2KU3A

Solution structure of brd1 phd1 finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
62
structure length
62
Chain Sequence
QSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 1
publication title Solution structure of BRD1 PHD1 finger
rcsb
source organism Homo sapiens
total genus 6
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13831 PHD_2 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ku3A00
1JM7A 1VYXA 3ZTGA 3L11A 4L7XA 4FO9A 4TKPB 2YSJA 4V3KC 4AYCB 3GV4A 1WE9A 2MA5A 5TABA 3N9PA 5G0FA 2KGIA 2YHNA 2KR4A 4QF2A 4QF3A 2L75A 2ECJA 1Z6UA 2LXPC 2ECVA 5B76A 5DKAA 2HDPA 4XI1A 4YAXA 2YU4A 3LRQA 1WEPA 2OXQC 2MD8C 2MNZA 1WIMA 2G45A 4F52B 2K1JA 3O7AA 2F6NA 3IHPA 2KWJA 5EYAF 4BHWA 2MT5A 4YBTA 1DVPA 3L1ZB 3M62A 2PNXA 5TBNA 1Z60A 4R2YA 3MHSA 2FSAA 2K4DA 3SOUA 4S3OC 2QICA 4YBSA 3U5NA 2KWOA 4B86C 3N9LA 2YW8A 4WZ2A 5D1LB 4PTBA 5FERA 4R7EA 3LQJA 3ZPV1 2KYUA 3T6RA 2VPGA 4CCGX 1WEMA 5TRBA 2AN6A 3O37A 4I7DA 4WZ0A 2H0DA 5B78A 4ZQLA 4GNEA 1WEOA 2VNFA 4YC9A 4B7YC 1HYJA 4MSXA 5B8DA 2VPDA 4A0CD 2Y1MA 2ECIA 2NAAA 2L43A 4WZ3B 2DX8A 2CKLB 1FBVA 3FL2A 2LGLA 2BAYA 4YATA 2CT2A 4IC2A 5B79A 2VJFA 1BORA 4C9ZA 3GL6A 2VPEA 5AIUA 4V3LC 2JMIA 2E6RA 2IDAA 4LKAA 3O36A 3ZPVE 5H1TA 2YYRA 2YREA 2C2VS 1Z2QA 2ECTA 1CHCA 4AYCA 5LKZA 5FEYA 2G43A 4UP5A 1HYIA 4LLBA 4I7BA 4BBQA 3O33A 5FB1A 5LCWB 3V43A 3KV6A 3M63A 3O35A 4AP4A 2HYED 2XEUA 2YSMA 4IC3A 1LDJB 5LKTA 2EA6A 2EGPA 2PUYA 5D1KB 3N9MA 2E6SA 3PHDA 2ECWA 4NN2A 4YABA 5C11A 1WESA 3RPGC 1WEUA 4AUQB 1V87A 2LN0A 2XB1A 4FIPA 3DQVR 2L0BA 1K2FA 4A4CA 3SOXA 3LQHA 3N9NA 4UP0A 5H1VA 2LXHC 3T7LA 1WEVA 1RMDA 4AVXA 3EB6A 4LJNA 5AITA 4S3OB 4YADA 1VFYA 1VD4A 2KIZA 2FUUA 1WEWA 2M6MA 2JRJA 4LK9A 2LV9A 3O70A 2ECNA 3C6WA 2VP7A 2KGGA 2L80A 2KREA 4WA6A 2YQLA 2MD7B 4UI9B 2K16A 3ZYQA 4FJCA 1WGMA 1WEQA 4W4UA 5KH3A 4GNFA 5C13A 2CSYA 3HTKC 2F6JA 4R8PK 4YBMA 2Y1NA 5JG6A 2KE1A 2CKLA 2YQMA 5TDWA 3VK6A 4P5OB 2YUCA 2M1RA 2Y43A 2MUMA 2QIZA 4A4BA 2VJEB 2RSDA 2MA6A 3HCUA 2LGKA 1LDKC 4Q6FA 1FP0A 3MHHA 2I50A 2C2LA 3U5MA 4GNGA 2LRIC 5H1UA 5J3XA 2ECGA 2LGVA 4ZDTA 2F42A 2MIQA 1JM7B 5FB0A 3ZVZB 5LKXA 5KH9A 3HCSA 3SHBA 1WEEA 4LADB 5LKUA 4GNDA 3KV5A 1MM2A 1N87A 5KH7A 2YHOA 1WENA 3NG2A 1IYMA 3RPGB 2RI7A 1WFKA 2KWKA 1G25A 1F62A 2K17A 5H9MA 3M99A 3PUQA 2QJ0A 4A49A 3LQIA 2FUIA 1X4IA 2KWNA 3N9QA 2M85A 5DINA 2LGGA 4CA1A 2CSZA 5G05B 1E4UA 4ZUXU 1XWHA 1ZBDB 2L5UA 4PPEA 3QZVA 5B77A 2M3HA 3EB5A 2KU3A 2JMDA 2ZETC 5D1MB 2MNYA 3DPLR 2G6QA 2KFTA 3ZVYA 2EODA 5TDRA 3KNVA 4FK5A 4MVTA 1MM3A 3RTRB 3ASLA 5B75A 2D8SA 3I2DA 3HCTA 3L1XA 4GB0A 1T1HA 4O64A 1X4UA 5G04B 4I7CA 2H0DB 2VPBA 3U5OA 1JOCA 1WILA 3O34A 2UZGA 5I3LA 1X4JA 2LQ6A 4N4FA 1U6GB 2VJEA 3SOWA 2LDRA 3PURA 3N9OA 2JMJA 2VJFB 2YT5A 4X3GA 2YURA 3KQIA 4N3WA 4L58A 3U5PA 3ZNIA 3C5KA
chains in the Genus database with same CATH superfamily
3KDEC 1JM7A 1VYXA 3ZTGA 3L11A 3DDTA 4L7XA 4FO9A 4TKPB 2YSJA 4V3KC 4AYCB 3GV4A 1WE9A 2MA5A 5TABA 3N9PA 5G0FA 2KGIA 2YHNA 5SVXA 2KR4A 4QF2A 2E61A 4QF3A 2L75A 2YVRA 2FD4A 2ECJA 1Z6UA 2LXPC 2ECVA 5B76A 5DKAA 2HDPA 4XI1A 4YAXA 2YU4A 3LRQA 1WEPA 2OXQC 2MD8C 2MNZA 1WIMA 2G45A 4F52B 2K1JA 3O7AA 2F6NA 3IHPA 2KWJA 5EYAF 4BHWA 2MT5A 4YBTA 1DVPA 3L1ZB 3M62A 2PNXA 5TBNA 2KKXA 1Z60A 4R2YA 4O62A 3MHSA 2FSAA 2DSMA 2K4DA 3SOUA 4S3OC 4F1PA 2QICA 4YBSA 3U5NA 2KWOA 4B86C 3N9LA 2YW8A 3H7HA 4WZ2A 2XOZA 5D1LB 4PTBA 2CONA 3FAOA 5FERA 4R7EA 3LQJA 3ZPV1 2L7PA 2KYUA 3T6RA 2VPGA 4CCGX 1WEMA 5TRBA 2AN6A 3O37A 4I7DA 4WZ0A 2H0DA 5B78A 4ZQLA 4GNEA 1WEOA 3M7KA 3LVQE 2VNFA 3DWDA 4YC9A 4B7YC 1HYJA 4MSXA 2EXUA 5B8DA 2VPDA 4A0CD 2Y1MA 2ECIA 2LAUA 2NAAA 2L43A 4WZ3B 2DX8A 2CKLB 1FBVA 2CRWA 3FL2A 2LGLA 2BAYA 4YATA 2CT2A 2B0OE 4IC2A 5B79A 2XOCA 2VJFA 1BORA 4C9ZA 3GL6A 5SVIB 2VPEA 3FM8C 5AIUA 4V3LC 2JMIA 2E6RA 2IDAA 4LKAA 3O36A 3ZPVE 5H1TA 2YYRA 2YREA 2C2VS 1Z2QA 2ECTA 1CHCA 3FANA 4AYCA 2D8UA 5LKZA 5FEYA 2G43A 4UP5A 1HYIA 4LLBA 4I7BA 4BBQA 3O33A 5FB1A 5LCWB 3V43A 3KV6A 3M63A 3O35A 4AP4A 2HYED 2XEUA 2YSMA 4IC3A 1LDJB 2M13A 5LKTA 2EA6A 2EGPA 2PUYA 3Q1DA 5D1KB 3N9MA 4OGEA 2E6SA 3PHDA 2ECWA 4NN2A 4YABA 5C11A 1WESA 3RPGC 1WEUA 4AUQB 1V87A 2LN0A 2XB1A 4FIPA 3DQVR 2L0BA 1K2FA 4A4CA 3SOXA 3LQHA 3N9NA 3O47A 4UP0A 5H1VA 3LJUX 2LXHC 3T7LA 1WEVA 1RMDA 4AVXA 3FJUB 3EB6A 4LJNA 2CRRA 5AITA 4S3OB 4Z0RA 4YADA 1VFYA 1VD4A 2KIZA 2FUUA 3E2DA 1WEWA 2M6MA 2JRJA 4LK9A 2LV9A 3O70A 2ECNA 2RR4A 3C6WA 2VP7A 2KGGA 3PLWA 2L80A 2EGMA 2KREA 2FFWA 4WA6A 2YQLA 2MD7B 4UI9B 3SUBA 2K16A 3ZYQA 2P57A 4FJCA 1WGMA 1WEQA 4W4UA 5KH3A 4GNFA 5C13A 3T9KA 2CSYA 2JUNA 3HTKC 2F6JA 4R8PK 4YBMA 2Y1NA 2OWAA 5JG6A 2KE1A 2CKLA 2YQMA 5TDWA 3VK6A 4P5OB 2YUCA 2M1RA 2CSVA 2XP0A 2Y43A 2JM3A 5SVIA 2MUMA 2QIZA 4A4BA 2VJEB 2DJAA 2RSDA 2MA6A 3HCUA 2LGKA 1LDKC 2KKYA 4Q6FA 1FP0A 3MHHA 2I50A 2C2LA 3U5MA 4GNGA 2LRIC 5H1UA 5J3XA 2ECGA 2LGVA 4ZDTA 2F42A 2MIQA 1JM7B 5FB0A 3ZVZB 5LKXA 5KH9A 3HCSA 3SHBA 1WEEA 4LADB 2MKEA 5LKUA 4GNDA 4H9DA 3KV5A 1MM2A 4OGCA 1N87A 5KH7A 2YHOA 1WENA 3NG2A 1IYMA 3RPGB 2RI7A 3LDYA 1WFKA 2KWKA 1G25A 1F62A 2K17A 5H9MA 3M99A 3PUQA 2QJ0A 4A49A 3LQIA 2FUIA 1X4IA 2KWNA 3N9QA 2M85A 5DINA 2LGGA 4CA1A 2CSZA 5G05B 1E4UA 4ZUXU 1XWHA 4QQ4A 1ZBDB 2L5UA 1DCQA 3MDBC 4PPEA 3QZVA 5B77A 5SVYA 2M3HA 3EB5A 2KU3A 3JUEA 2JMDA 2ZETC 5D1MB 2MNYA 3DPLR 2G6QA 2KFTA 3ZVYA 4Z0OA 2EODA 5TDRA 3KNVA 4FK5A 2IQJA 4MVTA 1MM3A 3RTRB 3ASLA 5B75A 2D8SA 3I2DA 3HCTA 3L1XA 3LVRE 4GB0A 1T1HA 4O64A 2XOYA 1X4UA 3FEHA 5G04B 4I7CA 2H0DB 2VPBA 3U5OA 1JOCA 1WILA 3O34A 2UZGA 5I3LA 1X4JA 2LQ6A 4N4FA 1U6GB 1MBMA 2VJEA 3SOWA 2LDRA 3PURA 3N9OA 2JMJA 2VJFB 2YT5A 5K3QA 4X3GA 2YURA 3KQIA 4N3WA 4L58A 3U5PA 3ZNIA 3C5KA
chains in the Genus database with same CATH topology
1JM7A 1VYXA 3ZTGA 3L11A 4L7XA 4FO9A 4TKPB 2YSJA 4V3KC 4AYCB 3GV4A 1WE9A 2MA5A 5TABA 3N9PA 5G0FA 2KGIA 2YHNA 2KR4A 4QF2A 4QF3A 2L75A 2ECJA 1Z6UA 2LXPC 2ECVA 5B76A 5DKAA 2HDPA 4XI1A 4YAXA 2YU4A 3LRQA 1WEPA 2OXQC 2MD8C 2MNZA 1WIMA 2G45A 4F52B 2K1JA 3O7AA 2F6NA 3IHPA 2KWJA 5EYAF 4BHWA 2MT5A 4YBTA 1DVPA 3L1ZB 3M62A 2PNXA 5TBNA 1Z60A 4R2YA 3MHSA 2FSAA 2K4DA 3SOUA 4S3OC 2QICA 4YBSA 3U5NA 2KWOA 4B86C 3N9LA 2YW8A 4WZ2A 5D1LB 4PTBA 5FERA 4R7EA 3LQJA 3ZPV1 2KYUA 3T6RA 2VPGA 4CCGX 1WEMA 5TRBA 2AN6A 3O37A 4I7DA 4WZ0A 2H0DA 5B78A 4ZQLA 4GNEA 1WEOA 2VNFA 4YC9A 4B7YC 1HYJA 4MSXA 5B8DA 2VPDA 4A0CD 2Y1MA 2ECIA 2NAAA 2L43A 4WZ3B 2DX8A 2CKLB 1FBVA 3FL2A 2LGLA 2BAYA 4YATA 2CT2A 4IC2A 5B79A 2VJFA 1BORA 4C9ZA 3GL6A 2VPEA 5AIUA 4V3LC 2JMIA 2E6RA 2IDAA 4LKAA 3O36A 3ZPVE 5H1TA 2YYRA 2YREA 2C2VS 1Z2QA 2ECTA 1CHCA 4AYCA 5LKZA 5FEYA 2G43A 4UP5A 1HYIA 4LLBA 4I7BA 4BBQA 3O33A 5FB1A 5LCWB 3V43A 3KV6A 3M63A 3O35A 4AP4A 2HYED 2XEUA 2YSMA 4IC3A 1LDJB 5LKTA 2EA6A 2EGPA 2PUYA 5D1KB 3N9MA 2E6SA 3PHDA 2ECWA 4NN2A 4YABA 5C11A 1WESA 3RPGC 1WEUA 4AUQB 1V87A 2LN0A 2XB1A 4FIPA 3DQVR 2L0BA 1K2FA 4A4CA 3SOXA 3LQHA 3N9NA 4UP0A 5H1VA 2LXHC 3T7LA 1WEVA 1RMDA 4AVXA 3EB6A 4LJNA 5AITA 4S3OB 4YADA 1VFYA 1VD4A 2KIZA 2FUUA 1WEWA 2M6MA 2JRJA 4LK9A 2LV9A 3O70A 2ECNA 3C6WA 2VP7A 2KGGA 2L80A 2KREA 4WA6A 2YQLA 2MD7B 4UI9B 2K16A 3ZYQA 4FJCA 1WGMA 1WEQA 4W4UA 5KH3A 4GNFA 5C13A 2CSYA 3HTKC 2F6JA 4R8PK 4YBMA 2Y1NA 5JG6A 2KE1A 2CKLA 2YQMA 5TDWA 3VK6A 4P5OB 2YUCA 2M1RA 2Y43A 2MUMA 2QIZA 4A4BA 2VJEB 2RSDA 2MA6A 3HCUA 2LGKA 1LDKC 4Q6FA 1FP0A 3MHHA 2I50A 2C2LA 3U5MA 4GNGA 2LRIC 5H1UA 5J3XA 2ECGA 2LGVA 4ZDTA 2F42A 2MIQA 1JM7B 5FB0A 3ZVZB 5LKXA 5KH9A 3HCSA 3SHBA 1WEEA 4LADB 5LKUA 4GNDA 3KV5A 1MM2A 1N87A 5KH7A 2YHOA 1WENA 3NG2A 1IYMA 3RPGB 2RI7A 1WFKA 2KWKA 1G25A 1F62A 2K17A 5H9MA 3M99A 3PUQA 2QJ0A 4A49A 3LQIA 2FUIA 1X4IA 2KWNA 3N9QA 2M85A 5DINA 2LGGA 4CA1A 2CSZA 5G05B 1E4UA 4ZUXU 1XWHA 1ZBDB 2L5UA 4PPEA 3QZVA 5B77A 2M3HA 3EB5A 2KU3A 2JMDA 2ZETC 5D1MB 2MNYA 3DPLR 2G6QA 2KFTA 3ZVYA 2EODA 5TDRA 3KNVA 4FK5A 4MVTA 1MM3A 3RTRB 3ASLA 5B75A 2D8SA 3I2DA 3HCTA 3L1XA 4GB0A 1T1HA 4O64A 1X4UA 5G04B 4I7CA 2H0DB 2VPBA 3U5OA 1JOCA 1WILA 3O34A 2UZGA 5I3LA 1X4JA 2LQ6A 4N4FA 1U6GB 2VJEA 3SOWA 2LDRA 3PURA 3N9OA 2JMJA 2VJFB 2YT5A 4X3GA 2YURA 3KQIA 4N3WA 4L58A 3U5PA 3ZNIA 3C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM7 A;  1VYX A;  3ZTG A;  3L11 A;  4L7X A;  4FO9 A;  4TKP B;  2YSJ A;  4V3K C;  4AYC B;  3GV4 A;  1WE9 A;  2MA5 A;  5TAB A;  3N9P A;  5G0F A;  2KGI A;  2YHN A;  2KR4 A;  4QF2 A;  4QF3 A;  2L75 A;  2ECJ A;  1Z6U A;  2LXP C;  2ECV A;  5B76 A;  5DKA A;  2HDP A;  4XI1 A;  4YAX A;  2YU4 A;  3LRQ A;  1WEP A;  2OXQ C;  2MD8 C;  2MNZ A;  1WIM A;  2G45 A;  4F52 B;  2K1J A;  3O7A A;  2F6N A;  3IHP A;  2KWJ A;  5EYA F;  4BHW A;  2MT5 A;  4YBT A;  1DVP A;  3L1Z B;  3M62 A;  2PNX A;  5TBN A;  1Z60 A;  4R2Y A;  3MHS A;  2FSA A;  2K4D A;  3SOU A;  4S3O C;  2QIC A;  4YBS A;  3U5N A;  2KWO A;  4B86 C;  3N9L A;  2YW8 A;  4WZ2 A;  5D1L B;  4PTB A;  5FER A;  4R7E A;  3LQJ A;  3ZPV 1;  2KYU A;  3T6R A;  2VPG A;  4CCG X;  1WEM A;  5TRB A;  2AN6 A;  3O37 A;  4I7D A;  4WZ0 A;  2H0D A;  5B78 A;  4ZQL A;  4GNE A;  1WEO A;  2VNF A;  4YC9 A;  4B7Y C;  1HYJ A;  4MSX A;  5B8D A;  2VPD A;  4A0C D;  2Y1M A;  2ECI A;  2NAA A;  2L43 A;  4WZ3 B;  2DX8 A;  2CKL B;  1FBV A;  3FL2 A;  2LGL A;  2BAY A;  4YAT A;  2CT2 A;  4IC2 A;  5B79 A;  2VJF A;  1BOR A;  4C9Z A;  3GL6 A;  2VPE A;  5AIU A;  4V3L C;  2JMI A;  2E6R A;  2IDA A;  4LKA A;  3O36 A;  3ZPV E;  5H1T A;  2YYR A;  2YRE A;  2C2V S;  1Z2Q A;  2ECT A;  1CHC A;  4AYC A;  5LKZ A;  5FEY A;  2G43 A;  4UP5 A;  1HYI A;  4LLB A;  4I7B A;  4BBQ A;  3O33 A;  5FB1 A;  5LCW B;  3V43 A;  3KV6 A;  3M63 A;  3O35 A;  4AP4 A;  2HYE D;  2XEU A;  2YSM A;  4IC3 A;  1LDJ B;  5LKT A;  2EA6 A;  2EGP A;  2PUY A;  5D1K B;  3N9M A;  2E6S A;  3PHD A;  2ECW A;  4NN2 A;  4YAB A;  5C11 A;  1WES A;  3RPG C;  1WEU A;  4AUQ B;  1V87 A;  2LN0 A;  2XB1 A;  4FIP A;  3DQV R;  2L0B A;  1K2F A;  4A4C A;  3SOX A;  3LQH A;  3N9N A;  4UP0 A;  5H1V A;  2LXH C;  3T7L A;  1WEV A;  1RMD A;  4AVX A;  3EB6 A;  4LJN A;  5AIT A;  4S3O B;  4YAD A;  1VFY A;  1VD4 A;  2KIZ A;  2FUU A;  1WEW A;  2M6M A;  2JRJ A;  4LK9 A;  2LV9 A;  3O70 A;  2ECN A;  3C6W A;  2VP7 A;  2KGG A;  2L80 A;  2KRE A;  4WA6 A;  2YQL A;  2MD7 B;  4UI9 B;  2K16 A;  3ZYQ A;  4FJC A;  1WGM A;  1WEQ A;  4W4U A;  5KH3 A;  4GNF A;  5C13 A;  2CSY A;  3HTK C;  2F6J A;  4R8P K;  4YBM A;  2Y1N A;  5JG6 A;  2KE1 A;  2CKL A;  2YQM A;  5TDW A;  3VK6 A;  4P5O B;  2YUC A;  2M1R A;  2Y43 A;  2MUM A;  2QIZ A;  4A4B A;  2VJE B;  2RSD A;  2MA6 A;  3HCU A;  2LGK A;  1LDK C;  4Q6F A;  1FP0 A;  3MHH A;  2I50 A;  2C2L A;  3U5M A;  4GNG A;  2LRI C;  5H1U A;  5J3X A;  2ECG A;  2LGV A;  4ZDT A;  2F42 A;  2MIQ A;  1JM7 B;  5FB0 A;  3ZVZ B;  5LKX A;  5KH9 A;  3HCS A;  3SHB A;  1WEE A;  4LAD B;  5LKU A;  4GND A;  3KV5 A;  1MM2 A;  1N87 A;  5KH7 A;  2YHO A;  1WEN A;  3NG2 A;  1IYM A;  3RPG B;  2RI7 A;  1WFK A;  2KWK A;  1G25 A;  1F62 A;  2K17 A;  5H9M A;  3M99 A;  3PUQ A;  2QJ0 A;  4A49 A;  3LQI A;  2FUI A;  1X4I A;  2KWN A;  3N9Q A;  2M85 A;  5DIN A;  2LGG A;  4CA1 A;  2CSZ A;  5G05 B;  1E4U A;  4ZUX U;  1XWH A;  1ZBD B;  2L5U A;  4PPE A;  3QZV A;  5B77 A;  2M3H A;  3EB5 A;  2KU3 A;  2JMD A;  2ZET C;  5D1M B;  2MNY A;  3DPL R;  2G6Q A;  2KFT A;  3ZVY A;  2EOD A;  5TDR A;  3KNV A;  4FK5 A;  4MVT A;  1MM3 A;  3RTR B;  3ASL A;  5B75 A;  2D8S A;  3I2D A;  3HCT A;  3L1X A;  4GB0 A;  1T1H A;  4O64 A;  1X4U A;  5G04 B;  4I7C A;  2H0D B;  2VPB A;  3U5O A;  1JOC A;  1WIL A;  3O34 A;  2UZG A;  5I3L A;  1X4J A;  2LQ6 A;  4N4F A;  1U6G B;  2VJE A;  3SOW A;  2LDR A;  3PUR A;  3N9O A;  2JMJ A;  2VJF B;  2YT5 A;  4X3G A;  2YUR A;  3KQI A;  4N3W A;  4L58 A;  3U5P A;  3ZNI A;  3C5K A; 
#chains in the Genus database with same CATH topology
 3KDE C;  1JM7 A;  1VYX A;  3ZTG A;  3L11 A;  3DDT A;  4L7X A;  4FO9 A;  4TKP B;  2YSJ A;  4V3K C;  4AYC B;  3GV4 A;  1WE9 A;  2MA5 A;  5TAB A;  3N9P A;  5G0F A;  2KGI A;  2YHN A;  5SVX A;  2KR4 A;  4QF2 A;  2E61 A;  4QF3 A;  2L75 A;  2YVR A;  2FD4 A;  2ECJ A;  1Z6U A;  2LXP C;  2ECV A;  5B76 A;  5DKA A;  2HDP A;  4XI1 A;  4YAX A;  2YU4 A;  3LRQ A;  1WEP A;  2OXQ C;  2MD8 C;  2MNZ A;  1WIM A;  2G45 A;  4F52 B;  2K1J A;  3O7A A;  2F6N A;  3IHP A;  2KWJ A;  5EYA F;  4BHW A;  2MT5 A;  4YBT A;  1DVP A;  3L1Z B;  3M62 A;  2PNX A;  5TBN A;  2KKX A;  1Z60 A;  4R2Y A;  4O62 A;  3MHS A;  2FSA A;  2DSM A;  2K4D A;  3SOU A;  4S3O C;  4F1P A;  2QIC A;  4YBS A;  3U5N A;  2KWO A;  4B86 C;  3N9L A;  2YW8 A;  3H7H A;  4WZ2 A;  2XOZ A;  5D1L B;  4PTB A;  2CON A;  3FAO A;  5FER A;  4R7E A;  3LQJ A;  3ZPV 1;  2L7P A;  2KYU A;  3T6R A;  2VPG A;  4CCG X;  1WEM A;  5TRB A;  2AN6 A;  3O37 A;  4I7D A;  4WZ0 A;  2H0D A;  5B78 A;  4ZQL A;  4GNE A;  1WEO A;  3M7K A;  3LVQ E;  2VNF A;  3DWD A;  4YC9 A;  4B7Y C;  1HYJ A;  4MSX A;  2EXU A;  5B8D A;  2VPD A;  4A0C D;  2Y1M A;  2ECI A;  2LAU A;  2NAA A;  2L43 A;  4WZ3 B;  2DX8 A;  2CKL B;  1FBV A;  2CRW A;  3FL2 A;  2LGL A;  2BAY A;  4YAT A;  2CT2 A;  2B0O E;  4IC2 A;  5B79 A;  2XOC A;  2VJF A;  1BOR A;  4C9Z A;  3GL6 A;  5SVI B;  2VPE A;  3FM8 C;  5AIU A;  4V3L C;  2JMI A;  2E6R A;  2IDA A;  4LKA A;  3O36 A;  3ZPV E;  5H1T A;  2YYR A;  2YRE A;  2C2V S;  1Z2Q A;  2ECT A;  1CHC A;  3FAN A;  4AYC A;  2D8U A;  5LKZ A;  5FEY A;  2G43 A;  4UP5 A;  1HYI A;  4LLB A;  4I7B A;  4BBQ A;  3O33 A;  5FB1 A;  5LCW B;  3V43 A;  3KV6 A;  3M63 A;  3O35 A;  4AP4 A;  2HYE D;  2XEU A;  2YSM A;  4IC3 A;  1LDJ B;  2M13 A;  5LKT A;  2EA6 A;  2EGP A;  2PUY A;  3Q1D A;  5D1K B;  3N9M A;  4OGE A;  2E6S A;  3PHD A;  2ECW A;  4NN2 A;  4YAB A;  5C11 A;  1WES A;  3RPG C;  1WEU A;  4AUQ B;  1V87 A;  2LN0 A;  2XB1 A;  4FIP A;  3DQV R;  2L0B A;  1K2F A;  4A4C A;  3SOX A;  3LQH A;  3N9N A;  3O47 A;  4UP0 A;  5H1V A;  3LJU X;  2LXH C;  3T7L A;  1WEV A;  1RMD A;  4AVX A;  3FJU B;  3EB6 A;  4LJN A;  2CRR A;  5AIT A;  4S3O B;  4Z0R A;  4YAD A;  1VFY A;  1VD4 A;  2KIZ A;  2FUU A;  3E2D A;  1WEW A;  2M6M A;  2JRJ A;  4LK9 A;  2LV9 A;  3O70 A;  2ECN A;  2RR4 A;  3C6W A;  2VP7 A;  2KGG A;  3PLW A;  2L80 A;  2EGM A;  2KRE A;  2FFW A;  4WA6 A;  2YQL A;  2MD7 B;  4UI9 B;  3SUB A;  2K16 A;  3ZYQ A;  2P57 A;  4FJC A;  1WGM A;  1WEQ A;  4W4U A;  5KH3 A;  4GNF A;  5C13 A;  3T9K A;  2CSY A;  2JUN A;  3HTK C;  2F6J A;  4R8P K;  4YBM A;  2Y1N A;  2OWA A;  5JG6 A;  2KE1 A;  2CKL A;  2YQM A;  5TDW A;  3VK6 A;  4P5O B;  2YUC A;  2M1R A;  2CSV A;  2XP0 A;  2Y43 A;  2JM3 A;  5SVI A;  2MUM A;  2QIZ A;  4A4B A;  2VJE B;  2DJA A;  2RSD A;  2MA6 A;  3HCU A;  2LGK A;  1LDK C;  2KKY A;  4Q6F A;  1FP0 A;  3MHH A;  2I50 A;  2C2L A;  3U5M A;  4GNG A;  2LRI C;  5H1U A;  5J3X A;  2ECG A;  2LGV A;  4ZDT A;  2F42 A;  2MIQ A;  1JM7 B;  5FB0 A;  3ZVZ B;  5LKX A;  5KH9 A;  3HCS A;  3SHB A;  1WEE A;  4LAD B;  2MKE A;  5LKU A;  4GND A;  4H9D A;  3KV5 A;  1MM2 A;  4OGC A;  1N87 A;  5KH7 A;  2YHO A;  1WEN A;  3NG2 A;  1IYM A;  3RPG B;  2RI7 A;  3LDY A;  1WFK A;  2KWK A;  1G25 A;  1F62 A;  2K17 A;  5H9M A;  3M99 A;  3PUQ A;  2QJ0 A;  4A49 A;  3LQI A;  2FUI A;  1X4I A;  2KWN A;  3N9Q A;  2M85 A;  5DIN A;  2LGG A;  4CA1 A;  2CSZ A;  5G05 B;  1E4U A;  4ZUX U;  1XWH A;  4QQ4 A;  1ZBD B;  2L5U A;  1DCQ A;  3MDB C;  4PPE A;  3QZV A;  5B77 A;  5SVY A;  2M3H A;  3EB5 A;  2KU3 A;  3JUE A;  2JMD A;  2ZET C;  5D1M B;  2MNY A;  3DPL R;  2G6Q A;  2KFT A;  3ZVY A;  4Z0O A;  2EOD A;  5TDR A;  3KNV A;  4FK5 A;  2IQJ A;  4MVT A;  1MM3 A;  3RTR B;  3ASL A;  5B75 A;  2D8S A;  3I2D A;  3HCT A;  3L1X A;  3LVR E;  4GB0 A;  1T1H A;  4O64 A;  2XOY A;  1X4U A;  3FEH A;  5G04 B;  4I7C A;  2H0D B;  2VPB A;  3U5O A;  1JOC A;  1WIL A;  3O34 A;  2UZG A;  5I3L A;  1X4J A;  2LQ6 A;  4N4F A;  1U6G B;  1MBM A;  2VJE A;  3SOW A;  2LDR A;  3PUR A;  3N9O A;  2JMJ A;  2VJF B;  2YT5 A;  5K3Q A;  4X3G A;  2YUR A;  3KQI A;  4N3W A;  4L58 A;  3U5P A;  3ZNI A;  3C5K A; 
#chains in the Genus database with same CATH homology
 1JM7 A;  1VYX A;  3ZTG A;  3L11 A;  4L7X A;  4FO9 A;  4TKP B;  2YSJ A;  4V3K C;  4AYC B;  3GV4 A;  1WE9 A;  2MA5 A;  5TAB A;  3N9P A;  5G0F A;  2KGI A;  2YHN A;  2KR4 A;  4QF2 A;  4QF3 A;  2L75 A;  2ECJ A;  1Z6U A;  2LXP C;  2ECV A;  5B76 A;  5DKA A;  2HDP A;  4XI1 A;  4YAX A;  2YU4 A;  3LRQ A;  1WEP A;  2OXQ C;  2MD8 C;  2MNZ A;  1WIM A;  2G45 A;  4F52 B;  2K1J A;  3O7A A;  2F6N A;  3IHP A;  2KWJ A;  5EYA F;  4BHW A;  2MT5 A;  4YBT A;  1DVP A;  3L1Z B;  3M62 A;  2PNX A;  5TBN A;  1Z60 A;  4R2Y A;  3MHS A;  2FSA A;  2K4D A;  3SOU A;  4S3O C;  2QIC A;  4YBS A;  3U5N A;  2KWO A;  4B86 C;  3N9L A;  2YW8 A;  4WZ2 A;  5D1L B;  4PTB A;  5FER A;  4R7E A;  3LQJ A;  3ZPV 1;  2KYU A;  3T6R A;  2VPG A;  4CCG X;  1WEM A;  5TRB A;  2AN6 A;  3O37 A;  4I7D A;  4WZ0 A;  2H0D A;  5B78 A;  4ZQL A;  4GNE A;  1WEO A;  2VNF A;  4YC9 A;  4B7Y C;  1HYJ A;  4MSX A;  5B8D A;  2VPD A;  4A0C D;  2Y1M A;  2ECI A;  2NAA A;  2L43 A;  4WZ3 B;  2DX8 A;  2CKL B;  1FBV A;  3FL2 A;  2LGL A;  2BAY A;  4YAT A;  2CT2 A;  4IC2 A;  5B79 A;  2VJF A;  1BOR A;  4C9Z A;  3GL6 A;  2VPE A;  5AIU A;  4V3L C;  2JMI A;  2E6R A;  2IDA A;  4LKA A;  3O36 A;  3ZPV E;  5H1T A;  2YYR A;  2YRE A;  2C2V S;  1Z2Q A;  2ECT A;  1CHC A;  4AYC A;  5LKZ A;  5FEY A;  2G43 A;  4UP5 A;  1HYI A;  4LLB A;  4I7B A;  4BBQ A;  3O33 A;  5FB1 A;  5LCW B;  3V43 A;  3KV6 A;  3M63 A;  3O35 A;  4AP4 A;  2HYE D;  2XEU A;  2YSM A;  4IC3 A;  1LDJ B;  5LKT A;  2EA6 A;  2EGP A;  2PUY A;  5D1K B;  3N9M A;  2E6S A;  3PHD A;  2ECW A;  4NN2 A;  4YAB A;  5C11 A;  1WES A;  3RPG C;  1WEU A;  4AUQ B;  1V87 A;  2LN0 A;  2XB1 A;  4FIP A;  3DQV R;  2L0B A;  1K2F A;  4A4C A;  3SOX A;  3LQH A;  3N9N A;  4UP0 A;  5H1V A;  2LXH C;  3T7L A;  1WEV A;  1RMD A;  4AVX A;  3EB6 A;  4LJN A;  5AIT A;  4S3O B;  4YAD A;  1VFY A;  1VD4 A;  2KIZ A;  2FUU A;  1WEW A;  2M6M A;  2JRJ A;  4LK9 A;  2LV9 A;  3O70 A;  2ECN A;  3C6W A;  2VP7 A;  2KGG A;  2L80 A;  2KRE A;  4WA6 A;  2YQL A;  2MD7 B;  4UI9 B;  2K16 A;  3ZYQ A;  4FJC A;  1WGM A;  1WEQ A;  4W4U A;  5KH3 A;  4GNF A;  5C13 A;  2CSY A;  3HTK C;  2F6J A;  4R8P K;  4YBM A;  2Y1N A;  5JG6 A;  2KE1 A;  2CKL A;  2YQM A;  5TDW A;  3VK6 A;  4P5O B;  2YUC A;  2M1R A;  2Y43 A;  2MUM A;  2QIZ A;  4A4B A;  2VJE B;  2RSD A;  2MA6 A;  3HCU A;  2LGK A;  1LDK C;  4Q6F A;  1FP0 A;  3MHH A;  2I50 A;  2C2L A;  3U5M A;  4GNG A;  2LRI C;  5H1U A;  5J3X A;  2ECG A;  2LGV A;  4ZDT A;  2F42 A;  2MIQ A;  1JM7 B;  5FB0 A;  3ZVZ B;  5LKX A;  5KH9 A;  3HCS A;  3SHB A;  1WEE A;  4LAD B;  5LKU A;  4GND A;  3KV5 A;  1MM2 A;  1N87 A;  5KH7 A;  2YHO A;  1WEN A;  3NG2 A;  1IYM A;  3RPG B;  2RI7 A;  1WFK A;  2KWK A;  1G25 A;  1F62 A;  2K17 A;  5H9M A;  3M99 A;  3PUQ A;  2QJ0 A;  4A49 A;  3LQI A;  2FUI A;  1X4I A;  2KWN A;  3N9Q A;  2M85 A;  5DIN A;  2LGG A;  4CA1 A;  2CSZ A;  5G05 B;  1E4U A;  4ZUX U;  1XWH A;  1ZBD B;  2L5U A;  4PPE A;  3QZV A;  5B77 A;  2M3H A;  3EB5 A;  2KU3 A;  2JMD A;  2ZET C;  5D1M B;  2MNY A;  3DPL R;  2G6Q A;  2KFT A;  3ZVY A;  2EOD A;  5TDR A;  3KNV A;  4FK5 A;  4MVT A;  1MM3 A;  3RTR B;  3ASL A;  5B75 A;  2D8S A;  3I2D A;  3HCT A;  3L1X A;  4GB0 A;  1T1H A;  4O64 A;  1X4U A;  5G04 B;  4I7C A;  2H0D B;  2VPB A;  3U5O A;  1JOC A;  1WIL A;  3O34 A;  2UZG A;  5I3L A;  1X4J A;  2LQ6 A;  4N4F A;  1U6G B;  2VJE A;  3SOW A;  2LDR A;  3PUR A;  3N9O A;  2JMJ A;  2VJF B;  2YT5 A;  4X3G A;  2YUR A;  3KQI A;  4N3W A;  4L58 A;  3U5P A;  3ZNI A;  3C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...