  4ME2 A;  3GW4 A;  4O1P A;  3P1U A;  2AWI A;  3C5R A;  4GZ5 A;  2KXP C;  5LCW B;  2KC7 A;  4A3T A;  3LY8 A;  2J8S D;  1MM3 A;  3L1Z B;  1W3B A;  5ENR D;  3G2W A;  3DQV R;  4XEI G;  4A4C A;  3UUX A;  3PRE A;  1FCH A;  4GPM A;  4A49 A;  2LAI A;  2Y43 A;  3TG5 A;  3QZV A;  3CHR A;  1EPU A;  3O34 A;  4UI9 K;  5CED B;  2I1K A;  3B7T A;  3KV5 A;  4GTQ A;  4EBA G;  3E4B A;  3GZS A;  2L6J A;  4I2Z A;  5LOZ A;  1HU3 A;  2HYZ A;  4A3V A;  2XQ0 A;  5CMW A;  2Y1M A;  4EZJ A;  3SOW A;  3IHP A;  3B95 A;  3HCT A;  2IJG X;  2J9Q A;  1TR4 A;  4JVS A;  5AIU A;  3IHY A;  5KJK A;  3GV4 A;  3MCX A;  1N0Q A;  3SOX A;  3RK6 A;  3UT7 A;  1IXV A;  3U66 A;  3RAU A;  3PDN A;  3WXX A;  3Q7F A;  2KWJ A;  2KRE A;  2CG2 A;  2F42 A;  3NZU A;  3V2O A;  4HOU A;  5C11 A;  2YHE A;  2YQL A;  3ULQ A;  4OVU A;  2HM8 A;  3VLE A;  4GA1 A;  4KXK B;  1E8Z A;  2Y4U A;  5BV1 A;  3V31 A;  3MEK A;  5H7P A;  3W9G A;  4CCA A;  2XZD G;  4FP7 A;  3HRA A;  1MX6 A;  3S7J A;  2YUC A;  1HX8 A;  3RPG C;  1PY1 A;  3EHR A;  3FU6 A;  2XOY A;  3TL5 A;  2JM3 A;  1KPS B;  4HOS A;  4OVV A;  2GRM A;  2WXJ A;  4PS7 A;  2KCV A;  5ENS D;  2E6R A;  1BD8 A;  5CEC B;  3FTX A;  1ELW A;  4BET A;  3QDN A;  3FU3 A;  3DEO A;  3CVY A;  3JUI A;  2FI7 A;  1H6O A;  4YND A;  1D9S A;  3QJZ A;  2CSZ A;  2VPG A;  1TNO A;  4UI9 J;  4ILG A;  3HCS A;  3TXN A;  3KEZ A;  3PZ4 A;  3FTU A;  5D1K B;  3ZGQ A;  2DYS E;  4LER A;  3UMV A;  4U63 A;  4B8C B;  5ITZ F;  3X2Q E;  2CG3 A;  2CKL A;  5CER B;  1AP7 A;  3C5K A;  2QY7 A;  4AJW A;  4U7E B;  5AQ7 A;  3FUK A;  1INZ A;  2KYU A;  5TBN A;  3ONK A;  1H2T C;  4HLL A;  3TAX A;  3S2A A;  2X6H A;  4MVT A;  2BED A;  4FAD A;  3AU5 A;  2ECN A;  4J8E A;  5B3S E;  2YW8 A;  2B6C A;  5LFA A;  5DBK A;  5A6C A;  2YSM A;  2UWJ G;  3N9Q A;  2LO6 A;  4CT4 A;  3PE3 A;  2NC9 A;  5HI7 A;  4KYO B;  4HXI A;  3ZUV B;  4AXH A;  1K2F A;  4U8H A;  1SZA A;  2HO1 A;  3WG7 E;  2BKK B;  4I1A A;  4G1T A;  3C98 A;  3Q9N C;  1WEM A;  3AG4 E;  2Y0B G;  4G26 A;  2UY1 B;  1SVX A;  5HKP A;  2V5F A;  3ASF A;  2GRO B;  4WNG A;  4GNE A;  1TN8 A;  4HRL A;  2LUH A;  4BT8 A;  4AVX A;  2VJF B;  2GRP B;  2QJ0 A;  5FIN A;  3NG2 A;  5D66 A;  4TV3 A;  3PZD A;  2V4L A;  2L0I A;  4GU5 A;  3TWV A;  1TEZ A;  2XZT G;  4ANX A;  2KR4 A;  3CK8 A;  3D9O A;  4ANV A;  3HXD A;  2YNQ A;  3OXL A;  4HRM B;  2VJ8 A;  3FY4 A;  2Q7F A;  5AJL A;  3AJI A;  4GAA A;  2ZIS A;  3QWP A;  2DSM A;  2KKY A;  4I9E A;  3AS5 A;  3PRZ A;  4UI9 B;  2L0T B;  4Q69 A;  2MT5 A;  3FH5 A;  4ZDT A;  3FM8 C;  4DX1 A;  3MV2 B;  3MYV A;  3OXG A;  5AIT A;  5SVY A;  1MX2 A;  3FU0 A;  2XGO A;  3VTY A;  4MRU A;  2QFC A;  2Y3A A;  5DIZ A;  3ASG A;  4PDX A;  3D9H A;  3RU0 A;  4ACL A;  4ATG A;  3Q49 B;  1K1A A;  2BUG A;  2KCK A;  3FAO A;  3KEA A;  4I43 A;  4GTS A;  3CHO A;  5AIJ A;  1OXJ A;  2WXG A;  4AYC B;  3BG1 B;  3MZL B;  1IYG A;  2J4D A;  3B7R L;  3QAQ A;  4UQX A;  2EQX A;  1ZBP A;  4DK5 A;  2IY0 C;  5JJT A;  3CLJ A;  1TYQ G;  2XPI A;  1JWF A;  2CHZ A;  3QB2 A;  3CSF A;  1NA0 A;  2KM4 A;  3OTN A;  3Q9U C;  3ZEF A;  5HQ8 A;  4FA6 A;  4F53 A;  5B77 A;  2OCC E;  4EQF A;  2I6H A;  2KCL A;  4YVO A;  3DWD A;  2E61 A;  5EX0 A;  1OCC E;  4L23 A;  4L1B A;  3U64 A;  4S3O C;  3QC1 A;  3FEH A;  4ZHB A;  4ILH B;  5C2Y A;  3Q1D A;  3ZXS A;  3J5P A;  3SFY A;  5FB1 A;  1UW4 B;  3NZS A;  4RQI A;  5FQ8 A;  2KWN A;  2M1R A;  1LF8 A;  3RPG B;  1RW2 A;  4W4U A;  3KQI A;  1OT8 A;  3NBN B;  3Q75 A;  4AEZ C;  4ABN A;  2IO2 C;  2VSY A;  2OXQ C;  4ANW A;  4GA0 A;  5EIB E;  3U4T A;  3L6A A;  1WE9 A;  4EHM A;  4XZ4 A;  1N9A A;  4X3G A;  2CRW A;  5B78 A;  5D0O D;  3CGH A;  5AAO A;  3APD A;  4G23 A;  1ZBD B;  2VYI A;  2J49 A;  3FTW A;  3ENE A;  1X4I A;  2PNN A;  2MOW A;  4APO A;  4I1O B;  3ZN3 A;  1A5E A;  2GRL A;  4MKT A;  3DPL R;  1QQE A;  1WEQ A;  3B7B A;  3LCA A;  3NOC D;  1WEO A;  3E37 A;  1NFI E;  4GYY A;  3FUH A;  2ECI A;  3ZU7 B;  5G55 A;  3AG1 E;  4CZ2 D;  3MV3 B;  3RRM B;  5T8I A;  1JUQ A;  1SA4 A;  1XGW A;  1TJF A;  2EIL E;  1OCR E;  4L2L A;  2VSN A;  4WWP A;  4CDR A;  5I3L A;  1Z60 A;  3IKO B;  1UOH A;  2FBN A;  4FJZ A;  3O37 A;  1D8D A;  2XEH A;  4E85 A;  2IQJ A;  5LP0 A;  1B89 A;  4DX2 A;  4JEH A;  2OVF A;  2A4Z A;  2CHX A;  3SNX A;  4L9P A;  2E2E A;  4D10 C;  2J09 A;  4Q94 A;  3KNV A;  2KKX A;  2OEV A;  1FVH A;  2OV8 A;  3SFZ A;  3FWV A;  1MYO A;  3D3M A;  1HG2 A;  1HF8 A;  2VJE B;  4RSY A;  2YQM A;  4LSZ E;  3UT4 A;  3ZIM A;  1HS6 A;  4DI4 A;  3Q5M A;  3GL6 A;  1SQM A;  4OGC A;  4I6G A;  2GW1 A;  2EIM E;  4DPR A;  4B89 A;  4DLQ A;  5EYP F;  2CSV A;  2H0D A;  5JMN D;  2RSD A;  2FF4 A;  2VGY A;  4U0U A;  2RKK A;  5KH7 A;  2MRI A;  4GMJ A;  5JHB A;  5LCW J;  2EA6 A;  3TG4 A;  3EB5 A;  4UQZ A;  2R17 C;  4AUQ B;  4TKP B;  3DPD A;  2KZT B;  1ZB1 A;  2DZN A;  1TN6 A;  4TXP A;  4N5C A;  4RLY A;  4WAF A;  1E96 B;  2WXF A;  4ATZ D;  3C3O A;  3R7Q A;  3ZHE A;  3JQ0 A;  5JJ6 A;  2MIQ A;  4LUN U;  1EYH A;  4U0S A;  1PAQ A;  3UIO C;  3FP3 A;  4I17 A;  1OWO A;  2ZU6 B;  5FQ6 A;  1WEW A;  1WAO 1;  1NL4 A;  1VYX A;  2ZET C;  2VTB A;  4A4B A;  3EUV A;  2WXO A;  5B8D A;  3EHM A;  2F6N A;  4HOR A;  2KWK A;  2YVR A;  2YT5 A;  2L5U A;  4DX7 D;  1UJK A;  5KWD A;  4OGE A;  1U3C A;  4Z0O A;  4GTP A;  4L7T A;  2PZI A;  1WM5 A;  1Y8M A;  4GND A;  1MZC A;  3UM0 A;  2PM6 A;  4MSX A;  5ANR A;  3M7K A;  3N9P A;  3U5N A;  2XB1 A;  1KT1 A;  3RJV A;  3BEE A;  3G2T A;  3ISM C;  3EB6 A;  4U04 A;  1LD8 A;  1LDK C;  2MYO A;  4HS2 A;  4GB9 A;  3LS8 A;  2IOL A;  2IU1 A;  1S70 B;  2OVB A;  3PS6 A;  3EHQ A;  3Q73 A;  4G8L A;  2H6I A;  2LV9 A;  1K8K G;  2ECV A;  2WXK A;  3FUN A;  5ENO D;  5AQA A;  4JHK A;  1N52 A;  4XKB A;  4L58 A;  4J8F A;  4JPS A;  4C9B B;  1ZU2 A;  5CHE E;  5G04 C;  3L13 A;  4WNF A;  4S3O B;  3ZPV 1;  5SVI A;  4MLP A;  4F52 B;  4J6I A;  3G2U A;  2VNF A;  2ETB A;  4BSZ B;  4GYO A;  4JZY A;  3FEX A;  2P9N G;  3RRU A;  2QC9 A;  4KZ0 A;  2L75 A;  1BPO A;  4BTB A;  4P5O B;  1O1T A;  2RFA A;  3C3Q A;  4YBT A;  2ETA A;  2DYR E;  2E0I A;  4JEU A;  3IV0 A;  4BEP A;  4QF2 A;  1KLX A;  2VSO E;  5FER A;  4AV7 A;  3AG3 E;  4DLO A;  3PNT B;  2VGX B;  3ZPJ A;  3FUJ A;  4NQ0 A;  3SF4 A;  3VLF A;  5K3Q A;  3U9W A;  5KNG A;  3MKQ B;  4N39 A;  2BF0 X;  3D9M A;  5ENT D;  2JUN A;  2M63 A;  3PUJ A;  3Q4A B;  1VFY A;  4GMR A;  2E6S A;  2HDP A;  1V55 E;  4HRN A;  1N94 A;  3U5P A;  2MD8 C;  3CVL A;  4W9R A;  5AN8 A;  4FIP A;  2F8X K;  5B76 A;  3BU8 A;  3PZ3 A;  2IF4 A;  1KZO A;  5FIO A;  2RI7 A;  5BXO A;  3RTR B;  5ENP D;  4H7Y A;  4GCO A;  2WXP A;  4JD2 G;  2GRR B;  1XNF A;  2CRR A;  1VD4 A;  3L54 A;  3ZVY A;  1Q2Z A;  3SZ7 A;  1QBQ A;  5EID A;  4HLE A;  4XI9 A;  3ZYK A;  2YRE A;  5EDS A;  2FUU A;  5LKX A;  1N0R A;  2YU4 A;  3LVQ E;  3FJU B;  4U07 A;  3K9I A;  1HZ4 A;  5CRU A;  2KE1 A;  5D2M C;  3FH7 A;  2KGI A;  3KV6 A;  5FJY A;  5BUZ A;  3L08 A;  3CHM A;  1N4S A;  2YSJ A;  3VLD A;  1N11 A;  3EIJ A;  3ML9 A;  3LDY A;  2D8U A;  1MX4 A;  1BOR A;  3LXU X;  2YUR A;  2P2C P;  4NAC A;  5D0Q D;  1WEN A;  2OWA A;  5FT9 A;  1NI1 A;  2FO1 E;  2NXP A;  4C48 B;  4ACK A;  4A55 A;  5G04 J;  3HG0 D;  3FEY A;  2L7P A;  1E8W A;  2LN0 A;  2EXU A;  4WWO A;  3E2D A;  1WDY A;  3FTZ A;  5KJL A;  1XWH A;  2VQ2 A;  2IO3 C;  2YHN A;  4L7X A;  2P57 A;  1OWM A;  2H6G A;  4LLB A;  2IEJ A;  3LJ3 A;  4UWH A;  3SQV A;  1WIL A;  4AIF A;  2CT2 A;  1WEU A;  5JHA A;  4GB0 A;  1IYM A;  3ASD A;  4GML A;  4FK5 A;  5B79 A;  1WGM A;  1O5M A;  4KVM A;  2KWO A;  3JCK C;  1S64 A;  1N54 A;  1T1H A;  1DCE A;  2KGG A;  3EJN A;  2F0Y A;  3UTM A;  4CDM A;  5E76 A;  5EYL A;  3UKR G;  3T5V A;  2ZGD A;  3R9A B;  3R7R A;  2C0M A;  4TRQ A;  1OWN A;  4GTT A;  3L22 A;  2G6Q A;  1Z2Q A;  4HVB A;  4LNU D;  4G25 A;  3HVE A;  4B7Y C;  3L82 A;  5TRB A;  3ABK E;  4IC2 A;  4JW1 A;  2RG8 A;  3KD7 A;  2LSU A;  3PEU B;  4BX8 A;  1HYI A;  4E6H A;  2EIJ E;  1JM7 B;  3R9M A;  3MHH A;  2I50 A;  3PH0 C;  1N4P A;  3HXB A;  2I9C A;  3RKV A;  5JG6 A;  3DDT A;  2LXP C;  4G24 A;  2FFW A;  3ABL E;  3UM1 A;  3QWV A;  4LNG A;  4GPK A;  3Q7A A;  2LGV A;  2R59 A;  4UWF A;  2KAT A;  2MD7 B;  3TWR A;  3CKB A;  3PUQ A;  1OCZ E;  4Z0R A;  3ZNI A;  5H1T A;  4FLH A;  4JHJ A;  4IC3 A;  4I1M A;  4UWL A;  5G04 B;  5KH3 A;  4GZ6 A;  4YAX A;  1KZP A;  1P5Q A;  3ZTG A;  3V2X A;  3T5X A;  4GNF A;  4QQ4 A;  3HXF A;  2P58 C;  5G0F A;  4BTA A;  4QF3 A;  2PL2 A;  4GNG A;  3I3N A;  3VK6 A;  3PE4 A;  1N87 A;  4LRZ A;  5HRY A;  5H1U A;  2ETC A;  2MA5 A;  5FZQ A;  3FTY A;  2CHW A;  2HYE D;  3OAW A;  1S0P A;  3CR3 A;  2K17 A;  1Z3Y A;  2Y1N A;  4DJA A;  3SD5 A;  1YA0 A;  3PUR A;  4B94 A;  4WNE A;  2ILR A;  3T7L A;  2IQC A;  2CFZ A;  4U0Z A;  4BES A;  4I7D A;  4JA7 A;  5EYA F;  4Y6W A;  3CV0 A;  1FBV A;  4PS8 A;  5BPP A;  3T6R A;  2WQ6 A;  1SZ9 A;  1ELK A;  4AP4 A;  2VP7 A;  4BWR A;  2R2L A;  1E8Y A;  4C0E A;  5FB0 A;  2YIN A;  4RG6 A;  3CIA A;  3IEG A;  4GZD A;  1OUV A;  2QIZ A;  4F7A A;  5FQ7 A;  3JXI A;  3PLW A;  3ZPV E;  2A5E A;  2XPZ A;  2WB2 A;  4H9D A;  2Y69 E;  2MUM A;  3G2V A;  4LJN A;  5B1A E;  2ECW A;  3ZYM A;  4CGW A;  2F37 A;  3OXF A;  3UIP C;  3CVU A;  4EEC A;  2LDR A;  1N4R A;  5CBO A;  3APC A;  3HXC A;  2WQ7 A;  4YAB A;  3V30 A;  2DIW A;  4YAD A;  4AM9 A;  5CMY A;  2XCB A;  2DCP A;  2K1J A;  2FO7 A;  2OOE A;  4BY6 A;  2AJA A;  2VPB A;  2A5U A;  4GCN A;  4QFV A;  2LXL A;  5KJN A;  2HR2 A;  5CRV A;  3HYM B;  1H6K A;  2RFM A;  3GYZ A;  2DX8 A;  2JMD A;  5E75 A;  2P9S G;  3TGO A;  1JCQ A;  1LD7 A;  4EZL A;  3O4Z A;  3SI5 A;  2CON A;  3SBS A;  2GGF A;  2YHO A;  4HFG A;  3CK7 A;  1TNZ A;  3KAE A;  4B93 B;  2AVP A;  4KT6 B;  3QWW A;  4X8Q A;  3MHS A;  1S63 A;  3CST A;  2ION A;  4CYM D;  2WMN A;  1G25 A;  4CT0 A;  5G05 B;  3FHE A;  1DVP A;  3KS2 A;  2CSY A;  3F6Q A;  1E4U A;  2UY1 A;  3BQO A;  2H6F A;  4KMO A;  3PEV B;  5ARF A;  3UIN C;  3NAW A;  1O1S A;  4WZ3 B;  4LEU A;  4YBS A;  5KCM A;  2G45 A;  4TUU A;  3NF1 A;  2PQN A;  4HOT A;  4BX9 A;  3I4G A;  4NN2 A;  2VJF A;  2PM7 A;  2X38 A;  3PUK A;  5DKA A;  4OAU C;  2P9K G;  3QKY A;  1EDU A;  2LAH A;  3ULE G;  2XEN A;  1FT2 A;  1OWL A;  5A23 A;  3QNK A;  1U2V G;  3LY9 A;  1JCR A;  2XOC A;  2JAB A;  5FWQ A;  2ECT A;  1X81 A;  2LGG A;  2K16 A;  2AXZ A;  3FFL A;  2JEK A;  1DNP A;  4KVO A;  2LXM A;  4CGV A;  2L9B A;  2ZGG A;  2C0L A;  4GTO A;  2WXH A;  1Y6I A;  3SUB A;  4ZFH A;  3T8M A;  2V8S E;  2JRJ A;  5BNW A;  2R03 A;  1WG0 A;  2EOD A;  1U3D A;  3TWQ A;  1LTX A;  3RSE G;  3Q78 A;  2FUL A;  5D1M B;  5AYW D;  3FUE A;  1GW6 A;  4EBA A;  2WXL A;  3ZW3 A;  4N3B A;  4KBQ A;  5LKZ A;  2B0O E;  5AQ9 A;  4CEM A;  1WEE A;  2XP0 A;  4V3L C;  3Q47 B;  2WQH A;  4U95 D;  3EHN A;  4AYC A;  4JXT A;  1A17 A;  4Z68 A;  1RZ4 A;  1TJC A;  3L11 A;  4HBD A;  3MA5 A;  4APF A;  2Y4T A;  3LRQ A;  4FU3 A;  3HDX A;  2LQ6 A;  4R7L A;  3ASH A;  3SOU A;  4MS6 A;  3KDE C;  4GTM A;  1FVF A;  4DI3 A;  4FLB A;  3MJW A;  4GTR A;  2MNZ A;  2CKL B;  2EIN E;  4HI8 A;  3TJP A;  2R02 A;  3PZ1 A;  4OYS A;  2LXH C;  3CK9 A;  3L9T A;  1Z6U A;  3DXM G;  2L80 A;  2GRQ B;  4A63 B;  4EPZ A;  2LGL A;  5SVX A;  4RVB A;  3DSU A;  3QAR A;  4XKC A;  1N95 A;  2LAU A;  5ENN A;  3DRA A;  4NIK A;  4YDO A;  3NOG D;  2XEV A;  5C13 A;  3CHP A;  4AY6 A;  1TNU A;  4FHJ A;  4BT9 A;  2ECJ A;  2PQR A;  3MX3 A;  2OEW A;  2P9I G;  5BXU A;  1SA5 A;  3CQC B;  3AAA C;  1BU9 A;  4Q6F A;  5LKU A;  4BER A;  2AXV A;  4ZUX U;  3FH8 A;  3UXG A;  3E34 A;  4IRU A;  2MNY A;  2LGK A;  3FDH A;  3UM2 A;  1U6G B;  4OAV B;  4UP5 A;  5EN5 D;  5AQB A;  2WXN A;  3HCU A;  3B7S A;  1YYH A;  2LSV A;  5J08 A;  4LNB A;  3V43 A;  2EGM A;  3GZ2 A;  2GRN B;  3D9J A;  2LNI A;  2QIC A;  2XHE A;  1X4U A;  4DX5 D;  3T9K A;  3RO3 A;  3SO8 A;  1Z6T A;  2AW6 A;  1H2V C;  5D1L B;  3ZFW A;  1TNY A;  3IHV A;  1TNB A;  1X5B A;  5CEA A;  3LQH A;  1N4Q A;  3E33 A;  4HI9 A;  5H9M A;  2IOS A;  4N3C A;  5AEN A;  5KNH D;  3SBT B;  2NSZ A;  1HYJ A;  2FSA A;  1WIM A;  4Y6C A;  2DZO A;  3LVR E;  3CVX A;  5B1B E;  1K1B A;  2X6K A;  3M62 A;  4HNA D;  5IY5 E;  4WA6 A;  3JUE A;  4F3V A;  3ESK A;  4J8D A;  5EKQ D;  2BTD A;  3LJN A;  3O36 A;  2MHK A;  4N4F A;  2LRI C;  3DSX A;  3LYA A;  3AG2 E;  4YDY A;  2F6J A;  3CHQ A;  2M85 A;  2VJE A;  3E30 A;  3SGH A;  5KJM A;  4I6J A;  4B0Z A;  2WXR A;  2XEE A;  2EIK E;  3CVV A;  2J07 A;  2DJA A;  3ZNG A;  3D9I A;  2J4B A;  1HH8 A;  3PZ2 A;  2YYR A;  1F62 A;  1H0A A;  2I2O A;  2KFT A;  4RG9 A;  1WEV A;  3HIZ A;  2FD4 A;  5FZS A;  4K5A B;  4K0R A;  4LK9 A;  2KZT A;  3TWT A;  5FZR A;  4UUC A;  1OWP A;  4JA9 A;  5M72 A;  4ANU A;  1MHQ A;  4J7W A;  4XX5 A;  1Z3X A;  5DIN A;  3I4R B;  5ARG A;  4K5B A;  2X6I A;  4LG6 A;  5TAB A;  2AN6 A;  2XPY A;  2C2L A;  3FTS A;  3SY2 A;  3EDT B;  3CKC A;  3ESL A;  2XOZ A;  3FUF A;  4N3A A;  2ECG A;  1MBM A;  1MM2 A;  1AWC B;  2X6J A;  2PUY A;  5H1V A;  2VPD A;  2QZA A;  2XRZ A;  4F1S A;  1RMD A;  1H6P A;  5G05 C;  2P9P G;  3PHD A;  1BI7 B;  2WVI A;  3MKR A;  3S7F A;  3N9N A;  3LEW A;  5J3X A;  1QNF A;  3UPV A;  2VGE A;  5LKT A;  4ILI A;  4GZ3 A;  3DEP A;  4GTV A;  1QZ2 A;  2CFU A;  3ZXP A;  1BLX B;  5JJ7 A;  2M6M A;  3L16 A;  2V5Q C;  4N2S A;  3U3W A;  3RO2 A;  3CVQ A;  3CHS A;  4FJC A;  1DCQ A;  4I7B A;  1NZN A;  1YCS B;  3KSQ A;  3DSV A;  3DBS A;  2FEZ A;  4WND A;  4XE0 A;  4N5Q A;  1X4J A;  3MDB C;  1FPP A;  3JXJ A;  5ANL A;  3ML8 A;  4CDN A;  1IQR A;  1TN7 A;  1FP0 A;  3ZVZ B;  4GYW A;  3URZ A;  2R05 A;  1UG3 A;  3EIQ C;  3ASO E;  4CA1 A;  3CQG B;  3QOU A;  4YC9 A;  2HE0 A;  3PNL B;  3UT8 A;  2L6B A;  1YMP A;  2F8Y A;  5LX8 A;  2YQ8 A;  3Q15 A;  3N71 A;  3D9L A;  3IXE A;  4P29 A;  4V3I A;  2WM9 A;  3DST A;  2MKE A;  5B75 A;  4G11 A;  2QYU A;  1HO8 A;  4WWN A;  4YDW A;  3CVW A;  5TDR A;  4WUY A;  3LPZ A;  5CCL A;  4H7X A;  2VGX A;  4R2Y A;  1V54 E;  4AP2 A;  5CCM A;  1WES A;  2RD0 A;  3SFX A;  1HXI A;  3MKQ A;  4DX6 D;  4TXQ A;  1QYM A;  1E90 A;  4N2Q A;  3LJU X;  2H0D B;  4I7C A; 
#chains in the Genus database with same CATH homology
 1N0R A;  4QQI A;  4LNU D;  5KNH D;  4U96 D;  3FEH A;  3FJU B;  4BES A;  3LVQ E;  3KDE C;  4O1P A;  2VGE A;  5ENS D;  1MYO A;  1BD8 A;  4ZHB A;  1IKN D;  1S70 B;  5CEC B;  2RR4 A;  3TWV A;  3Q1D A;  5SVI B;  2XZT G;  3ZKJ A;  3EHQ A;  4LSZ E;  4G8L A;  3C5R A;  5AAR A;  3DEP A;  3J5P A;  2DZO A;  1OY3 D;  4HI8 A;  2KXP C;  2NYJ A;  2KBX A;  3EU9 A;  4BET A;  3DEO A;  3LVR E;  4OGC A;  3J5Q B;  4HRM B;  4HB5 A;  5ENO D;  2J8S D;  5AQA A;  3AJI A;  3UI2 A;  1K1B A;  5ENR D;  1D9S A;  4OAU C;  4HNA D;  5CBN A;  4F1P A;  3JUE A;  4O1O A;  1MJ0 A;  3TWW A;  5EYP F;  2CSV A;  3LJN A;  4GPM A;  2KKY A;  4U8Y D;  5JMN D;  4DUI A;  1N11 A;  2XEN A;  4JB8 P;  1OT8 A;  1BLX B;  4A63 B;  5SVX A;  2DVW A;  1BI8 B;  2V5Q C;  3LDY A;  2D8U A;  3NBN B;  3DDT A;  4YDY A;  5SVI A;  1MX4 A;  4K5C A;  2LAU A;  5ITZ F;  2FFW A;  4J8Y A;  5CED B;  2P2C P;  4NIK A;  2ETB A;  4BSZ B;  3JXI A;  5JA4 D;  3NOG D;  5CER B;  2XOC A;  3FM8 C;  3PLW A;  5EIB E;  2JAB A;  2OWA A;  4DX1 A;  2A5E A;  1AP7 A;  2XEE A;  1DCQ A;  2DZN A;  1YCS B;  5SVY A;  1MX2 A;  4H9D A;  2QC9 A;  2FO1 E;  2Y1L E;  4C48 B;  2CRW A;  4O60 A;  3TWU A;  3ZNG A;  5AQ7 A;  5ENQ D;  2DJA A;  5BXU A;  2RFA A;  4RLY A;  3D9H A;  2F37 A;  2ZGG A;  2V4H C;  3HG0 D;  4N5Q A;  2ETA A;  3TWR A;  4ATZ D;  5AAO A;  2L7P A;  4O62 A;  3AAA C;  1BU9 A;  3MDB C;  3JXJ A;  4Z0R A;  4HLL A;  4BER A;  4ZFH A;  3V79 K;  2EXU A;  4BEP A;  3W9F A;  3E2D A;  3SUB A;  1WDY A;  4TUM A;  3UXG A;  5CBO A;  2PNN A;  5EIL A;  1G3N B;  2BKG A;  3B95 A;  3V30 A;  1K1A A;  3TWS A;  2FD4 A;  3V2X A;  5HS0 A;  1WG0 A;  1SW6 A;  1K3Z D;  1A5E A;  4K5A B;  4OAV B;  1TR4 A;  3KEA A;  2P57 A;  4QQ4 A;  5K3Q A;  3TWT A;  2AJA A;  2HE0 A;  5EN5 D;  3B7B A;  5AQB A;  3TWQ A;  3NOC D;  3ZUV B;  3O47 A;  4UUC A;  4QFV A;  1N0Q A;  5KNG A;  2L6B A;  1YMP A;  1NFI E;  2F8Y A;  1IXV A;  1YYH A;  3ZU7 B;  5ENT D;  4CZ2 D;  2BKK B;  2JUN A;  3IXE A;  1DC2 A;  4J7W A;  2RFM A;  4GMR A;  2MKE A;  3Q9N C;  2EGM A;  4HRN A;  2YVR A;  2B0O E;  4HQD A;  4YDW A;  3V2O A;  2Y0B G;  4K5B A;  4LG6 A;  5AN8 A;  5AQ9 A;  5HRY A;  4DX7 D;  5KWD A;  2F8X K;  4OGE A;  1SVX A;  2ETC A;  4Z0O A;  5HKP A;  2CON A;  2XP0 A;  4U8V D;  2XOZ A;  4DX5 D;  3T9K A;  5FIO A;  4F6R D;  5BXO A;  5ENP D;  4U95 D;  1IHB A;  4B93 B;  3Q9U C;  1UOH A;  4G8K A;  2M13 A;  2XEH A;  3SO8 A;  4HRL A;  2IQJ A;  3UTM A;  3TWX A;  3T8K A;  4Z68 A;  2QYJ A;  5EYL A;  1AWC B;  3V31 A;  2ZGD A;  4DX2 A;  4DX6 D;  3W9G A;  4HBD A;  4CYM D;  3M7K A;  5FIN A;  2CRR A;  2XZD G;  3HRA A;  1MX6 A;  1QYM A;  5CEA A;  3DWD A;  2E61 A;  3LJU X;  5EID A;  5D66 A;  4DRX E;  2KKX A;  3EHR A;  1BI7 B;  4HI9 A;  2XOY A;  2MYO A;  2JM3 A;  3F6Q A;  2YRE A;  5KBA A;  2DWZ A;  3H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...