2KU3A

Solution structure of brd1 phd1 finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
62
structure length
62
Chain Sequence
b'QSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 1
publication title Solution structure of BRD1 PHD1 finger
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13831 PHD_2 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ku3A00
4B7YC 2KWJA 3SOXA 2LGVA 5LKTA 4A0CD 2ECNA 5EYAF 2YW8A 2K1JA 4I7BA 2EODA 1X4JA 5C13A 4YAXA 1U6GB 2KWNA 5FB0A 5I3LA 2LN0A 4C9ZA 2YQMA 4N4FA 4GNFA 2EGPA 2YU4A 2PNXA 4AUQB 3O34A 4FJCA 2LQ6A 2YURA 1WEOA 2Y1MA 4CA1A 3LQJA 2VP7A 4IC2A 2LV9A 3O36A 1DVPA 4CCGX 3IHPA 1JOCA 5TDRA 3N9MA 2FUUA 3GV4A 4F52B 3ZVZB 3ASLA 2KFTA 2JRJA 1JM7A 3N9QA 2C2LA 2KREA 3RPGC 2Y43A 2MUMA 1WEQA 3DPLR 2MA6A 2JMIA 3EB5A 1VFYA 4FK5A 4R2YA 3VK6A 1LDKC 3PUQA 4W4UA 3M99A 1T1HA 4YBSA 2KR4A 2E6RA 2ZETC 2YSJA 1Z2QA 5FB1A 5D1LB 3PHDA 3O7AA 4I7CA 2K17A 2AN6A 2F42A 2KIZA 5DINA 4UP0A 2L80A 4V3KC 2L75A 2KWOA 2LXPC 5B76A 1HYIA 4A49A 4GB0A 1JM7B 1CHCA 2EA6A 4A4CA 2YT5A 1WGMA 2LGLA 1WEUA 2M85A 4UI9B 2G43A 3ZVYA 4WZ3B 2CKLA 2MA5A 2M6MA 1N87A 5TDWA 4FO9A 4R7EA 5TABA 3KQIA 4ZUXU 1MM2A 4N3WA 2LGGA 3C6WA 5DKAA 1HYJA 4BBQA 2KGGA 2G45A 3LQIA 2BAYA 3EB6A 2ECGA 4L7XA 5H1TA 2VPGA 2KWKA 2LGKA 4YABA 3KV5A 3T6RA 4GNGA 2RI7A 5TBNA 2VPEA 4LLBA 2ECVA 2ECJA 4YBMA 1XWHA 5AIUA 2H0DA 1G25A 2XEUA 1IYMA 3MHSA 3NG2A 2E6SA 2YSMA 3ZPV1 2UZGA 2FSAA 5LKZA 5FEYA 5C11A 5B8DA 1Z6UA 2QICA 2JMDA 2MD8C 4AYCB 2VJFA 2OXQC 2CKLB 1WEMA 3KV6A 1Z60A 3PURA 3N9NA 2KE1A 1FBVA 4O64A 2VNFA 3M63A 2CSYA 2M3HA 2RSDA 5LCWB 4GNDA 4YBTA 2XB1A 3M62A 3N9PA 3FL2A 1RMDA 5J3XA 2YQLA 3SHBA 4PPEA 2VPDA 2VJEA 3N9OA 1K2FA 1WEEA 1WEVA 3V43A 2YREA 3LQHA 2KYUA 2D8SA 5G0FA 2MT5A 3L1ZB 2VJFB 4MVTA 5H1UA 4R8PK 3HCTA 4FIPA 4TKPB 3ZYQA 2CT2A 4LJNA 3U5OA 1F62A 3GL6A 5H9MA 1V87A 2KGIA 4LK9A 3HCSA 4I7DA 4PTBA 2I50A 1WE9A 5AITA 2MIQA 2MD7B 5KH3A 4YC9A 3ZTGA 4GNEA 5G04B 4YADA 4XI1A 4S3OC 1LDJB 2VJEB 4LADB 2JMJA 1VYXA 2M1RA 3RPGB 4YATA 2G6QA 2LDRA 1WESA 2PUYA 2C2VS 1VD4A 3O37A 4X3GA 4B86C 3N9LA 4WA6A 4LKAA 3U5NA 1WFKA 5D1KB 3SOUA 4Q6FA 3HCUA 3ZNIA 5G05B 4A4BA 2L43A 2Y1NA 2QJ0A 1WEWA 4ZDTA 4WZ2A 3U5PA 4MSXA 5KH9A 3L11A 5B79A 2VPBA 4AP4A 3O70A 3O35A 5B78A 2CSZA 2LXHC 3I2DA 4WZ0A 5TRBA 5LKXA 2L5UA 3SOWA 1X4IA 1E4UA 2HYED 2MNZA 2H0DB 3DQVR 3MHHA 4QF3A 2DX8A 2YUCA 3HTKC 5KH7A 3L1XA 5B77A 4P5OB 2QIZA 5LKUA 2YYRA 2LRIC 2FUIA 1WEPA 4QF2A 3T7LA 2ECWA 3RTRB 1WENA 2YHOA 4IC3A 4S3OB 3QZVA 2ECTA 4NN2A 2MNYA 2IDAA 2YHNA 2L0BA 3C5KA 2F6NA 4ZQLA 3U5MA 5B75A 5D1MB 2K16A 3KNVA 2ECIA 4UP5A 2KU3A 1BORA 2NAAA 2HDPA 3ZPVE 4L58A 4BHWA 1WILA 1X4UA 1ZBDB 5FERA 5JG6A 4V3LC 1MM3A 4AYCA 3LRQA 1WIMA 5H1VA 4AVXA 2K4DA 1FP0A 2F6JA 3O33A
chains in the Genus database with same CATH superfamily
4B7YC 2KWJA 3SOXA 2LGVA 5LKTA 4A0CD 2ECNA 5EYAF 2YW8A 2XOZA 2K1JA 4I7BA 2EODA 1X4JA 2OWAA 3FANA 5C13A 4YAXA 1U6GB 2KWNA 5FB0A 5I3LA 2LN0A 2CRRA 4C9ZA 2YQMA 3SUBA 4N4FA 4GNFA 2EGPA 2YU4A 2PNXA 4AUQB 3O34A 4F1PA 4FJCA 2LQ6A 2YURA 1WEOA 2Y1MA 4CA1A 3LQJA 2VP7A 4IC2A 2LV9A 3O36A 1DVPA 4CCGX 3IHPA 1JOCA 5TDRA 2MKEA 3N9MA 2FUUA 3GV4A 3LVRE 4F52B 3ZVZB 3LDYA 3ASLA 3FJUB 3Q1DA 2KFTA 2JRJA 1JM7A 2FFWA 3N9QA 2C2LA 2KREA 3RPGC 2Y43A 2MUMA 2M13A 1WEQA 3DPLR 2MA6A 2JMIA 3E2DA 3EB5A 1VFYA 4FK5A 4R2YA 3VK6A 1LDKC 3PUQA 4W4UA 3M99A 1T1HA 4YBSA 2KR4A 2E6RA 2ZETC 2YSJA 1Z2QA 5FB1A 5D1LB 3PHDA 3O7AA 4I7CA 2XOYA 2K17A 2AN6A 2F42A 2KIZA 5DINA 4UP0A 2L80A 4V3KC 2L75A 2KWOA 2LXPC 5B76A 1HYIA 4QQ4A 4A49A 4GB0A 2FD4A 1JM7B 1CHCA 2EA6A 4A4CA 2YT5A 1WGMA 4O62A 2LGLA 2D8UA 1WEUA 2P57A 2M85A 4UI9B 2G43A 3ZVYA 4WZ3B 2CKLA 2MA5A 2M6MA 1N87A 5TDWA 4FO9A 4R7EA 5TABA 3KQIA 4ZUXU 1MM2A 4N3WA 3KDEC 2LGGA 3C6WA 5DKAA 1HYJA 4BBQA 2KGGA 2G45A 3LQIA 2BAYA 3EB6A 2ECGA 2LAUA 4L7XA 5H1TA 2VPGA 2KWKA 2LGKA 4YABA 3KV5A 3T6RA 4GNGA 2RI7A 5TBNA 2KKXA 2JM3A 2VPEA 4LLBA 2CRWA 2ECVA 2ECJA 4YBMA 1XWHA 5AIUA 2H0DA 1G25A 2YVRA 4Z0OA 2XEUA 1IYMA 3MHSA 1MBMA 3NG2A 2E6SA 2YSMA 3ZPV1 2UZGA 2FSAA 5LKZA 5FEYA 5C11A 5B8DA 1Z6UA 2QICA 2JMDA 4OGEA 2E61A 2MD8C 4AYCB 2VJFA 2EGMA 2OXQC 2CKLB 2EXUA 1WEMA 3KV6A 3JUEA 1Z60A 3PURA 3N9NA 2KE1A 1FBVA 4O64A 2VNFA 3M63A 2CONA 5SVYA 2CSYA 3O47A 2M3HA 2RSDA 4GNDA 4YBTA 5LCWB 2XB1A 3M62A 3N9PA 3FL2A 1RMDA 5J3XA 5SVIA 2YQLA 3SHBA 4PPEA 2VPDA 2VJEA 2CSVA 3N9OA 1K2FA 1WEEA 4H9DA 1WEVA 3V43A 2YREA 3LQHA 3H7HA 2KYUA 2D8SA 5G0FA 2MT5A 3L1ZB 2VJFB 4MVTA 5H1UA 4OGCA 4R8PK 3HCTA 4FIPA 3FM8C 4TKPB 2DSMA 3ZYQA 2CT2A 2B0OE 4LJNA 3U5OA 1F62A 3GL6A 5H9MA 1V87A 2KGIA 4LK9A 3DWDA 3HCSA 4I7DA 3DDTA 4PTBA 2I50A 1WE9A 5AITA 2MIQA 2MD7B 5KH3A 4YC9A 3ZTGA 4GNEA 5G04B 5SVIB 4YADA 4XI1A 4S3OC 1LDJB 2VJEB 4LADB 2JMJA 1VYXA 2M1RA 3RPGB 4YATA 2G6QA 3PLWA 2LDRA 1WESA 2PUYA 2C2VS 1VD4A 3O37A 4X3GA 4B86C 3N9LA 4WA6A 4LKAA 3U5NA 1WFKA 5D1KB 3LJUX 3SOUA 4Q6FA 3HCUA 3ZNIA 5G05B 4A4BA 2L43A 2Y1NA 2QJ0A 1WEWA 4ZDTA 4WZ2A 3U5PA 2RR4A 2IQJA 4MSXA 5K3QA 5KH9A 3L11A 5B79A 2VPBA 4AP4A 3O70A 3O35A 3T9KA 5B78A 2CSZA 2LXHC 3I2DA 4WZ0A 5TRBA 5LKXA 2L5UA 3SOWA 1X4IA 2XP0A 3LVQE 1E4UA 5SVXA 2JUNA 2HYED 2MNZA 2H0DB 3DQVR 3MHHA 4QF3A 2DX8A 2YUCA 3HTKC 5KH7A 3M7KA 3L1XA 5B77A 2L7PA 4P5OB 2QIZA 5LKUA 2YYRA 2LRIC 2FUIA 1WEPA 4QF2A 3T7LA 2ECWA 3RTRB 1WENA 3FEHA 2YHOA 4IC3A 4S3OB 3QZVA 2ECTA 4NN2A 2MNYA 2IDAA 2YHNA 1DCQA 2L0BA 3C5KA 2F6NA 4ZQLA 3U5MA 5B75A 5D1MB 2K16A 3KNVA 3FAOA 2ECIA 4UP5A 2KU3A 1BORA 2NAAA 2HDPA 3ZPVE 4L58A 4BHWA 1WILA 1X4UA 1ZBDB 5FERA 5JG6A 4V3LC 1MM3A 4AYCA 4Z0RA 3LRQA 1WIMA 5H1VA 3MDBC 2KKYA 2DJAA 4AVXA 2K4DA 1FP0A 2F6JA 2XOCA 3O33A
chains in the Genus database with same CATH topology
4B7YC 2KWJA 3SOXA 2LGVA 5LKTA 4A0CD 2ECNA 5EYAF 2YW8A 2K1JA 4I7BA 2EODA 1X4JA 5C13A 4YAXA 1U6GB 2KWNA 5FB0A 5I3LA 2LN0A 4C9ZA 2YQMA 4N4FA 4GNFA 2EGPA 2YU4A 2PNXA 4AUQB 3O34A 4FJCA 2LQ6A 2YURA 1WEOA 2Y1MA 4CA1A 3LQJA 2VP7A 4IC2A 2LV9A 3O36A 1DVPA 4CCGX 3IHPA 1JOCA 5TDRA 3N9MA 2FUUA 3GV4A 4F52B 3ZVZB 3ASLA 2KFTA 2JRJA 1JM7A 3N9QA 2C2LA 2KREA 3RPGC 2Y43A 2MUMA 1WEQA 3DPLR 2MA6A 2JMIA 3EB5A 1VFYA 4FK5A 4R2YA 3VK6A 1LDKC 3PUQA 4W4UA 3M99A 1T1HA 4YBSA 2KR4A 2E6RA 2ZETC 2YSJA 1Z2QA 5FB1A 5D1LB 3PHDA 3O7AA 4I7CA 2K17A 2AN6A 2F42A 2KIZA 5DINA 4UP0A 2L80A 4V3KC 2L75A 2KWOA 2LXPC 5B76A 1HYIA 4A49A 4GB0A 1JM7B 1CHCA 2EA6A 4A4CA 2YT5A 1WGMA 2LGLA 1WEUA 2M85A 4UI9B 2G43A 3ZVYA 4WZ3B 2CKLA 2MA5A 2M6MA 1N87A 5TDWA 4FO9A 4R7EA 5TABA 3KQIA 4ZUXU 1MM2A 4N3WA 2LGGA 3C6WA 5DKAA 1HYJA 4BBQA 2KGGA 2G45A 3LQIA 2BAYA 3EB6A 2ECGA 4L7XA 5H1TA 2VPGA 2KWKA 2LGKA 4YABA 3KV5A 3T6RA 4GNGA 2RI7A 5TBNA 2VPEA 4LLBA 2ECVA 2ECJA 4YBMA 1XWHA 5AIUA 2H0DA 1G25A 2XEUA 1IYMA 3MHSA 3NG2A 2E6SA 2YSMA 3ZPV1 2UZGA 2FSAA 5LKZA 5FEYA 5C11A 5B8DA 1Z6UA 2QICA 2JMDA 2MD8C 4AYCB 2VJFA 2OXQC 2CKLB 1WEMA 3KV6A 1Z60A 3PURA 3N9NA 2KE1A 1FBVA 4O64A 2VNFA 3M63A 2CSYA 2M3HA 2RSDA 5LCWB 4GNDA 4YBTA 2XB1A 3M62A 3N9PA 3FL2A 1RMDA 5J3XA 2YQLA 3SHBA 4PPEA 2VPDA 2VJEA 3N9OA 1K2FA 1WEEA 1WEVA 3V43A 2YREA 3LQHA 2KYUA 2D8SA 5G0FA 2MT5A 3L1ZB 2VJFB 4MVTA 5H1UA 4R8PK 3HCTA 4FIPA 4TKPB 3ZYQA 2CT2A 4LJNA 3U5OA 1F62A 3GL6A 5H9MA 1V87A 2KGIA 4LK9A 3HCSA 4I7DA 4PTBA 2I50A 1WE9A 5AITA 2MIQA 2MD7B 5KH3A 4YC9A 3ZTGA 4GNEA 5G04B 4YADA 4XI1A 4S3OC 1LDJB 2VJEB 4LADB 2JMJA 1VYXA 2M1RA 3RPGB 4YATA 2G6QA 2LDRA 1WESA 2PUYA 2C2VS 1VD4A 3O37A 4X3GA 4B86C 3N9LA 4WA6A 4LKAA 3U5NA 1WFKA 5D1KB 3SOUA 4Q6FA 3HCUA 3ZNIA 5G05B 4A4BA 2L43A 2Y1NA 2QJ0A 1WEWA 4ZDTA 4WZ2A 3U5PA 4MSXA 5KH9A 3L11A 5B79A 2VPBA 4AP4A 3O70A 3O35A 5B78A 2CSZA 2LXHC 3I2DA 4WZ0A 5TRBA 5LKXA 2L5UA 3SOWA 1X4IA 1E4UA 2HYED 2MNZA 2H0DB 3DQVR 3MHHA 4QF3A 2DX8A 2YUCA 3HTKC 5KH7A 3L1XA 5B77A 4P5OB 2QIZA 5LKUA 2YYRA 2LRIC 2FUIA 1WEPA 4QF2A 3T7LA 2ECWA 3RTRB 1WENA 2YHOA 4IC3A 4S3OB 3QZVA 2ECTA 4NN2A 2MNYA 2IDAA 2YHNA 2L0BA 3C5KA 2F6NA 4ZQLA 3U5MA 5B75A 5D1MB 2K16A 3KNVA 2ECIA 4UP5A 2KU3A 1BORA 2NAAA 2HDPA 3ZPVE 4L58A 4BHWA 1WILA 1X4UA 1ZBDB 5FERA 5JG6A 4V3LC 1MM3A 4AYCA 3LRQA 1WIMA 5H1VA 4AVXA 2K4DA 1FP0A 2F6JA 3O33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B7Y C;  2KWJ A;  3SOX A;  2LGV A;  5LKT A;  4A0C D;  2ECN A;  5EYA F;  2YW8 A;  2K1J A;  4I7B A;  2EOD A;  1X4J A;  5C13 A;  4YAX A;  1U6G B;  2KWN A;  5FB0 A;  5I3L A;  2LN0 A;  4C9Z A;  2YQM A;  4N4F A;  4GNF A;  2EGP A;  2YU4 A;  2PNX A;  4AUQ B;  3O34 A;  4FJC A;  2LQ6 A;  2YUR A;  1WEO A;  2Y1M A;  4CA1 A;  3LQJ A;  2VP7 A;  4IC2 A;  2LV9 A;  3O36 A;  1DVP A;  4CCG X;  3IHP A;  1JOC A;  5TDR A;  3N9M A;  2FUU A;  3GV4 A;  4F52 B;  3ZVZ B;  3ASL A;  2KFT A;  2JRJ A;  1JM7 A;  3N9Q A;  2C2L A;  2KRE A;  3RPG C;  2Y43 A;  2MUM A;  1WEQ A;  3DPL R;  2MA6 A;  2JMI A;  3EB5 A;  1VFY A;  4FK5 A;  4R2Y A;  3VK6 A;  1LDK C;  3PUQ A;  4W4U A;  3M99 A;  1T1H A;  4YBS A;  2KR4 A;  2E6R A;  2ZET C;  2YSJ A;  1Z2Q A;  5FB1 A;  5D1L B;  3PHD A;  3O7A A;  4I7C A;  2K17 A;  2AN6 A;  2F42 A;  2KIZ A;  5DIN A;  4UP0 A;  2L80 A;  4V3K C;  2L75 A;  2KWO A;  2LXP C;  5B76 A;  1HYI A;  4A49 A;  4GB0 A;  1JM7 B;  1CHC A;  2EA6 A;  4A4C A;  2YT5 A;  1WGM A;  2LGL A;  1WEU A;  2M85 A;  4UI9 B;  2G43 A;  3ZVY A;  4WZ3 B;  2CKL A;  2MA5 A;  2M6M A;  1N87 A;  5TDW A;  4FO9 A;  4R7E A;  5TAB A;  3KQI A;  4ZUX U;  1MM2 A;  4N3W A;  2LGG A;  3C6W A;  5DKA A;  1HYJ A;  4BBQ A;  2KGG A;  2G45 A;  3LQI A;  2BAY A;  3EB6 A;  2ECG A;  4L7X A;  5H1T A;  2VPG A;  2KWK A;  2LGK A;  4YAB A;  3KV5 A;  3T6R A;  4GNG A;  2RI7 A;  5TBN A;  2VPE A;  4LLB A;  2ECV A;  2ECJ A;  4YBM A;  1XWH A;  5AIU A;  2H0D A;  1G25 A;  2XEU A;  1IYM A;  3MHS A;  3NG2 A;  2E6S A;  2YSM A;  3ZPV 1;  2UZG A;  2FSA A;  5LKZ A;  5FEY A;  5C11 A;  5B8D A;  1Z6U A;  2QIC A;  2JMD A;  2MD8 C;  4AYC B;  2VJF A;  2OXQ C;  2CKL B;  1WEM A;  3KV6 A;  1Z60 A;  3PUR A;  3N9N A;  2KE1 A;  1FBV A;  4O64 A;  2VNF A;  3M63 A;  2CSY A;  2M3H A;  2RSD A;  5LCW B;  4GND A;  4YBT A;  2XB1 A;  3M62 A;  3N9P A;  3FL2 A;  1RMD A;  5J3X A;  2YQL A;  3SHB A;  4PPE A;  2VPD A;  2VJE A;  3N9O A;  1K2F A;  1WEE A;  1WEV A;  3V43 A;  2YRE A;  3LQH A;  2KYU A;  2D8S A;  5G0F A;  2MT5 A;  3L1Z B;  2VJF B;  4MVT A;  5H1U A;  4R8P K;  3HCT A;  4FIP A;  4TKP B;  3ZYQ A;  2CT2 A;  4LJN A;  3U5O A;  1F62 A;  3GL6 A;  5H9M A;  1V87 A;  2KGI A;  4LK9 A;  3HCS A;  4I7D A;  4PTB A;  2I50 A;  1WE9 A;  5AIT A;  2MIQ A;  2MD7 B;  5KH3 A;  4YC9 A;  3ZTG A;  4GNE A;  5G04 B;  4YAD A;  4XI1 A;  4S3O C;  1LDJ B;  2VJE B;  4LAD B;  2JMJ A;  1VYX A;  2M1R A;  3RPG B;  4YAT A;  2G6Q A;  2LDR A;  1WES A;  2PUY A;  2C2V S;  1VD4 A;  3O37 A;  4X3G A;  4B86 C;  3N9L A;  4WA6 A;  4LKA A;  3U5N A;  1WFK A;  5D1K B;  3SOU A;  4Q6F A;  3HCU A;  3ZNI A;  5G05 B;  4A4B A;  2L43 A;  2Y1N A;  2QJ0 A;  1WEW A;  4ZDT A;  4WZ2 A;  3U5P A;  4MSX A;  5KH9 A;  3L11 A;  5B79 A;  2VPB A;  4AP4 A;  3O70 A;  3O35 A;  5B78 A;  2CSZ A;  2LXH C;  3I2D A;  4WZ0 A;  5TRB A;  5LKX A;  2L5U A;  3SOW A;  1X4I A;  1E4U A;  2HYE D;  2MNZ A;  2H0D B;  3DQV R;  3MHH A;  4QF3 A;  2DX8 A;  2YUC A;  3HTK C;  5KH7 A;  3L1X A;  5B77 A;  4P5O B;  2QIZ A;  5LKU A;  2YYR A;  2LRI C;  2FUI A;  1WEP A;  4QF2 A;  3T7L A;  2ECW A;  3RTR B;  1WEN A;  2YHO A;  4IC3 A;  4S3O B;  3QZV A;  2ECT A;  4NN2 A;  2MNY A;  2IDA A;  2YHN A;  2L0B A;  3C5K A;  2F6N A;  4ZQL A;  3U5M A;  5B75 A;  5D1M B;  2K16 A;  3KNV A;  2ECI A;  4UP5 A;  2KU3 A;  1BOR A;  2NAA A;  2HDP A;  3ZPV E;  4L58 A;  4BHW A;  1WIL A;  1X4U A;  1ZBD B;  5FER A;  5JG6 A;  4V3L C;  1MM3 A;  4AYC A;  3LRQ A;  1WIM A;  5H1V A;  4AVX A;  2K4D A;  1FP0 A;  2F6J A;  3O33 A; 
#chains in the Genus database with same CATH topology
 4B7Y C;  2KWJ A;  3SOX A;  2LGV A;  5LKT A;  4A0C D;  2ECN A;  5EYA F;  2YW8 A;  2XOZ A;  2K1J A;  4I7B A;  2EOD A;  1X4J A;  2OWA A;  3FAN A;  5C13 A;  4YAX A;  1U6G B;  2KWN A;  5FB0 A;  5I3L A;  2LN0 A;  2CRR A;  4C9Z A;  2YQM A;  3SUB A;  4N4F A;  4GNF A;  2EGP A;  2YU4 A;  2PNX A;  4AUQ B;  3O34 A;  4F1P A;  4FJC A;  2LQ6 A;  2YUR A;  1WEO A;  2Y1M A;  4CA1 A;  3LQJ A;  2VP7 A;  4IC2 A;  2LV9 A;  3O36 A;  1DVP A;  4CCG X;  3IHP A;  1JOC A;  5TDR A;  2MKE A;  3N9M A;  2FUU A;  3GV4 A;  3LVR E;  4F52 B;  3ZVZ B;  3LDY A;  3ASL A;  3FJU B;  3Q1D A;  2KFT A;  2JRJ A;  1JM7 A;  2FFW A;  3N9Q A;  2C2L A;  2KRE A;  3RPG C;  2Y43 A;  2MUM A;  2M13 A;  1WEQ A;  3DPL R;  2MA6 A;  2JMI A;  3E2D A;  3EB5 A;  1VFY A;  4FK5 A;  4R2Y A;  3VK6 A;  1LDK C;  3PUQ A;  4W4U A;  3M99 A;  1T1H A;  4YBS A;  2KR4 A;  2E6R A;  2ZET C;  2YSJ A;  1Z2Q A;  5FB1 A;  5D1L B;  3PHD A;  3O7A A;  4I7C A;  2XOY A;  2K17 A;  2AN6 A;  2F42 A;  2KIZ A;  5DIN A;  4UP0 A;  2L80 A;  4V3K C;  2L75 A;  2KWO A;  2LXP C;  5B76 A;  1HYI A;  4QQ4 A;  4A49 A;  4GB0 A;  2FD4 A;  1JM7 B;  1CHC A;  2EA6 A;  4A4C A;  2YT5 A;  1WGM A;  4O62 A;  2LGL A;  2D8U A;  1WEU A;  2P57 A;  2M85 A;  4UI9 B;  2G43 A;  3ZVY A;  4WZ3 B;  2CKL A;  2MA5 A;  2M6M A;  1N87 A;  5TDW A;  4FO9 A;  4R7E A;  5TAB A;  3KQI A;  4ZUX U;  1MM2 A;  4N3W A;  3KDE C;  2LGG A;  3C6W A;  5DKA A;  1HYJ A;  4BBQ A;  2KGG A;  2G45 A;  3LQI A;  2BAY A;  3EB6 A;  2ECG A;  2LAU A;  4L7X A;  5H1T A;  2VPG A;  2KWK A;  2LGK A;  4YAB A;  3KV5 A;  3T6R A;  4GNG A;  2RI7 A;  5TBN A;  2KKX A;  2JM3 A;  2VPE A;  4LLB A;  2CRW A;  2ECV A;  2ECJ A;  4YBM A;  1XWH A;  5AIU A;  2H0D A;  1G25 A;  2YVR A;  4Z0O A;  2XEU A;  1IYM A;  3MHS A;  1MBM A;  3NG2 A;  2E6S A;  2YSM A;  3ZPV 1;  2UZG A;  2FSA A;  5LKZ A;  5FEY A;  5C11 A;  5B8D A;  1Z6U A;  2QIC A;  2JMD A;  4OGE A;  2E61 A;  2MD8 C;  4AYC B;  2VJF A;  2EGM A;  2OXQ C;  2CKL B;  2EXU A;  1WEM A;  3KV6 A;  3JUE A;  1Z60 A;  3PUR A;  3N9N A;  2KE1 A;  1FBV A;  4O64 A;  2VNF A;  3M63 A;  2CON A;  5SVY A;  2CSY A;  3O47 A;  2M3H A;  2RSD A;  4GND A;  4YBT A;  5LCW B;  2XB1 A;  3M62 A;  3N9P A;  3FL2 A;  1RMD A;  5J3X A;  5SVI A;  2YQL A;  3SHB A;  4PPE A;  2VPD A;  2VJE A;  2CSV A;  3N9O A;  1K2F A;  1WEE A;  4H9D A;  1WEV A;  3V43 A;  2YRE A;  3LQH A;  3H7H A;  2KYU A;  2D8S A;  5G0F A;  2MT5 A;  3L1Z B;  2VJF B;  4MVT A;  5H1U A;  4OGC A;  4R8P K;  3HCT A;  4FIP A;  3FM8 C;  4TKP B;  2DSM A;  3ZYQ A;  2CT2 A;  2B0O E;  4LJN A;  3U5O A;  1F62 A;  3GL6 A;  5H9M A;  1V87 A;  2KGI A;  4LK9 A;  3DWD A;  3HCS A;  4I7D A;  3DDT A;  4PTB A;  2I50 A;  1WE9 A;  5AIT A;  2MIQ A;  2MD7 B;  5KH3 A;  4YC9 A;  3ZTG A;  4GNE A;  5G04 B;  5SVI B;  4YAD A;  4XI1 A;  4S3O C;  1LDJ B;  2VJE B;  4LAD B;  2JMJ A;  1VYX A;  2M1R A;  3RPG B;  4YAT A;  2G6Q A;  3PLW A;  2LDR A;  1WES A;  2PUY A;  2C2V S;  1VD4 A;  3O37 A;  4X3G A;  4B86 C;  3N9L A;  4WA6 A;  4LKA A;  3U5N A;  1WFK A;  5D1K B;  3LJU X;  3SOU A;  4Q6F A;  3HCU A;  3ZNI A;  5G05 B;  4A4B A;  2L43 A;  2Y1N A;  2QJ0 A;  1WEW A;  4ZDT A;  4WZ2 A;  3U5P A;  2RR4 A;  2IQJ A;  4MSX A;  5K3Q A;  5KH9 A;  3L11 A;  5B79 A;  2VPB A;  4AP4 A;  3O70 A;  3O35 A;  3T9K A;  5B78 A;  2CSZ A;  2LXH C;  3I2D A;  4WZ0 A;  5TRB A;  5LKX A;  2L5U A;  3SOW A;  1X4I A;  2XP0 A;  3LVQ E;  1E4U A;  5SVX A;  2JUN A;  2HYE D;  2MNZ A;  2H0D B;  3DQV R;  3MHH A;  4QF3 A;  2DX8 A;  2YUC A;  3HTK C;  5KH7 A;  3M7K A;  3L1X A;  5B77 A;  2L7P A;  4P5O B;  2QIZ A;  5LKU A;  2YYR A;  2LRI C;  2FUI A;  1WEP A;  4QF2 A;  3T7L A;  2ECW A;  3RTR B;  1WEN A;  3FEH A;  2YHO A;  4IC3 A;  4S3O B;  3QZV A;  2ECT A;  4NN2 A;  2MNY A;  2IDA A;  2YHN A;  1DCQ A;  2L0B A;  3C5K A;  2F6N A;  4ZQL A;  3U5M A;  5B75 A;  5D1M B;  2K16 A;  3KNV A;  3FAO A;  2ECI A;  4UP5 A;  2KU3 A;  1BOR A;  2NAA A;  2HDP A;  3ZPV E;  4L58 A;  4BHW A;  1WIL A;  1X4U A;  1ZBD B;  5FER A;  5JG6 A;  4V3L C;  1MM3 A;  4AYC A;  4Z0R A;  3LRQ A;  1WIM A;  5H1V A;  3MDB C;  2KKY A;  2DJA A;  4AVX A;  2K4D A;  1FP0 A;  2F6J A;  2XOC A;  3O33 A; 
#chains in the Genus database with same CATH homology
 4B7Y C;  2KWJ A;  3SOX A;  2LGV A;  5LKT A;  4A0C D;  2ECN A;  5EYA F;  2YW8 A;  2K1J A;  4I7B A;  2EOD A;  1X4J A;  5C13 A;  4YAX A;  1U6G B;  2KWN A;  5FB0 A;  5I3L A;  2LN0 A;  4C9Z A;  2YQM A;  4N4F A;  4GNF A;  2EGP A;  2YU4 A;  2PNX A;  4AUQ B;  3O34 A;  4FJC A;  2LQ6 A;  2YUR A;  1WEO A;  2Y1M A;  4CA1 A;  3LQJ A;  2VP7 A;  4IC2 A;  2LV9 A;  3O36 A;  1DVP A;  4CCG X;  3IHP A;  1JOC A;  5TDR A;  3N9M A;  2FUU A;  3GV4 A;  4F52 B;  3ZVZ B;  3ASL A;  2KFT A;  2JRJ A;  1JM7 A;  3N9Q A;  2C2L A;  2KRE A;  3RPG C;  2Y43 A;  2MUM A;  1WEQ A;  3DPL R;  2MA6 A;  2JMI A;  3EB5 A;  1VFY A;  4FK5 A;  4R2Y A;  3VK6 A;  1LDK C;  3PUQ A;  4W4U A;  3M99 A;  1T1H A;  4YBS A;  2KR4 A;  2E6R A;  2ZET C;  2YSJ A;  1Z2Q A;  5FB1 A;  5D1L B;  3PHD A;  3O7A A;  4I7C A;  2K17 A;  2AN6 A;  2F42 A;  2KIZ A;  5DIN A;  4UP0 A;  2L80 A;  4V3K C;  2L75 A;  2KWO A;  2LXP C;  5B76 A;  1HYI A;  4A49 A;  4GB0 A;  1JM7 B;  1CHC A;  2EA6 A;  4A4C A;  2YT5 A;  1WGM A;  2LGL A;  1WEU A;  2M85 A;  4UI9 B;  2G43 A;  3ZVY A;  4WZ3 B;  2CKL A;  2MA5 A;  2M6M A;  1N87 A;  5TDW A;  4FO9 A;  4R7E A;  5TAB A;  3KQI A;  4ZUX U;  1MM2 A;  4N3W A;  2LGG A;  3C6W A;  5DKA A;  1HYJ A;  4BBQ A;  2KGG A;  2G45 A;  3LQI A;  2BAY A;  3EB6 A;  2ECG A;  4L7X A;  5H1T A;  2VPG A;  2KWK A;  2LGK A;  4YAB A;  3KV5 A;  3T6R A;  4GNG A;  2RI7 A;  5TBN A;  2VPE A;  4LLB A;  2ECV A;  2ECJ A;  4YBM A;  1XWH A;  5AIU A;  2H0D A;  1G25 A;  2XEU A;  1IYM A;  3MHS A;  3NG2 A;  2E6S A;  2YSM A;  3ZPV 1;  2UZG A;  2FSA A;  5LKZ A;  5FEY A;  5C11 A;  5B8D A;  1Z6U A;  2QIC A;  2JMD A;  2MD8 C;  4AYC B;  2VJF A;  2OXQ C;  2CKL B;  1WEM A;  3KV6 A;  1Z60 A;  3PUR A;  3N9N A;  2KE1 A;  1FBV A;  4O64 A;  2VNF A;  3M63 A;  2CSY A;  2M3H A;  2RSD A;  5LCW B;  4GND A;  4YBT A;  2XB1 A;  3M62 A;  3N9P A;  3FL2 A;  1RMD A;  5J3X A;  2YQL A;  3SHB A;  4PPE A;  2VPD A;  2VJE A;  3N9O A;  1K2F A;  1WEE A;  1WEV A;  3V43 A;  2YRE A;  3LQH A;  2KYU A;  2D8S A;  5G0F A;  2MT5 A;  3L1Z B;  2VJF B;  4MVT A;  5H1U A;  4R8P K;  3HCT A;  4FIP A;  4TKP B;  3ZYQ A;  2CT2 A;  4LJN A;  3U5O A;  1F62 A;  3GL6 A;  5H9M A;  1V87 A;  2KGI A;  4LK9 A;  3HCS A;  4I7D A;  4PTB A;  2I50 A;  1WE9 A;  5AIT A;  2MIQ A;  2MD7 B;  5KH3 A;  4YC9 A;  3ZTG A;  4GNE A;  5G04 B;  4YAD A;  4XI1 A;  4S3O C;  1LDJ B;  2VJE B;  4LAD B;  2JMJ A;  1VYX A;  2M1R A;  3RPG B;  4YAT A;  2G6Q A;  2LDR A;  1WES A;  2PUY A;  2C2V S;  1VD4 A;  3O37 A;  4X3G A;  4B86 C;  3N9L A;  4WA6 A;  4LKA A;  3U5N A;  1WFK A;  5D1K B;  3SOU A;  4Q6F A;  3HCU A;  3ZNI A;  5G05 B;  4A4B A;  2L43 A;  2Y1N A;  2QJ0 A;  1WEW A;  4ZDT A;  4WZ2 A;  3U5P A;  4MSX A;  5KH9 A;  3L11 A;  5B79 A;  2VPB A;  4AP4 A;  3O70 A;  3O35 A;  5B78 A;  2CSZ A;  2LXH C;  3I2D A;  4WZ0 A;  5TRB A;  5LKX A;  2L5U A;  3SOW A;  1X4I A;  1E4U A;  2HYE D;  2MNZ A;  2H0D B;  3DQV R;  3MHH A;  4QF3 A;  2DX8 A;  2YUC A;  3HTK C;  5KH7 A;  3L1X A;  5B77 A;  4P5O B;  2QIZ A;  5LKU A;  2YYR A;  2LRI C;  2FUI A;  1WEP A;  4QF2 A;  3T7L A;  2ECW A;  3RTR B;  1WEN A;  2YHO A;  4IC3 A;  4S3O B;  3QZV A;  2ECT A;  4NN2 A;  2MNY A;  2IDA A;  2YHN A;  2L0B A;  3C5K A;  2F6N A;  4ZQL A;  3U5M A;  5B75 A;  5D1M B;  2K16 A;  3KNV A;  2ECI A;  4UP5 A;  2KU3 A;  1BOR A;  2NAA A;  2HDP A;  3ZPV E;  4L58 A;  4BHW A;  1WIL A;  1X4U A;  1ZBD B;  5FER A;  5JG6 A;  4V3L C;  1MM3 A;  4AYC A;  3LRQ A;  1WIM A;  5H1V A;  4AVX A;  2K4D A;  1FP0 A;  2F6J A;  3O33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...