2KU3A

Solution structure of brd1 phd1 finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
62
structure length
62
Chain Sequence
QSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of BRD1 PHD1 finger
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 1
total genus 6
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13831 PHD_2 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ku3A00
4S3OC 1WEEA 3O35A 2FUUA 4A0CD 2L80A 4V3LC 2YUCA 4C9ZA 1IYMA 2VNFA 2K16A 2MD7B 4YBSA 3MHHA 4AVXA 2L43A 2EODA 4X3GA 1V87A 2G45A 5FEYA 4UI9B 5AITA 5EYAF 4WZ0A 2G6QA 3KNVA 3SOWA 2M6MA 3IHPA 4UP0A 2F42A 2RSDA 4B7YC 4YBMA 3T6RA 2YT5A 3KQIA 5JG6A 3U5OA 5B75A 2LQ6A 2MT5A 5TDRA 2LGLA 2F6JA 5D1KB 2KYUA 2KWOA 2YQMA 5DKAA 4IC2A 3LQIA 1XWHA 3PURA 2PNXA 2QJ0A 2KGGA 4AYCB 2K4DA 2I50A 3O33A 4XI1A 1Z6UA 2KWNA 2XEUA 3O36A 4I7BA 3SHBA 3I2DA 4YBTA 2D8SA 5J3XA 5D1LB 1CHCA 4N4FA 3T7LA 4WZ3B 2MD8C 5TRBA 2VPBA 2EA6A 2ECTA 2UZGA 4YC9A 2KREA 4WA6A 4I7DA 1X4IA 1Z2QA 3N9NA 3M63A 4YABA 2FUIA 2YREA 2H0DA 2K1JA 3O37A 2MNYA 1WEWA 3HCSA 4MSXA 5C13A 2VJFB 5H1UA 4S3OB 4N3WA 2LXPC 5G0FA 4GNFA 2E6RA 2YQLA 3LQHA 4GNEA 3SOUA 2AN6A 1JM7B 2LGVA 5H1TA 2VJEA 1E4UA 4YATA 2LXHC 3ZNIA 5FB0A 5H9MA 4IC3A 4LJNA 2CT2A 2L0BA 2KR4A 3HCTA 2K17A 1G25A 4GNGA 1WEUA 3FL2A 2VP7A 5D1MB 5I3LA 4BBQA 2OXQC 4B86C 5LKXA 3N9OA 3NG2A 4O64A 4R7EA 2EGPA 2YURA 5FERA 4CA1A 2L75A 3ZVYA 2KGIA 2YSJA 2ECIA 4PTBA 2FSAA 3L1ZB 2LDRA 1JOCA 4LK9A 2LRIC 3MHSA 2LV9A 4P5OB 5B77A 1RMDA 3N9PA 2LGGA 4WZ2A 1LDKC 3V43A 3M99A 1VYXA 1DVPA 3GL6A 5DINA 3HCUA 4ZDTA 4ZQLA 3LRQA 2Y1MA 1VFYA 1MM2A 4L7XA 3DQVR 2CSZA 4FIPA 2YU4A 4L58A 5LKTA 4QF3A 1WIMA 2ECNA 1F62A 2YSMA 2ECVA 2ECGA 1WFKA 2QIZA 2JRJA 2JMIA 2C2VS 4YAXA 2RI7A 2DX8A 2HYED 3N9MA 2MNZA 3SOXA 4A4CA 2F6NA 2CKLA 2YYRA 2KWKA 2Y43A 3O70A 5LKZA 1BORA 2MUMA 1FBVA 2G43A 3VK6A 3PHDA 1WEQA 3HTKC 2QICA 4NN2A 4AP4A 2KU3A 4FJCA 2JMJA 2HDPA 5KH3A 4A4BA 4F52B 5TBNA 5G04B 5B8DA 5KH9A 2VPDA 5TDWA 4QF2A 3ZTGA 4LLBA 2M3HA 3GV4A 1VD4A 2LGKA 1N87A 5TABA 3C5KA 4LADB 3RPGC 3PUQA 4AYCA 4BHWA 1K2FA 1HYIA 3O7AA 3ZYQA 3DPLR 1X4JA 4I7CA 1MM3A 2CKLB 2VJFA 4PPEA 2NAAA 1WEMA 5C11A 4V3KC 5AIUA 4R2YA 1X4UA 2KE1A 3L11A 5B79A 2JMDA 2YW8A 1WEPA 3EB5A 3LQJA 2ECJA 2MA5A 1WENA 3EB6A 2YHOA 2M85A 5LCWB 4TKPB 3KV6A 2KIZA 3KV5A 4ZUXU 4LKAA 3ZPV1 2VPEA 4GNDA 3C6WA 5LKUA 1T1HA 1WESA 2XB1A 4GB0A 1WEOA 1WGMA 3M62A 1FP0A 3ZVZB 4AUQB 1JM7A 3U5PA 2MA6A 2VJEB 4UP5A 2L5UA 2VPGA 3N9QA 5KH7A 2KFTA 4FO9A 2ECWA 3RTRB 1HYJA 2C2LA 2ZETC 1WILA 3ZPVE 4FK5A 3QZVA 2IDAA 2MIQA 5B76A 1U6GB 3U5MA 2H0DB 1LDJB 1WEVA 2KWJA 5H1VA 1Z60A 3O34A 2CSYA 5B78A 3U5NA 5G05B 4A49A 3RPGB 2PUYA 4CCGX 2YHNA 3N9LA 3L1XA 4YADA 4W4UA 2BAYA 4Q6FA 1WE9A 3ASLA 5FB1A 2Y1NA 4R8PK 2E6SA 1ZBDB 2LN0A 2M1RA 4MVTA
chains in the Genus database with same CATH superfamily
4S3OC 3LJUX 1WEEA 3O35A 2FUUA 4A0CD 2L80A 4V3LC 2YUCA 4C9ZA 2CRWA 1IYMA 2VNFA 2K16A 1MBMA 2MD7B 4YBSA 3MHHA 2OWAA 4AVXA 2L43A 2EODA 3FEHA 4X3GA 1V87A 2G45A 5FEYA 4UI9B 5AITA 5EYAF 4WZ0A 3KDEC 2G6QA 3KNVA 2MKEA 3SOWA 2M6MA 3IHPA 4UP0A 2F42A 4OGEA 2IQJA 2RSDA 4B7YC 4YBMA 3T6RA 2YT5A 3KQIA 5JG6A 3U5OA 5B75A 2LQ6A 3LDYA 4OGCA 2MT5A 3Q1DA 5TDRA 2LGLA 2F6JA 5D1KB 2KYUA 2KWOA 2YQMA 5DKAA 4IC2A 3LQIA 1XWHA 3PURA 2PNXA 2QJ0A 2KGGA 4AYCB 2K4DA 3FAOA 2I50A 3O33A 4XI1A 1Z6UA 2KWNA 2XEUA 3O36A 4I7BA 3SHBA 3I2DA 4YBTA 2D8SA 5J3XA 3PLWA 5D1LB 1CHCA 4N4FA 2YVRA 3T7LA 4WZ3B 2MD8C 2DSMA 5TRBA 2VPBA 2EA6A 2ECTA 2UZGA 4YC9A 3M7KA 2XOZA 2KREA 4WA6A 4I7DA 1X4IA 1Z2QA 3N9NA 3M63A 4YABA 2FUIA 2YREA 2H0DA 2K1JA 3O37A 2MNYA 2FFWA 3E2DA 1WEWA 3HCSA 4MSXA 5C13A 4QQ4A 2VJFB 5H1UA 4S3OB 4N3WA 2LXPC 5G0FA 4GNFA 2E6RA 2YQLA 3LQHA 4GNEA 3SOUA 2AN6A 1JM7B 2LGVA 5H1TA 2VJEA 1E4UA 4YATA 2LXHC 3ZNIA 5FB0A 2D8UA 2KKXA 5H9MA 4IC3A 4LJNA 2KKYA 2CT2A 2L0BA 3LVQE 2KR4A 3O47A 3HCTA 2K17A 1G25A 4GNGA 3JUEA 1WEUA 2XOYA 3FL2A 2CONA 2VP7A 5D1MB 5I3LA 4BBQA 2OXQC 4B86C 3DWDA 5LKXA 3N9OA 3NG2A 4O64A 2JM3A 4R7EA 2EGPA 2YURA 5FERA 4CA1A 2L75A 3ZVYA 2KGIA 2YSJA 3T9KA 2ECIA 4H9DA 4PTBA 2FSAA 3L1ZB 2LDRA 1JOCA 4LK9A 2LRIC 3MHSA 4Z0RA 2LV9A 4P5OB 5B77A 2RR4A 1RMDA 3N9PA 2LGGA 4WZ2A 1LDKC 3V43A 3M99A 1VYXA 1DVPA 3GL6A 5DINA 3HCUA 4ZDTA 3MDBC 2FD4A 4ZQLA 3LRQA 2Y1MA 1VFYA 1MM2A 4L7XA 3DQVR 2CSZA 2LAUA 4FIPA 2YU4A 4L58A 5LKTA 4QF3A 1WIMA 2ECNA 1F62A 2P57A 2YSMA 2ECVA 2ECGA 1WFKA 2QIZA 2JRJA 2JMIA 2C2VS 2CSVA 3H7HA 4YAXA 2CRRA 2RI7A 2XP0A 2DX8A 2HYED 2JUNA 4Z0OA 3N9MA 2MNZA 3SOXA 4A4CA 2F6NA 2CKLA 2YYRA 2KWKA 2Y43A 3O70A 5LKZA 1BORA 2EGMA 2DJAA 1FBVA 2G43A 2MUMA 3VK6A 3FANA 3PHDA 1WEQA 3HTKC 2QICA 4NN2A 4AP4A 2KU3A 4FJCA 2JMJA 2HDPA 5KH3A 4A4BA 4F52B 5TBNA 5G04B 5B8DA 5KH9A 2E61A 5SVIB 2VPDA 4QF2A 5TDWA 3ZTGA 4LLBA 2M3HA 3GV4A 3FM8C 1VD4A 2LGKA 1N87A 5TABA 3LVRE 3C5KA 4LADB 2B0OE 3RPGC 3PUQA 3SUBA 2EXUA 4AYCA 5SVXA 4BHWA 1K2FA 1HYIA 3O7AA 3ZYQA 3DPLR 1X4JA 4I7CA 1MM3A 2CKLB 2VJFA 4PPEA 2NAAA 1WEMA 5C11A 4V3KC 5AIUA 4R2YA 1X4UA 2KE1A 3L11A 5B79A 2JMDA 2YW8A 1WEPA 3EB5A 3LQJA 4F1PA 2ECJA 2MA5A 5K3QA 1WENA 1DCQA 3EB6A 2YHOA 2M13A 2M85A 5LCWB 4TKPB 3KV6A 2KIZA 4O62A 5SVIA 3KV5A 4ZUXU 3DDTA 4LKAA 3ZPV1 2VPEA 4GNDA 3C6WA 5LKUA 1T1HA 1WESA 2XB1A 4GB0A 1WEOA 1WGMA 3M62A 1FP0A 3ZVZB 2XOCA 4AUQB 1JM7A 3U5PA 2MA6A 2VJEB 4UP5A 2L5UA 2VPGA 3N9QA 3FJUB 5KH7A 2KFTA 4FO9A 2ECWA 3RTRB 1HYJA 2C2LA 2L7PA 2ZETC 1WILA 3ZPVE 4FK5A 3QZVA 2IDAA 2MIQA 5B76A 1U6GB 3U5MA 2H0DB 1LDJB 1WEVA 2KWJA 5H1VA 1Z60A 3O34A 2CSYA 5B78A 3U5NA 5G05B 4A49A 3RPGB 2PUYA 4CCGX 2YHNA 3N9LA 3L1XA 4YADA 4W4UA 2BAYA 4Q6FA 1WE9A 3ASLA 5FB1A 2Y1NA 4R8PK 2E6SA 1ZBDB 2LN0A 2M1RA 5SVYA 4MVTA
chains in the Genus database with same CATH topology
4S3OC 1WEEA 3O35A 2FUUA 4A0CD 2L80A 4V3LC 2YUCA 4C9ZA 1IYMA 2VNFA 2K16A 2MD7B 4YBSA 3MHHA 4AVXA 2L43A 2EODA 4X3GA 1V87A 2G45A 5FEYA 4UI9B 5AITA 5EYAF 4WZ0A 2G6QA 3KNVA 3SOWA 2M6MA 3IHPA 4UP0A 2F42A 2RSDA 4B7YC 4YBMA 3T6RA 2YT5A 3KQIA 5JG6A 3U5OA 5B75A 2LQ6A 2MT5A 5TDRA 2LGLA 2F6JA 5D1KB 2KYUA 2KWOA 2YQMA 5DKAA 4IC2A 3LQIA 1XWHA 3PURA 2PNXA 2QJ0A 2KGGA 4AYCB 2K4DA 2I50A 3O33A 4XI1A 1Z6UA 2KWNA 2XEUA 3O36A 4I7BA 3SHBA 3I2DA 4YBTA 2D8SA 5J3XA 5D1LB 1CHCA 4N4FA 3T7LA 4WZ3B 2MD8C 5TRBA 2VPBA 2EA6A 2ECTA 2UZGA 4YC9A 2KREA 4WA6A 4I7DA 1X4IA 1Z2QA 3N9NA 3M63A 4YABA 2FUIA 2YREA 2H0DA 2K1JA 3O37A 2MNYA 1WEWA 3HCSA 4MSXA 5C13A 2VJFB 5H1UA 4S3OB 4N3WA 2LXPC 5G0FA 4GNFA 2E6RA 2YQLA 3LQHA 4GNEA 3SOUA 2AN6A 1JM7B 2LGVA 5H1TA 2VJEA 1E4UA 4YATA 2LXHC 3ZNIA 5FB0A 5H9MA 4IC3A 4LJNA 2CT2A 2L0BA 2KR4A 3HCTA 2K17A 1G25A 4GNGA 1WEUA 3FL2A 2VP7A 5D1MB 5I3LA 4BBQA 2OXQC 4B86C 5LKXA 3N9OA 3NG2A 4O64A 4R7EA 2EGPA 2YURA 5FERA 4CA1A 2L75A 3ZVYA 2KGIA 2YSJA 2ECIA 4PTBA 2FSAA 3L1ZB 2LDRA 1JOCA 4LK9A 2LRIC 3MHSA 2LV9A 4P5OB 5B77A 1RMDA 3N9PA 2LGGA 4WZ2A 1LDKC 3V43A 3M99A 1VYXA 1DVPA 3GL6A 5DINA 3HCUA 4ZDTA 4ZQLA 3LRQA 2Y1MA 1VFYA 1MM2A 4L7XA 3DQVR 2CSZA 4FIPA 2YU4A 4L58A 5LKTA 4QF3A 1WIMA 2ECNA 1F62A 2YSMA 2ECVA 2ECGA 1WFKA 2QIZA 2JRJA 2JMIA 2C2VS 4YAXA 2RI7A 2DX8A 2HYED 3N9MA 2MNZA 3SOXA 4A4CA 2F6NA 2CKLA 2YYRA 2KWKA 2Y43A 3O70A 5LKZA 1BORA 2MUMA 1FBVA 2G43A 3VK6A 3PHDA 1WEQA 3HTKC 2QICA 4NN2A 4AP4A 2KU3A 4FJCA 2JMJA 2HDPA 5KH3A 4A4BA 4F52B 5TBNA 5G04B 5B8DA 5KH9A 2VPDA 5TDWA 4QF2A 3ZTGA 4LLBA 2M3HA 3GV4A 1VD4A 2LGKA 1N87A 5TABA 3C5KA 4LADB 3RPGC 3PUQA 4AYCA 4BHWA 1K2FA 1HYIA 3O7AA 3ZYQA 3DPLR 1X4JA 4I7CA 1MM3A 2CKLB 2VJFA 4PPEA 2NAAA 1WEMA 5C11A 4V3KC 5AIUA 4R2YA 1X4UA 2KE1A 3L11A 5B79A 2JMDA 2YW8A 1WEPA 3EB5A 3LQJA 2ECJA 2MA5A 1WENA 3EB6A 2YHOA 2M85A 5LCWB 4TKPB 3KV6A 2KIZA 3KV5A 4ZUXU 4LKAA 3ZPV1 2VPEA 4GNDA 3C6WA 5LKUA 1T1HA 1WESA 2XB1A 4GB0A 1WEOA 1WGMA 3M62A 1FP0A 3ZVZB 4AUQB 1JM7A 3U5PA 2MA6A 2VJEB 4UP5A 2L5UA 2VPGA 3N9QA 5KH7A 2KFTA 4FO9A 2ECWA 3RTRB 1HYJA 2C2LA 2ZETC 1WILA 3ZPVE 4FK5A 3QZVA 2IDAA 2MIQA 5B76A 1U6GB 3U5MA 2H0DB 1LDJB 1WEVA 2KWJA 5H1VA 1Z60A 3O34A 2CSYA 5B78A 3U5NA 5G05B 4A49A 3RPGB 2PUYA 4CCGX 2YHNA 3N9LA 3L1XA 4YADA 4W4UA 2BAYA 4Q6FA 1WE9A 3ASLA 5FB1A 2Y1NA 4R8PK 2E6SA 1ZBDB 2LN0A 2M1RA 4MVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3O C;  1WEE A;  3O35 A;  2FUU A;  4A0C D;  2L80 A;  4V3L C;  2YUC A;  4C9Z A;  1IYM A;  2VNF A;  2K16 A;  2MD7 B;  4YBS A;  3MHH A;  4AVX A;  2L43 A;  2EOD A;  4X3G A;  1V87 A;  2G45 A;  5FEY A;  4UI9 B;  5AIT A;  5EYA F;  4WZ0 A;  2G6Q A;  3KNV A;  3SOW A;  2M6M A;  3IHP A;  4UP0 A;  2F42 A;  2RSD A;  4B7Y C;  4YBM A;  3T6R A;  2YT5 A;  3KQI A;  5JG6 A;  3U5O A;  5B75 A;  2LQ6 A;  2MT5 A;  5TDR A;  2LGL A;  2F6J A;  5D1K B;  2KYU A;  2KWO A;  2YQM A;  5DKA A;  4IC2 A;  3LQI A;  1XWH A;  3PUR A;  2PNX A;  2QJ0 A;  2KGG A;  4AYC B;  2K4D A;  2I50 A;  3O33 A;  4XI1 A;  1Z6U A;  2KWN A;  2XEU A;  3O36 A;  4I7B A;  3SHB A;  3I2D A;  4YBT A;  2D8S A;  5J3X A;  5D1L B;  1CHC A;  4N4F A;  3T7L A;  4WZ3 B;  2MD8 C;  5TRB A;  2VPB A;  2EA6 A;  2ECT A;  2UZG A;  4YC9 A;  2KRE A;  4WA6 A;  4I7D A;  1X4I A;  1Z2Q A;  3N9N A;  3M63 A;  4YAB A;  2FUI A;  2YRE A;  2H0D A;  2K1J A;  3O37 A;  2MNY A;  1WEW A;  3HCS A;  4MSX A;  5C13 A;  2VJF B;  5H1U A;  4S3O B;  4N3W A;  2LXP C;  5G0F A;  4GNF A;  2E6R A;  2YQL A;  3LQH A;  4GNE A;  3SOU A;  2AN6 A;  1JM7 B;  2LGV A;  5H1T A;  2VJE A;  1E4U A;  4YAT A;  2LXH C;  3ZNI A;  5FB0 A;  5H9M A;  4IC3 A;  4LJN A;  2CT2 A;  2L0B A;  2KR4 A;  3HCT A;  2K17 A;  1G25 A;  4GNG A;  1WEU A;  3FL2 A;  2VP7 A;  5D1M B;  5I3L A;  4BBQ A;  2OXQ C;  4B86 C;  5LKX A;  3N9O A;  3NG2 A;  4O64 A;  4R7E A;  2EGP A;  2YUR A;  5FER A;  4CA1 A;  2L75 A;  3ZVY A;  2KGI A;  2YSJ A;  2ECI A;  4PTB A;  2FSA A;  3L1Z B;  2LDR A;  1JOC A;  4LK9 A;  2LRI C;  3MHS A;  2LV9 A;  4P5O B;  5B77 A;  1RMD A;  3N9P A;  2LGG A;  4WZ2 A;  1LDK C;  3V43 A;  3M99 A;  1VYX A;  1DVP A;  3GL6 A;  5DIN A;  3HCU A;  4ZDT A;  4ZQL A;  3LRQ A;  2Y1M A;  1VFY A;  1MM2 A;  4L7X A;  3DQV R;  2CSZ A;  4FIP A;  2YU4 A;  4L58 A;  5LKT A;  4QF3 A;  1WIM A;  2ECN A;  1F62 A;  2YSM A;  2ECV A;  2ECG A;  1WFK A;  2QIZ A;  2JRJ A;  2JMI A;  2C2V S;  4YAX A;  2RI7 A;  2DX8 A;  2HYE D;  3N9M A;  2MNZ A;  3SOX A;  4A4C A;  2F6N A;  2CKL A;  2YYR A;  2KWK A;  2Y43 A;  3O70 A;  5LKZ A;  1BOR A;  2MUM A;  1FBV A;  2G43 A;  3VK6 A;  3PHD A;  1WEQ A;  3HTK C;  2QIC A;  4NN2 A;  4AP4 A;  2KU3 A;  4FJC A;  2JMJ A;  2HDP A;  5KH3 A;  4A4B A;  4F52 B;  5TBN A;  5G04 B;  5B8D A;  5KH9 A;  2VPD A;  5TDW A;  4QF2 A;  3ZTG A;  4LLB A;  2M3H A;  3GV4 A;  1VD4 A;  2LGK A;  1N87 A;  5TAB A;  3C5K A;  4LAD B;  3RPG C;  3PUQ A;  4AYC A;  4BHW A;  1K2F A;  1HYI A;  3O7A A;  3ZYQ A;  3DPL R;  1X4J A;  4I7C A;  1MM3 A;  2CKL B;  2VJF A;  4PPE A;  2NAA A;  1WEM A;  5C11 A;  4V3K C;  5AIU A;  4R2Y A;  1X4U A;  2KE1 A;  3L11 A;  5B79 A;  2JMD A;  2YW8 A;  1WEP A;  3EB5 A;  3LQJ A;  2ECJ A;  2MA5 A;  1WEN A;  3EB6 A;  2YHO A;  2M85 A;  5LCW B;  4TKP B;  3KV6 A;  2KIZ A;  3KV5 A;  4ZUX U;  4LKA A;  3ZPV 1;  2VPE A;  4GND A;  3C6W A;  5LKU A;  1T1H A;  1WES A;  2XB1 A;  4GB0 A;  1WEO A;  1WGM A;  3M62 A;  1FP0 A;  3ZVZ B;  4AUQ B;  1JM7 A;  3U5P A;  2MA6 A;  2VJE B;  4UP5 A;  2L5U A;  2VPG A;  3N9Q A;  5KH7 A;  2KFT A;  4FO9 A;  2ECW A;  3RTR B;  1HYJ A;  2C2L A;  2ZET C;  1WIL A;  3ZPV E;  4FK5 A;  3QZV A;  2IDA A;  2MIQ A;  5B76 A;  1U6G B;  3U5M A;  2H0D B;  1LDJ B;  1WEV A;  2KWJ A;  5H1V A;  1Z60 A;  3O34 A;  2CSY A;  5B78 A;  3U5N A;  5G05 B;  4A49 A;  3RPG B;  2PUY A;  4CCG X;  2YHN A;  3N9L A;  3L1X A;  4YAD A;  4W4U A;  2BAY A;  4Q6F A;  1WE9 A;  3ASL A;  5FB1 A;  2Y1N A;  4R8P K;  2E6S A;  1ZBD B;  2LN0 A;  2M1R A;  4MVT A; 
#chains in the Genus database with same CATH topology
 4S3O C;  3LJU X;  1WEE A;  3O35 A;  2FUU A;  4A0C D;  2L80 A;  4V3L C;  2YUC A;  4C9Z A;  2CRW A;  1IYM A;  2VNF A;  2K16 A;  1MBM A;  2MD7 B;  4YBS A;  3MHH A;  2OWA A;  4AVX A;  2L43 A;  2EOD A;  3FEH A;  4X3G A;  1V87 A;  2G45 A;  5FEY A;  4UI9 B;  5AIT A;  5EYA F;  4WZ0 A;  3KDE C;  2G6Q A;  3KNV A;  2MKE A;  3SOW A;  2M6M A;  3IHP A;  4UP0 A;  2F42 A;  4OGE A;  2IQJ A;  2RSD A;  4B7Y C;  4YBM A;  3T6R A;  2YT5 A;  3KQI A;  5JG6 A;  3U5O A;  5B75 A;  2LQ6 A;  3LDY A;  4OGC A;  2MT5 A;  3Q1D A;  5TDR A;  2LGL A;  2F6J A;  5D1K B;  2KYU A;  2KWO A;  2YQM A;  5DKA A;  4IC2 A;  3LQI A;  1XWH A;  3PUR A;  2PNX A;  2QJ0 A;  2KGG A;  4AYC B;  2K4D A;  3FAO A;  2I50 A;  3O33 A;  4XI1 A;  1Z6U A;  2KWN A;  2XEU A;  3O36 A;  4I7B A;  3SHB A;  3I2D A;  4YBT A;  2D8S A;  5J3X A;  3PLW A;  5D1L B;  1CHC A;  4N4F A;  2YVR A;  3T7L A;  4WZ3 B;  2MD8 C;  2DSM A;  5TRB A;  2VPB A;  2EA6 A;  2ECT A;  2UZG A;  4YC9 A;  3M7K A;  2XOZ A;  2KRE A;  4WA6 A;  4I7D A;  1X4I A;  1Z2Q A;  3N9N A;  3M63 A;  4YAB A;  2FUI A;  2YRE A;  2H0D A;  2K1J A;  3O37 A;  2MNY A;  2FFW A;  3E2D A;  1WEW A;  3HCS A;  4MSX A;  5C13 A;  4QQ4 A;  2VJF B;  5H1U A;  4S3O B;  4N3W A;  2LXP C;  5G0F A;  4GNF A;  2E6R A;  2YQL A;  3LQH A;  4GNE A;  3SOU A;  2AN6 A;  1JM7 B;  2LGV A;  5H1T A;  2VJE A;  1E4U A;  4YAT A;  2LXH C;  3ZNI A;  5FB0 A;  2D8U A;  2KKX A;  5H9M A;  4IC3 A;  4LJN A;  2KKY A;  2CT2 A;  2L0B A;  3LVQ E;  2KR4 A;  3O47 A;  3HCT A;  2K17 A;  1G25 A;  4GNG A;  3JUE A;  1WEU A;  2XOY A;  3FL2 A;  2CON A;  2VP7 A;  5D1M B;  5I3L A;  4BBQ A;  2OXQ C;  4B86 C;  3DWD A;  5LKX A;  3N9O A;  3NG2 A;  4O64 A;  2JM3 A;  4R7E A;  2EGP A;  2YUR A;  5FER A;  4CA1 A;  2L75 A;  3ZVY A;  2KGI A;  2YSJ A;  3T9K A;  2ECI A;  4H9D A;  4PTB A;  2FSA A;  3L1Z B;  2LDR A;  1JOC A;  4LK9 A;  2LRI C;  3MHS A;  4Z0R A;  2LV9 A;  4P5O B;  5B77 A;  2RR4 A;  1RMD A;  3N9P A;  2LGG A;  4WZ2 A;  1LDK C;  3V43 A;  3M99 A;  1VYX A;  1DVP A;  3GL6 A;  5DIN A;  3HCU A;  4ZDT A;  3MDB C;  2FD4 A;  4ZQL A;  3LRQ A;  2Y1M A;  1VFY A;  1MM2 A;  4L7X A;  3DQV R;  2CSZ A;  2LAU A;  4FIP A;  2YU4 A;  4L58 A;  5LKT A;  4QF3 A;  1WIM A;  2ECN A;  1F62 A;  2P57 A;  2YSM A;  2ECV A;  2ECG A;  1WFK A;  2QIZ A;  2JRJ A;  2JMI A;  2C2V S;  2CSV A;  3H7H A;  4YAX A;  2CRR A;  2RI7 A;  2XP0 A;  2DX8 A;  2HYE D;  2JUN A;  4Z0O A;  3N9M A;  2MNZ A;  3SOX A;  4A4C A;  2F6N A;  2CKL A;  2YYR A;  2KWK A;  2Y43 A;  3O70 A;  5LKZ A;  1BOR A;  2EGM A;  2DJA A;  1FBV A;  2G43 A;  2MUM A;  3VK6 A;  3FAN A;  3PHD A;  1WEQ A;  3HTK C;  2QIC A;  4NN2 A;  4AP4 A;  2KU3 A;  4FJC A;  2JMJ A;  2HDP A;  5KH3 A;  4A4B A;  4F52 B;  5TBN A;  5G04 B;  5B8D A;  5KH9 A;  2E61 A;  5SVI B;  2VPD A;  4QF2 A;  5TDW A;  3ZTG A;  4LLB A;  2M3H A;  3GV4 A;  3FM8 C;  1VD4 A;  2LGK A;  1N87 A;  5TAB A;  3LVR E;  3C5K A;  4LAD B;  2B0O E;  3RPG C;  3PUQ A;  3SUB A;  2EXU A;  4AYC A;  5SVX A;  4BHW A;  1K2F A;  1HYI A;  3O7A A;  3ZYQ A;  3DPL R;  1X4J A;  4I7C A;  1MM3 A;  2CKL B;  2VJF A;  4PPE A;  2NAA A;  1WEM A;  5C11 A;  4V3K C;  5AIU A;  4R2Y A;  1X4U A;  2KE1 A;  3L11 A;  5B79 A;  2JMD A;  2YW8 A;  1WEP A;  3EB5 A;  3LQJ A;  4F1P A;  2ECJ A;  2MA5 A;  5K3Q A;  1WEN A;  1DCQ A;  3EB6 A;  2YHO A;  2M13 A;  2M85 A;  5LCW B;  4TKP B;  3KV6 A;  2KIZ A;  4O62 A;  5SVI A;  3KV5 A;  4ZUX U;  3DDT A;  4LKA A;  3ZPV 1;  2VPE A;  4GND A;  3C6W A;  5LKU A;  1T1H A;  1WES A;  2XB1 A;  4GB0 A;  1WEO A;  1WGM A;  3M62 A;  1FP0 A;  3ZVZ B;  2XOC A;  4AUQ B;  1JM7 A;  3U5P A;  2MA6 A;  2VJE B;  4UP5 A;  2L5U A;  2VPG A;  3N9Q A;  3FJU B;  5KH7 A;  2KFT A;  4FO9 A;  2ECW A;  3RTR B;  1HYJ A;  2C2L A;  2L7P A;  2ZET C;  1WIL A;  3ZPV E;  4FK5 A;  3QZV A;  2IDA A;  2MIQ A;  5B76 A;  1U6G B;  3U5M A;  2H0D B;  1LDJ B;  1WEV A;  2KWJ A;  5H1V A;  1Z60 A;  3O34 A;  2CSY A;  5B78 A;  3U5N A;  5G05 B;  4A49 A;  3RPG B;  2PUY A;  4CCG X;  2YHN A;  3N9L A;  3L1X A;  4YAD A;  4W4U A;  2BAY A;  4Q6F A;  1WE9 A;  3ASL A;  5FB1 A;  2Y1N A;  4R8P K;  2E6S A;  1ZBD B;  2LN0 A;  2M1R A;  5SVY A;  4MVT A; 
#chains in the Genus database with same CATH homology
 4S3O C;  1WEE A;  3O35 A;  2FUU A;  4A0C D;  2L80 A;  4V3L C;  2YUC A;  4C9Z A;  1IYM A;  2VNF A;  2K16 A;  2MD7 B;  4YBS A;  3MHH A;  4AVX A;  2L43 A;  2EOD A;  4X3G A;  1V87 A;  2G45 A;  5FEY A;  4UI9 B;  5AIT A;  5EYA F;  4WZ0 A;  2G6Q A;  3KNV A;  3SOW A;  2M6M A;  3IHP A;  4UP0 A;  2F42 A;  2RSD A;  4B7Y C;  4YBM A;  3T6R A;  2YT5 A;  3KQI A;  5JG6 A;  3U5O A;  5B75 A;  2LQ6 A;  2MT5 A;  5TDR A;  2LGL A;  2F6J A;  5D1K B;  2KYU A;  2KWO A;  2YQM A;  5DKA A;  4IC2 A;  3LQI A;  1XWH A;  3PUR A;  2PNX A;  2QJ0 A;  2KGG A;  4AYC B;  2K4D A;  2I50 A;  3O33 A;  4XI1 A;  1Z6U A;  2KWN A;  2XEU A;  3O36 A;  4I7B A;  3SHB A;  3I2D A;  4YBT A;  2D8S A;  5J3X A;  5D1L B;  1CHC A;  4N4F A;  3T7L A;  4WZ3 B;  2MD8 C;  5TRB A;  2VPB A;  2EA6 A;  2ECT A;  2UZG A;  4YC9 A;  2KRE A;  4WA6 A;  4I7D A;  1X4I A;  1Z2Q A;  3N9N A;  3M63 A;  4YAB A;  2FUI A;  2YRE A;  2H0D A;  2K1J A;  3O37 A;  2MNY A;  1WEW A;  3HCS A;  4MSX A;  5C13 A;  2VJF B;  5H1U A;  4S3O B;  4N3W A;  2LXP C;  5G0F A;  4GNF A;  2E6R A;  2YQL A;  3LQH A;  4GNE A;  3SOU A;  2AN6 A;  1JM7 B;  2LGV A;  5H1T A;  2VJE A;  1E4U A;  4YAT A;  2LXH C;  3ZNI A;  5FB0 A;  5H9M A;  4IC3 A;  4LJN A;  2CT2 A;  2L0B A;  2KR4 A;  3HCT A;  2K17 A;  1G25 A;  4GNG A;  1WEU A;  3FL2 A;  2VP7 A;  5D1M B;  5I3L A;  4BBQ A;  2OXQ C;  4B86 C;  5LKX A;  3N9O A;  3NG2 A;  4O64 A;  4R7E A;  2EGP A;  2YUR A;  5FER A;  4CA1 A;  2L75 A;  3ZVY A;  2KGI A;  2YSJ A;  2ECI A;  4PTB A;  2FSA A;  3L1Z B;  2LDR A;  1JOC A;  4LK9 A;  2LRI C;  3MHS A;  2LV9 A;  4P5O B;  5B77 A;  1RMD A;  3N9P A;  2LGG A;  4WZ2 A;  1LDK C;  3V43 A;  3M99 A;  1VYX A;  1DVP A;  3GL6 A;  5DIN A;  3HCU A;  4ZDT A;  4ZQL A;  3LRQ A;  2Y1M A;  1VFY A;  1MM2 A;  4L7X A;  3DQV R;  2CSZ A;  4FIP A;  2YU4 A;  4L58 A;  5LKT A;  4QF3 A;  1WIM A;  2ECN A;  1F62 A;  2YSM A;  2ECV A;  2ECG A;  1WFK A;  2QIZ A;  2JRJ A;  2JMI A;  2C2V S;  4YAX A;  2RI7 A;  2DX8 A;  2HYE D;  3N9M A;  2MNZ A;  3SOX A;  4A4C A;  2F6N A;  2CKL A;  2YYR A;  2KWK A;  2Y43 A;  3O70 A;  5LKZ A;  1BOR A;  2MUM A;  1FBV A;  2G43 A;  3VK6 A;  3PHD A;  1WEQ A;  3HTK C;  2QIC A;  4NN2 A;  4AP4 A;  2KU3 A;  4FJC A;  2JMJ A;  2HDP A;  5KH3 A;  4A4B A;  4F52 B;  5TBN A;  5G04 B;  5B8D A;  5KH9 A;  2VPD A;  5TDW A;  4QF2 A;  3ZTG A;  4LLB A;  2M3H A;  3GV4 A;  1VD4 A;  2LGK A;  1N87 A;  5TAB A;  3C5K A;  4LAD B;  3RPG C;  3PUQ A;  4AYC A;  4BHW A;  1K2F A;  1HYI A;  3O7A A;  3ZYQ A;  3DPL R;  1X4J A;  4I7C A;  1MM3 A;  2CKL B;  2VJF A;  4PPE A;  2NAA A;  1WEM A;  5C11 A;  4V3K C;  5AIU A;  4R2Y A;  1X4U A;  2KE1 A;  3L11 A;  5B79 A;  2JMD A;  2YW8 A;  1WEP A;  3EB5 A;  3LQJ A;  2ECJ A;  2MA5 A;  1WEN A;  3EB6 A;  2YHO A;  2M85 A;  5LCW B;  4TKP B;  3KV6 A;  2KIZ A;  3KV5 A;  4ZUX U;  4LKA A;  3ZPV 1;  2VPE A;  4GND A;  3C6W A;  5LKU A;  1T1H A;  1WES A;  2XB1 A;  4GB0 A;  1WEO A;  1WGM A;  3M62 A;  1FP0 A;  3ZVZ B;  4AUQ B;  1JM7 A;  3U5P A;  2MA6 A;  2VJE B;  4UP5 A;  2L5U A;  2VPG A;  3N9Q A;  5KH7 A;  2KFT A;  4FO9 A;  2ECW A;  3RTR B;  1HYJ A;  2C2L A;  2ZET C;  1WIL A;  3ZPV E;  4FK5 A;  3QZV A;  2IDA A;  2MIQ A;  5B76 A;  1U6G B;  3U5M A;  2H0D B;  1LDJ B;  1WEV A;  2KWJ A;  5H1V A;  1Z60 A;  3O34 A;  2CSY A;  5B78 A;  3U5N A;  5G05 B;  4A49 A;  3RPG B;  2PUY A;  4CCG X;  2YHN A;  3N9L A;  3L1X A;  4YAD A;  4W4U A;  2BAY A;  4Q6F A;  1WE9 A;  3ASL A;  5FB1 A;  2Y1N A;  4R8P K;  2E6S A;  1ZBD B;  2LN0 A;  2M1R A;  4MVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...