2MD7B

Nmr structure of human sp140 phd finger trans conformer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'GAMGMRNLDECEVCRDGGELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear body protein SP140
publication title Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2md7B00
5B78A 1WEWA 4I7DA 1WESA 2MNZA 3ZPV1 1ZBDB 2ECIA 2M85A 3LQIA 4ZUXU 1X4IA 2OXQC 3ZVYA 1VFYA 1Z60A 2ECGA 2NAAA 4WA6A 5D1KB 2F6JA 5LKZA 2YHNA 2CKLA 3ZPVE 4A4BA 3HCUA 4LK9A 4GNDA 4GNEA 2H0DA 5C11A 1HYIA 4L7XA 3ZTGA 3ZNIA 4V3LC 5C13A 1WEQA 3T6RA 2VPEA 4YATA 5FB0A 3N9PA 2YYRA 1FP0A 2ECWA 3IHPA 2CSYA 4FJCA 3HCTA 4PPEA 3ZYQA 2VJFA 3N9QA 1FBVA 3PURA 2I50A 4WZ2A 1WE9A 2CKLB 3U5OA 2YU4A 4R8PK 4B86C 2H0DB 3U5NA 2C2LA 5LKXA 5B8DA 3O37A 2MT5A 2KE1A 4IC3A 2Y1MA 1WILA 4ZQLA 1Z2QA 1BORA 1F62A 2LV9A 1RMDA 5TBNA 5D1MB 1V87A 3V43A 1WEOA 2VJFB 5G05B 5KH9A 5H9MA 2ECNA 5H1VA 3KV6A 4UI9B 5TDRA 4YAXA 1DVPA 2LXPC 3NG2A 2IDAA 1XWHA 2KREA 2YREA 2JRJA 2KFTA 2KWNA 5H1UA 4PTBA 3PHDA 2ECJA 4GNFA 2BAYA 4W4UA 1MM3A 4YADA 2E6RA 1WGMA 3N9LA 4X3GA 3O7AA 4AUQB 2YSJA 4S3OB 2L80A 3LQHA 2QJ0A 4QF2A 4AVXA 2MA5A 5TABA 1K2FA 3O35A 3KQIA 2QIZA 2FSAA 2G45A 4FK5A 3I2DA 2ECVA 4R2YA 4LADB 2CT2A 4A0CD 2K4DA 2MNYA 4YBSA 3M99A 4YABA 3HCSA 2JMIA 2LQ6A 2KU3A 4IC2A 2LGKA 2EA6A 1U6GB 4WZ0A 5D1LB 3SOUA 3KNVA 2L43A 4LKAA 4O64A 3O33A 5G04B 3L1ZB 3O34A 2VJEA 3QZVA 2F42A 3LQJA 3VK6A 2VPDA 2JMJA 4AYCA 5DKAA 5JG6A 4BBQA 2VP7A 2E6SA 4WZ3B 2K1JA 2YQMA 2EODA 2M3HA 2YURA 3SOXA 3KV5A 1WENA 1CHCA 5AIUA 2KIZA 3O36A 4CA1A 4N4FA 2MD7B 3C6WA 5B79A 5B76A 3GL6A 4F52B 1WEUA 2YT5A 3M63A 4C9ZA 1LDJB 1IYMA 3LRQA 4FIPA 2CSZA 1JM7A 2DX8A 3N9MA 2XEUA 2Y1NA 5FEYA 2YHOA 1MM2A 2LRIC 5H1TA 1JOCA 3ZVZB 3U5PA 3N9OA 2VJEB 2YQLA 2F6NA 4AYCB 4S3OC 3L11A 2UZGA 2RI7A 2YSMA 4UP0A 5J3XA 4TKPB 4I7CA 2KGGA 2K17A 2YW8A 1WFKA 3HTKC 2L0BA 4L58A 2FUIA 1WEVA 3GV4A 1WEEA 2G6QA 4Q6FA 2KWOA 2MUMA 2MD8C 2KGIA 4GNGA 1X4UA 2QICA 2KWJA 1LDKC 4NN2A 3RPGC 1JM7B 4UP5A 1N87A 2FUUA 2KWKA 4R7EA 2KYUA 5EYAF 5I3LA 2Y43A 4LLBA 2LDRA 1T1HA 2LN0A 4ZDTA 2LGLA 4LJNA 5KH3A 4YBTA 4YBMA 2LGGA 1VD4A 3FL2A 3RPGB 2ZETC 3C5KA 2L5UA 3M62A 1E4UA 1WIMA 3EB5A 2L75A 2KR4A 1G25A 4B7YC 2JMDA 5LKTA 2C2VS 5AITA 5KH7A 5G0FA 2VNFA 3DQVR 3MHSA 1HYJA 2K16A 2VPGA 2PUYA 4A4CA 2LGVA 2M1RA 4P5OB 3L1XA 2LXHC 4MVTA 4V3KC 3T7LA 4CCGX 4XI1A 2MIQA 2HYED 5TRBA 2VPBA 4BHWA 2M6MA 4QF3A 2AN6A 3DPLR 2D8SA 5B77A 2YUCA 5FB1A 3O70A 5LKUA 2MA6A 2RSDA 3EB6A 4N3WA 4A49A 5LCWB 2XB1A 5DINA 4AP4A 3N9NA 1WEMA 1VYXA 4GB0A 5FERA 1Z6UA 3RTRB 4MSXA 2EGPA 1X4JA 4YC9A 2PNXA 3ASLA 4I7BA 1WEPA 3SOWA 5B75A 2G43A 3SHBA 2HDPA 3PUQA 4FO9A 3U5MA 3MHHA 2ECTA 5TDWA
chains in the Genus database with same CATH superfamily
5B78A 3FAOA 1WEWA 4I7DA 1WESA 2MNZA 3ZPV1 1ZBDB 2ECIA 2M85A 3LQIA 4ZUXU 1X4IA 2OXQC 4H9DA 3ZVYA 3LDYA 1VFYA 1Z60A 2ECGA 3FANA 2M13A 2NAAA 4WA6A 5D1KB 5SVYA 2F6JA 5LKZA 2KKYA 2YHNA 3SUBA 2CKLA 3ZPVE 4A4BA 3HCUA 4LK9A 4GNDA 4GNEA 2H0DA 5C11A 1HYIA 4L7XA 3ZTGA 2KKXA 3ZNIA 4V3LC 5C13A 1WEQA 3T6RA 2VPEA 4YATA 5FB0A 3N9PA 2CRRA 3JUEA 2YYRA 1FP0A 2ECWA 3IHPA 2CSYA 4FJCA 3HCTA 4PPEA 3ZYQA 2VJFA 3N9QA 1FBVA 3PURA 2XP0A 2I50A 4WZ2A 1WE9A 2CKLB 5SVXA 3U5OA 2FFWA 2YU4A 4R8PK 2EGMA 2DSMA 4B86C 2H0DB 3DWDA 3U5NA 5SVIA 2C2LA 5LKXA 5B8DA 3O37A 3LVRE 2MT5A 2MKEA 2KE1A 4IC3A 2Y1MA 1WILA 4ZQLA 1Z2QA 1BORA 1F62A 2LV9A 4OGEA 1RMDA 5TBNA 5D1MB 1V87A 4QQ4A 3V43A 1WEOA 3T9KA 2VJFB 5G05B 5KH9A 5H9MA 2ECNA 5H1VA 2CSVA 4O62A 3KV6A 4UI9B 5TDRA 4YAXA 1DVPA 2LXPC 3NG2A 2IDAA 1XWHA 2KREA 2YREA 2JRJA 2KFTA 2KWNA 5H1UA 5SVIB 4PTBA 3PHDA 2ECJA 4Z0RA 2B0OE 4GNFA 2BAYA 4W4UA 1MM3A 4YADA 2E6RA 1DCQA 1WGMA 3N9LA 4X3GA 3O7AA 4AUQB 2YSJA 4OGCA 4S3OB 2L80A 3LQHA 2QJ0A 2FD4A 4QF2A 4AVXA 2MA5A 2EXUA 5TABA 1K2FA 3O35A 3KQIA 4F1PA 2QIZA 2FSAA 2G45A 4FK5A 3I2DA 2ECVA 4R2YA 4LADB 2LAUA 2CT2A 4A0CD 2K4DA 2MNYA 4YBSA 3M99A 4YABA 3HCSA 2JMIA 2LQ6A 2KU3A 4IC2A 2LGKA 2EA6A 1U6GB 4WZ0A 5D1LB 3SOUA 3KNVA 2L43A 4LKAA 4O64A 3O33A 5G04B 3L1ZB 3O34A 2VJEA 2E61A 3QZVA 2F42A 3LQJA 3VK6A 2VPDA 2JMJA 4AYCA 5DKAA 5JG6A 3LJUX 4BBQA 2VP7A 2E6SA 4WZ3B 2K1JA 2YQMA 2EODA 2M3HA 2YURA 3SOXA 3KV5A 1WENA 1CHCA 5AIUA 2KIZA 3O36A 4CA1A 4N4FA 2MD7B 2XOYA 3C6WA 5B79A 5B76A 3GL6A 4F52B 1WEUA 2P57A 2YT5A 3M63A 3E2DA 4C9ZA 1LDJB 1IYMA 3FEHA 2IQJA 3LRQA 4FIPA 2CSZA 1JM7A 3H7HA 2DX8A 3N9MA 2XEUA 2Y1NA 5FEYA 2YHOA 1MM2A 3PLWA 2LRIC 5H1TA 1JOCA 3ZVZB 3U5PA 3N9OA 2VJEB 2YQLA 2F6NA 3Q1DA 4AYCB 4S3OC 3L11A 2UZGA 2RI7A 2YSMA 4UP0A 3MDBC 5J3XA 4TKPB 4I7CA 2KGGA 3DDTA 2K17A 2YW8A 3LVQE 1WFKA 3HTKC 2L0BA 4L58A 2FUIA 1WEVA 3GV4A 1WEEA 2G6QA 4Q6FA 2KWOA 1MBMA 2MUMA 2MD8C 2KGIA 4GNGA 1X4UA 2QICA 2JUNA 2KWJA 1LDKC 4NN2A 3RPGC 1JM7B 4UP5A 1N87A 2FUUA 2KWKA 4R7EA 2DJAA 2KYUA 3O47A 5EYAF 5I3LA 2Y43A 4LLBA 2LDRA 1T1HA 2LN0A 4ZDTA 2LGLA 4LJNA 3M7KA 5KH3A 4YBTA 4YBMA 3KDEC 2LGGA 1VD4A 3FL2A 3RPGB 2XOZA 2ZETC 3C5KA 2L5UA 2CONA 2L7PA 3M62A 1E4UA 1WIMA 3EB5A 2L75A 2KR4A 1G25A 4B7YC 2JMDA 5LKTA 2C2VS 5AITA 5KH7A 2D8UA 5G0FA 2VNFA 3DQVR 5K3QA 3MHSA 2CRWA 1HYJA 2K16A 2VPGA 2PUYA 4A4CA 2LGVA 2M1RA 4P5OB 3L1XA 2LXHC 4MVTA 4V3KC 3T7LA 4CCGX 4XI1A 2MIQA 2HYED 2XOCA 5TRBA 4Z0OA 2VPBA 4BHWA 2M6MA 4QF3A 2AN6A 3DPLR 2D8SA 3FM8C 5B77A 2YUCA 5FB1A 3O70A 5LKUA 2MA6A 2RSDA 3EB6A 4N3WA 4A49A 5LCWB 2XB1A 2RR4A 5DINA 4AP4A 3N9NA 1WEMA 1VYXA 4GB0A 5FERA 1Z6UA 3RTRB 4MSXA 2EGPA 1X4JA 4YC9A 2PNXA 3ASLA 2OWAA 4I7BA 1WEPA 3SOWA 3FJUB 2YVRA 2G43A 3SHBA 2HDPA 5B75A 3PUQA 4FO9A 3U5MA 3MHHA 2JM3A 2ECTA 5TDWA
chains in the Genus database with same CATH topology
5B78A 1WEWA 4I7DA 1WESA 2MNZA 3ZPV1 1ZBDB 2ECIA 2M85A 3LQIA 4ZUXU 1X4IA 2OXQC 3ZVYA 1VFYA 1Z60A 2ECGA 2NAAA 4WA6A 5D1KB 2F6JA 5LKZA 2YHNA 2CKLA 3ZPVE 4A4BA 3HCUA 4LK9A 4GNDA 4GNEA 2H0DA 5C11A 1HYIA 4L7XA 3ZTGA 3ZNIA 4V3LC 5C13A 1WEQA 3T6RA 2VPEA 4YATA 5FB0A 3N9PA 2YYRA 1FP0A 2ECWA 3IHPA 2CSYA 4FJCA 3HCTA 4PPEA 3ZYQA 2VJFA 3N9QA 1FBVA 3PURA 2I50A 4WZ2A 1WE9A 2CKLB 3U5OA 2YU4A 4R8PK 4B86C 2H0DB 3U5NA 2C2LA 5LKXA 5B8DA 3O37A 2MT5A 2KE1A 4IC3A 2Y1MA 1WILA 4ZQLA 1Z2QA 1BORA 1F62A 2LV9A 1RMDA 5TBNA 5D1MB 1V87A 3V43A 1WEOA 2VJFB 5G05B 5KH9A 5H9MA 2ECNA 5H1VA 3KV6A 4UI9B 5TDRA 4YAXA 1DVPA 2LXPC 3NG2A 2IDAA 1XWHA 2KREA 2YREA 2JRJA 2KFTA 2KWNA 5H1UA 4PTBA 3PHDA 2ECJA 4GNFA 2BAYA 4W4UA 1MM3A 4YADA 2E6RA 1WGMA 3N9LA 4X3GA 3O7AA 4AUQB 2YSJA 4S3OB 2L80A 3LQHA 2QJ0A 4QF2A 4AVXA 2MA5A 5TABA 1K2FA 3O35A 3KQIA 2QIZA 2FSAA 2G45A 4FK5A 3I2DA 2ECVA 4R2YA 4LADB 2CT2A 4A0CD 2K4DA 2MNYA 4YBSA 3M99A 4YABA 3HCSA 2JMIA 2LQ6A 2KU3A 4IC2A 2LGKA 2EA6A 1U6GB 4WZ0A 5D1LB 3SOUA 3KNVA 2L43A 4LKAA 4O64A 3O33A 5G04B 3L1ZB 3O34A 2VJEA 3QZVA 2F42A 3LQJA 3VK6A 2VPDA 2JMJA 4AYCA 5DKAA 5JG6A 4BBQA 2VP7A 2E6SA 4WZ3B 2K1JA 2YQMA 2EODA 2M3HA 2YURA 3SOXA 3KV5A 1WENA 1CHCA 5AIUA 2KIZA 3O36A 4CA1A 4N4FA 2MD7B 3C6WA 5B79A 5B76A 3GL6A 4F52B 1WEUA 2YT5A 3M63A 4C9ZA 1LDJB 1IYMA 3LRQA 4FIPA 2CSZA 1JM7A 2DX8A 3N9MA 2XEUA 2Y1NA 5FEYA 2YHOA 1MM2A 2LRIC 5H1TA 1JOCA 3ZVZB 3U5PA 3N9OA 2VJEB 2YQLA 2F6NA 4AYCB 4S3OC 3L11A 2UZGA 2RI7A 2YSMA 4UP0A 5J3XA 4TKPB 4I7CA 2KGGA 2K17A 2YW8A 1WFKA 3HTKC 2L0BA 4L58A 2FUIA 1WEVA 3GV4A 1WEEA 2G6QA 4Q6FA 2KWOA 2MUMA 2MD8C 2KGIA 4GNGA 1X4UA 2QICA 2KWJA 1LDKC 4NN2A 3RPGC 1JM7B 4UP5A 1N87A 2FUUA 2KWKA 4R7EA 2KYUA 5EYAF 5I3LA 2Y43A 4LLBA 2LDRA 1T1HA 2LN0A 4ZDTA 2LGLA 4LJNA 5KH3A 4YBTA 4YBMA 2LGGA 1VD4A 3FL2A 3RPGB 2ZETC 3C5KA 2L5UA 3M62A 1E4UA 1WIMA 3EB5A 2L75A 2KR4A 1G25A 4B7YC 2JMDA 5LKTA 2C2VS 5AITA 5KH7A 5G0FA 2VNFA 3DQVR 3MHSA 1HYJA 2K16A 2VPGA 2PUYA 4A4CA 2LGVA 2M1RA 4P5OB 3L1XA 2LXHC 4MVTA 4V3KC 3T7LA 4CCGX 4XI1A 2MIQA 2HYED 5TRBA 2VPBA 4BHWA 2M6MA 4QF3A 2AN6A 3DPLR 2D8SA 5B77A 2YUCA 5FB1A 3O70A 5LKUA 2MA6A 2RSDA 3EB6A 4N3WA 4A49A 5LCWB 2XB1A 5DINA 4AP4A 3N9NA 1WEMA 1VYXA 4GB0A 5FERA 1Z6UA 3RTRB 4MSXA 2EGPA 1X4JA 4YC9A 2PNXA 3ASLA 4I7BA 1WEPA 3SOWA 5B75A 2G43A 3SHBA 2HDPA 3PUQA 4FO9A 3U5MA 3MHHA 2ECTA 5TDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B78 A;  1WEW A;  4I7D A;  1WES A;  2MNZ A;  3ZPV 1;  1ZBD B;  2ECI A;  2M85 A;  3LQI A;  4ZUX U;  1X4I A;  2OXQ C;  3ZVY A;  1VFY A;  1Z60 A;  2ECG A;  2NAA A;  4WA6 A;  5D1K B;  2F6J A;  5LKZ A;  2YHN A;  2CKL A;  3ZPV E;  4A4B A;  3HCU A;  4LK9 A;  4GND A;  4GNE A;  2H0D A;  5C11 A;  1HYI A;  4L7X A;  3ZTG A;  3ZNI A;  4V3L C;  5C13 A;  1WEQ A;  3T6R A;  2VPE A;  4YAT A;  5FB0 A;  3N9P A;  2YYR A;  1FP0 A;  2ECW A;  3IHP A;  2CSY A;  4FJC A;  3HCT A;  4PPE A;  3ZYQ A;  2VJF A;  3N9Q A;  1FBV A;  3PUR A;  2I50 A;  4WZ2 A;  1WE9 A;  2CKL B;  3U5O A;  2YU4 A;  4R8P K;  4B86 C;  2H0D B;  3U5N A;  2C2L A;  5LKX A;  5B8D A;  3O37 A;  2MT5 A;  2KE1 A;  4IC3 A;  2Y1M A;  1WIL A;  4ZQL A;  1Z2Q A;  1BOR A;  1F62 A;  2LV9 A;  1RMD A;  5TBN A;  5D1M B;  1V87 A;  3V43 A;  1WEO A;  2VJF B;  5G05 B;  5KH9 A;  5H9M A;  2ECN A;  5H1V A;  3KV6 A;  4UI9 B;  5TDR A;  4YAX A;  1DVP A;  2LXP C;  3NG2 A;  2IDA A;  1XWH A;  2KRE A;  2YRE A;  2JRJ A;  2KFT A;  2KWN A;  5H1U A;  4PTB A;  3PHD A;  2ECJ A;  4GNF A;  2BAY A;  4W4U A;  1MM3 A;  4YAD A;  2E6R A;  1WGM A;  3N9L A;  4X3G A;  3O7A A;  4AUQ B;  2YSJ A;  4S3O B;  2L80 A;  3LQH A;  2QJ0 A;  4QF2 A;  4AVX A;  2MA5 A;  5TAB A;  1K2F A;  3O35 A;  3KQI A;  2QIZ A;  2FSA A;  2G45 A;  4FK5 A;  3I2D A;  2ECV A;  4R2Y A;  4LAD B;  2CT2 A;  4A0C D;  2K4D A;  2MNY A;  4YBS A;  3M99 A;  4YAB A;  3HCS A;  2JMI A;  2LQ6 A;  2KU3 A;  4IC2 A;  2LGK A;  2EA6 A;  1U6G B;  4WZ0 A;  5D1L B;  3SOU A;  3KNV A;  2L43 A;  4LKA A;  4O64 A;  3O33 A;  5G04 B;  3L1Z B;  3O34 A;  2VJE A;  3QZV A;  2F42 A;  3LQJ A;  3VK6 A;  2VPD A;  2JMJ A;  4AYC A;  5DKA A;  5JG6 A;  4BBQ A;  2VP7 A;  2E6S A;  4WZ3 B;  2K1J A;  2YQM A;  2EOD A;  2M3H A;  2YUR A;  3SOX A;  3KV5 A;  1WEN A;  1CHC A;  5AIU A;  2KIZ A;  3O36 A;  4CA1 A;  4N4F A;  2MD7 B;  3C6W A;  5B79 A;  5B76 A;  3GL6 A;  4F52 B;  1WEU A;  2YT5 A;  3M63 A;  4C9Z A;  1LDJ B;  1IYM A;  3LRQ A;  4FIP A;  2CSZ A;  1JM7 A;  2DX8 A;  3N9M A;  2XEU A;  2Y1N A;  5FEY A;  2YHO A;  1MM2 A;  2LRI C;  5H1T A;  1JOC A;  3ZVZ B;  3U5P A;  3N9O A;  2VJE B;  2YQL A;  2F6N A;  4AYC B;  4S3O C;  3L11 A;  2UZG A;  2RI7 A;  2YSM A;  4UP0 A;  5J3X A;  4TKP B;  4I7C A;  2KGG A;  2K17 A;  2YW8 A;  1WFK A;  3HTK C;  2L0B A;  4L58 A;  2FUI A;  1WEV A;  3GV4 A;  1WEE A;  2G6Q A;  4Q6F A;  2KWO A;  2MUM A;  2MD8 C;  2KGI A;  4GNG A;  1X4U A;  2QIC A;  2KWJ A;  1LDK C;  4NN2 A;  3RPG C;  1JM7 B;  4UP5 A;  1N87 A;  2FUU A;  2KWK A;  4R7E A;  2KYU A;  5EYA F;  5I3L A;  2Y43 A;  4LLB A;  2LDR A;  1T1H A;  2LN0 A;  4ZDT A;  2LGL A;  4LJN A;  5KH3 A;  4YBT A;  4YBM A;  2LGG A;  1VD4 A;  3FL2 A;  3RPG B;  2ZET C;  3C5K A;  2L5U A;  3M62 A;  1E4U A;  1WIM A;  3EB5 A;  2L75 A;  2KR4 A;  1G25 A;  4B7Y C;  2JMD A;  5LKT A;  2C2V S;  5AIT A;  5KH7 A;  5G0F A;  2VNF A;  3DQV R;  3MHS A;  1HYJ A;  2K16 A;  2VPG A;  2PUY A;  4A4C A;  2LGV A;  2M1R A;  4P5O B;  3L1X A;  2LXH C;  4MVT A;  4V3K C;  3T7L A;  4CCG X;  4XI1 A;  2MIQ A;  2HYE D;  5TRB A;  2VPB A;  4BHW A;  2M6M A;  4QF3 A;  2AN6 A;  3DPL R;  2D8S A;  5B77 A;  2YUC A;  5FB1 A;  3O70 A;  5LKU A;  2MA6 A;  2RSD A;  3EB6 A;  4N3W A;  4A49 A;  5LCW B;  2XB1 A;  5DIN A;  4AP4 A;  3N9N A;  1WEM A;  1VYX A;  4GB0 A;  5FER A;  1Z6U A;  3RTR B;  4MSX A;  2EGP A;  1X4J A;  4YC9 A;  2PNX A;  3ASL A;  4I7B A;  1WEP A;  3SOW A;  5B75 A;  2G43 A;  3SHB A;  2HDP A;  3PUQ A;  4FO9 A;  3U5M A;  3MHH A;  2ECT A;  5TDW A; 
#chains in the Genus database with same CATH topology
 5B78 A;  3FAO A;  1WEW A;  4I7D A;  1WES A;  2MNZ A;  3ZPV 1;  1ZBD B;  2ECI A;  2M85 A;  3LQI A;  4ZUX U;  1X4I A;  2OXQ C;  4H9D A;  3ZVY A;  3LDY A;  1VFY A;  1Z60 A;  2ECG A;  3FAN A;  2M13 A;  2NAA A;  4WA6 A;  5D1K B;  5SVY A;  2F6J A;  5LKZ A;  2KKY A;  2YHN A;  3SUB A;  2CKL A;  3ZPV E;  4A4B A;  3HCU A;  4LK9 A;  4GND A;  4GNE A;  2H0D A;  5C11 A;  1HYI A;  4L7X A;  3ZTG A;  2KKX A;  3ZNI A;  4V3L C;  5C13 A;  1WEQ A;  3T6R A;  2VPE A;  4YAT A;  5FB0 A;  3N9P A;  2CRR A;  3JUE A;  2YYR A;  1FP0 A;  2ECW A;  3IHP A;  2CSY A;  4FJC A;  3HCT A;  4PPE A;  3ZYQ A;  2VJF A;  3N9Q A;  1FBV A;  3PUR A;  2XP0 A;  2I50 A;  4WZ2 A;  1WE9 A;  2CKL B;  5SVX A;  3U5O A;  2FFW A;  2YU4 A;  4R8P K;  2EGM A;  2DSM A;  4B86 C;  2H0D B;  3DWD A;  3U5N A;  5SVI A;  2C2L A;  5LKX A;  5B8D A;  3O37 A;  3LVR E;  2MT5 A;  2MKE A;  2KE1 A;  4IC3 A;  2Y1M A;  1WIL A;  4ZQL A;  1Z2Q A;  1BOR A;  1F62 A;  2LV9 A;  4OGE A;  1RMD A;  5TBN A;  5D1M B;  1V87 A;  4QQ4 A;  3V43 A;  1WEO A;  3T9K A;  2VJF B;  5G05 B;  5KH9 A;  5H9M A;  2ECN A;  5H1V A;  2CSV A;  4O62 A;  3KV6 A;  4UI9 B;  5TDR A;  4YAX A;  1DVP A;  2LXP C;  3NG2 A;  2IDA A;  1XWH A;  2KRE A;  2YRE A;  2JRJ A;  2KFT A;  2KWN A;  5H1U A;  5SVI B;  4PTB A;  3PHD A;  2ECJ A;  4Z0R A;  2B0O E;  4GNF A;  2BAY A;  4W4U A;  1MM3 A;  4YAD A;  2E6R A;  1DCQ A;  1WGM A;  3N9L A;  4X3G A;  3O7A A;  4AUQ B;  2YSJ A;  4OGC A;  4S3O B;  2L80 A;  3LQH A;  2QJ0 A;  2FD4 A;  4QF2 A;  4AVX A;  2MA5 A;  2EXU A;  5TAB A;  1K2F A;  3O35 A;  3KQI A;  4F1P A;  2QIZ A;  2FSA A;  2G45 A;  4FK5 A;  3I2D A;  2ECV A;  4R2Y A;  4LAD B;  2LAU A;  2CT2 A;  4A0C D;  2K4D A;  2MNY A;  4YBS A;  3M99 A;  4YAB A;  3HCS A;  2JMI A;  2LQ6 A;  2KU3 A;  4IC2 A;  2LGK A;  2EA6 A;  1U6G B;  4WZ0 A;  5D1L B;  3SOU A;  3KNV A;  2L43 A;  4LKA A;  4O64 A;  3O33 A;  5G04 B;  3L1Z B;  3O34 A;  2VJE A;  2E61 A;  3QZV A;  2F42 A;  3LQJ A;  3VK6 A;  2VPD A;  2JMJ A;  4AYC A;  5DKA A;  5JG6 A;  3LJU X;  4BBQ A;  2VP7 A;  2E6S A;  4WZ3 B;  2K1J A;  2YQM A;  2EOD A;  2M3H A;  2YUR A;  3SOX A;  3KV5 A;  1WEN A;  1CHC A;  5AIU A;  2KIZ A;  3O36 A;  4CA1 A;  4N4F A;  2MD7 B;  2XOY A;  3C6W A;  5B79 A;  5B76 A;  3GL6 A;  4F52 B;  1WEU A;  2P57 A;  2YT5 A;  3M63 A;  3E2D A;  4C9Z A;  1LDJ B;  1IYM A;  3FEH A;  2IQJ A;  3LRQ A;  4FIP A;  2CSZ A;  1JM7 A;  3H7H A;  2DX8 A;  3N9M A;  2XEU A;  2Y1N A;  5FEY A;  2YHO A;  1MM2 A;  3PLW A;  2LRI C;  5H1T A;  1JOC A;  3ZVZ B;  3U5P A;  3N9O A;  2VJE B;  2YQL A;  2F6N A;  3Q1D A;  4AYC B;  4S3O C;  3L11 A;  2UZG A;  2RI7 A;  2YSM A;  4UP0 A;  3MDB C;  5J3X A;  4TKP B;  4I7C A;  2KGG A;  3DDT A;  2K17 A;  2YW8 A;  3LVQ E;  1WFK A;  3HTK C;  2L0B A;  4L58 A;  2FUI A;  1WEV A;  3GV4 A;  1WEE A;  2G6Q A;  4Q6F A;  2KWO A;  1MBM A;  2MUM A;  2MD8 C;  2KGI A;  4GNG A;  1X4U A;  2QIC A;  2JUN A;  2KWJ A;  1LDK C;  4NN2 A;  3RPG C;  1JM7 B;  4UP5 A;  1N87 A;  2FUU A;  2KWK A;  4R7E A;  2DJA A;  2KYU A;  3O47 A;  5EYA F;  5I3L A;  2Y43 A;  4LLB A;  2LDR A;  1T1H A;  2LN0 A;  4ZDT A;  2LGL A;  4LJN A;  3M7K A;  5KH3 A;  4YBT A;  4YBM A;  3KDE C;  2LGG A;  1VD4 A;  3FL2 A;  3RPG B;  2XOZ A;  2ZET C;  3C5K A;  2L5U A;  2CON A;  2L7P A;  3M62 A;  1E4U A;  1WIM A;  3EB5 A;  2L75 A;  2KR4 A;  1G25 A;  4B7Y C;  2JMD A;  5LKT A;  2C2V S;  5AIT A;  5KH7 A;  2D8U A;  5G0F A;  2VNF A;  3DQV R;  5K3Q A;  3MHS A;  2CRW A;  1HYJ A;  2K16 A;  2VPG A;  2PUY A;  4A4C A;  2LGV A;  2M1R A;  4P5O B;  3L1X A;  2LXH C;  4MVT A;  4V3K C;  3T7L A;  4CCG X;  4XI1 A;  2MIQ A;  2HYE D;  2XOC A;  5TRB A;  4Z0O A;  2VPB A;  4BHW A;  2M6M A;  4QF3 A;  2AN6 A;  3DPL R;  2D8S A;  3FM8 C;  5B77 A;  2YUC A;  5FB1 A;  3O70 A;  5LKU A;  2MA6 A;  2RSD A;  3EB6 A;  4N3W A;  4A49 A;  5LCW B;  2XB1 A;  2RR4 A;  5DIN A;  4AP4 A;  3N9N A;  1WEM A;  1VYX A;  4GB0 A;  5FER A;  1Z6U A;  3RTR B;  4MSX A;  2EGP A;  1X4J A;  4YC9 A;  2PNX A;  3ASL A;  2OWA A;  4I7B A;  1WEP A;  3SOW A;  3FJU B;  2YVR A;  2G43 A;  3SHB A;  2HDP A;  5B75 A;  3PUQ A;  4FO9 A;  3U5M A;  3MHH A;  2JM3 A;  2ECT A;  5TDW A; 
#chains in the Genus database with same CATH homology
 5B78 A;  1WEW A;  4I7D A;  1WES A;  2MNZ A;  3ZPV 1;  1ZBD B;  2ECI A;  2M85 A;  3LQI A;  4ZUX U;  1X4I A;  2OXQ C;  3ZVY A;  1VFY A;  1Z60 A;  2ECG A;  2NAA A;  4WA6 A;  5D1K B;  2F6J A;  5LKZ A;  2YHN A;  2CKL A;  3ZPV E;  4A4B A;  3HCU A;  4LK9 A;  4GND A;  4GNE A;  2H0D A;  5C11 A;  1HYI A;  4L7X A;  3ZTG A;  3ZNI A;  4V3L C;  5C13 A;  1WEQ A;  3T6R A;  2VPE A;  4YAT A;  5FB0 A;  3N9P A;  2YYR A;  1FP0 A;  2ECW A;  3IHP A;  2CSY A;  4FJC A;  3HCT A;  4PPE A;  3ZYQ A;  2VJF A;  3N9Q A;  1FBV A;  3PUR A;  2I50 A;  4WZ2 A;  1WE9 A;  2CKL B;  3U5O A;  2YU4 A;  4R8P K;  4B86 C;  2H0D B;  3U5N A;  2C2L A;  5LKX A;  5B8D A;  3O37 A;  2MT5 A;  2KE1 A;  4IC3 A;  2Y1M A;  1WIL A;  4ZQL A;  1Z2Q A;  1BOR A;  1F62 A;  2LV9 A;  1RMD A;  5TBN A;  5D1M B;  1V87 A;  3V43 A;  1WEO A;  2VJF B;  5G05 B;  5KH9 A;  5H9M A;  2ECN A;  5H1V A;  3KV6 A;  4UI9 B;  5TDR A;  4YAX A;  1DVP A;  2LXP C;  3NG2 A;  2IDA A;  1XWH A;  2KRE A;  2YRE A;  2JRJ A;  2KFT A;  2KWN A;  5H1U A;  4PTB A;  3PHD A;  2ECJ A;  4GNF A;  2BAY A;  4W4U A;  1MM3 A;  4YAD A;  2E6R A;  1WGM A;  3N9L A;  4X3G A;  3O7A A;  4AUQ B;  2YSJ A;  4S3O B;  2L80 A;  3LQH A;  2QJ0 A;  4QF2 A;  4AVX A;  2MA5 A;  5TAB A;  1K2F A;  3O35 A;  3KQI A;  2QIZ A;  2FSA A;  2G45 A;  4FK5 A;  3I2D A;  2ECV A;  4R2Y A;  4LAD B;  2CT2 A;  4A0C D;  2K4D A;  2MNY A;  4YBS A;  3M99 A;  4YAB A;  3HCS A;  2JMI A;  2LQ6 A;  2KU3 A;  4IC2 A;  2LGK A;  2EA6 A;  1U6G B;  4WZ0 A;  5D1L B;  3SOU A;  3KNV A;  2L43 A;  4LKA A;  4O64 A;  3O33 A;  5G04 B;  3L1Z B;  3O34 A;  2VJE A;  3QZV A;  2F42 A;  3LQJ A;  3VK6 A;  2VPD A;  2JMJ A;  4AYC A;  5DKA A;  5JG6 A;  4BBQ A;  2VP7 A;  2E6S A;  4WZ3 B;  2K1J A;  2YQM A;  2EOD A;  2M3H A;  2YUR A;  3SOX A;  3KV5 A;  1WEN A;  1CHC A;  5AIU A;  2KIZ A;  3O36 A;  4CA1 A;  4N4F A;  2MD7 B;  3C6W A;  5B79 A;  5B76 A;  3GL6 A;  4F52 B;  1WEU A;  2YT5 A;  3M63 A;  4C9Z A;  1LDJ B;  1IYM A;  3LRQ A;  4FIP A;  2CSZ A;  1JM7 A;  2DX8 A;  3N9M A;  2XEU A;  2Y1N A;  5FEY A;  2YHO A;  1MM2 A;  2LRI C;  5H1T A;  1JOC A;  3ZVZ B;  3U5P A;  3N9O A;  2VJE B;  2YQL A;  2F6N A;  4AYC B;  4S3O C;  3L11 A;  2UZG A;  2RI7 A;  2YSM A;  4UP0 A;  5J3X A;  4TKP B;  4I7C A;  2KGG A;  2K17 A;  2YW8 A;  1WFK A;  3HTK C;  2L0B A;  4L58 A;  2FUI A;  1WEV A;  3GV4 A;  1WEE A;  2G6Q A;  4Q6F A;  2KWO A;  2MUM A;  2MD8 C;  2KGI A;  4GNG A;  1X4U A;  2QIC A;  2KWJ A;  1LDK C;  4NN2 A;  3RPG C;  1JM7 B;  4UP5 A;  1N87 A;  2FUU A;  2KWK A;  4R7E A;  2KYU A;  5EYA F;  5I3L A;  2Y43 A;  4LLB A;  2LDR A;  1T1H A;  2LN0 A;  4ZDT A;  2LGL A;  4LJN A;  5KH3 A;  4YBT A;  4YBM A;  2LGG A;  1VD4 A;  3FL2 A;  3RPG B;  2ZET C;  3C5K A;  2L5U A;  3M62 A;  1E4U A;  1WIM A;  3EB5 A;  2L75 A;  2KR4 A;  1G25 A;  4B7Y C;  2JMD A;  5LKT A;  2C2V S;  5AIT A;  5KH7 A;  5G0F A;  2VNF A;  3DQV R;  3MHS A;  1HYJ A;  2K16 A;  2VPG A;  2PUY A;  4A4C A;  2LGV A;  2M1R A;  4P5O B;  3L1X A;  2LXH C;  4MVT A;  4V3K C;  3T7L A;  4CCG X;  4XI1 A;  2MIQ A;  2HYE D;  5TRB A;  2VPB A;  4BHW A;  2M6M A;  4QF3 A;  2AN6 A;  3DPL R;  2D8S A;  5B77 A;  2YUC A;  5FB1 A;  3O70 A;  5LKU A;  2MA6 A;  2RSD A;  3EB6 A;  4N3W A;  4A49 A;  5LCW B;  2XB1 A;  5DIN A;  4AP4 A;  3N9N A;  1WEM A;  1VYX A;  4GB0 A;  5FER A;  1Z6U A;  3RTR B;  4MSX A;  2EGP A;  1X4J A;  4YC9 A;  2PNX A;  3ASL A;  4I7B A;  1WEP A;  3SOW A;  5B75 A;  2G43 A;  3SHB A;  2HDP A;  3PUQ A;  4FO9 A;  3U5M A;  3MHH A;  2ECT A;  5TDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...