5TBNA

Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
GHMDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription / structural protein
molecule keywords PHD finger protein 20
publication title PHF20 Readers Link Methylation of Histone H3K4 and p53 with H4K16 Acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tbnA00
2UZGA 1DVPA 1VYXA 2CKLB 5G05B 2BAYA 2M1RA 4ZUXU 3M63A 3RTRB 1Z60A 2IDAA 2M3HA 2VP7A 3DQVR 3NG2A 1WEVA 4YBMA 2MIQA 4AUQB 2ZETC 2NAAA 4UP5A 1IYMA 4QF3A 2XB1A 3N9PA 2LGVA 2VPEA 2K4DA 4AVXA 2QIZA 4ZDTA 5J3XA 3O36A 2K1JA 3N9QA 4ZQLA 4P5OB 2YW8A 4YATA 2G45A 2L43A 4TKPB 4A4CA 4YBTA 4A0CD 2HDPA 5H1UA 3RPGC 2CSZA 1LDKC 4GNFA 3PURA 1K2FA 1WEPA 2CKLA 1JOCA 2VJFB 4GNDA 4PPEA 4BBQA 1MM2A 4I7DA 3KV6A 2F6JA 3SOUA 2CT2A 2G43A 5KH7A 5D1MB 3I2DA 2I50A 2MD7B 1WFKA 2YYRA 2LRIC 5B78A 4QF2A 2KWKA 1ZBDB 3PHDA 2JRJA 4FO9A 5FEYA 1WGMA 1WEEA 2YU4A 5D1LB 2FSAA 4LKAA 2KIZA 4L7XA 2OXQC 3U5OA 1F62A 2YURA 2LGLA 5LKZA 3T7LA 2L80A 2F6NA 2HYED 5H1TA 4LJNA 3N9LA 2YSJA 3KV5A 2MA6A 3M99A 1BORA 1U6GB 5FB0A 2ECWA 2C2VS 3EB5A 2JMJA 2ECIA 2YQMA 1RMDA 5B76A 2VJFA 4XI1A 2LDRA 1E4UA 2PUYA 3N9MA 1N87A 4N4FA 3V43A 4GB0A 3C6WA 5EYAF 4YC9A 2MNZA 4FJCA 2KGGA 3HCUA 4AYCB 1CHCA 5I3LA 3SHBA 2PNXA 2YREA 2M6MA 4LADB 2M85A 5C13A 1X4JA 4X3GA 4YBSA 2LQ6A 3L1XA 2VPGA 3ZVZB 2ECNA 1WEMA 3T6RA 4WA6A 4V3KC 5TDWA 4UP0A 3C5KA 2ECGA 4NN2A 3KNVA 4IC3A 1HYIA 2ECTA 2E6SA 5DKAA 2RI7A 2LN0A 2QICA 2D8SA 2MT5A 4UI9B 3ZPVE 1WEOA 3ZPV1 4L58A 4F52B 1WILA 4AYCA 2ECJA 3GV4A 3U5MA 4MSXA 4S3OB 2LXHC 2E6RA 2XEUA 4IC2A 3L1ZB 2YQLA 3ZYQA 3RPGB 2EGPA 1WEUA 3O35A 3VK6A 5DINA 4WZ3B 2YHNA 1MM3A 4Q6FA 5H1VA 4BHWA 5B75A 1WEWA 2FUIA 5B79A 3ZVYA 2KGIA 3PUQA 2G6QA 2DX8A 3O7AA 5C11A 5H9MA 4WZ2A 3HTKC 4V3LC 3SOWA 4CCGX 3MHSA 2KREA 3L11A 4CA1A 3LRQA 4R2YA 4LLBA 2MA5A 2VJEB 2KWNA 3ASLA 5KH9A 3QZVA 4YAXA 5LKUA 1XWHA 2Y43A 5TDRA 2F42A 3LQIA 2YSMA 2JMDA 2L0BA 2EA6A 3ZTGA 1HYJA 2ECVA 2K17A 4YADA 1WESA 4A4BA 2VPBA 2KYUA 2YHOA 3N9NA 5KH3A 4WZ0A 5AIUA 1FBVA 4C9ZA 4B86C 2KR4A 2KWJA 5B77A 3N9OA 2FUUA 2MUMA 4O64A 5FERA 2MD8C 2VJEA 2C2LA 5B8DA 2JMIA 3GL6A 2Y1NA 1JM7B 4FIPA 3O37A 4GNGA 2KFTA 3ZNIA 3IHPA 2LGKA 4YABA 2EODA 1G25A 4MVTA 1VFYA 5D1KB 1WE9A 1FP0A 3O70A 4S3OC 1V87A 2LGGA 4LK9A 2YUCA 1X4IA 2KU3A 2QJ0A 1LDJB 2RSDA 3FL2A 3LQHA 2YT5A 1WENA 2H0DB 4N3WA 3SOXA 1X4UA 4W4UA 3DPLR 4R8PK 4PTBA 4GNEA 2CSYA 2Y1MA 2AN6A 3U5NA 4I7CA 1JM7A 2K16A 3LQJA 4AP4A 5LKXA 2LXPC 5FB1A 3KQIA 5LKTA 5LCWB 3EB6A 3O33A 2L75A 1T1HA 1WIMA 5G04B 2KWOA 2L5UA 4B7YC 5TBNA 1Z6UA 2LV9A 1WEQA 1Z2QA 3O34A 5TABA 5JG6A 4FK5A 2VNFA 3M62A 3MHHA 4R7EA 5AITA 3HCSA 2VPDA 3HCTA 5G0FA 2MNYA 1VD4A 4A49A 2H0DA 2KE1A 3U5PA 5TRBA 4I7BA
chains in the Genus database with same CATH superfamily
2UZGA 1DVPA 1VYXA 2E61A 2CKLB 5G05B 3FAOA 2BAYA 2M1RA 4ZUXU 3M63A 3RTRB 2XOZA 1Z60A 2IDAA 2M3HA 3E2DA 2P57A 2VP7A 3DQVR 3NG2A 1WEVA 4YBMA 2MIQA 3DWDA 4AUQB 2ZETC 2NAAA 4UP5A 1IYMA 4QF3A 2XB1A 3N9PA 2LGVA 2VPEA 2K4DA 4AVXA 2QIZA 4OGEA 4ZDTA 5J3XA 3O36A 2K1JA 3N9QA 4ZQLA 4P5OB 2YVRA 2YW8A 4YATA 3MDBC 2G45A 2L43A 3FM8C 4TKPB 4A4CA 4YBTA 4A0CD 2HDPA 5H1UA 3RPGC 2CSZA 1LDKC 4GNFA 3PURA 1K2FA 1WEPA 2CKLA 1JOCA 4PPEA 2VJFB 3LVQE 3PLWA 1MM2A 4GNDA 4I7DA 3KV6A 2F6JA 3SOUA 3LDYA 2CT2A 2G43A 5KH7A 5D1MB 3I2DA 2I50A 2MD7B 1WFKA 2YYRA 2LRIC 5B78A 4QF2A 2FD4A 2KWKA 1ZBDB 3PHDA 2JRJA 2L7PA 4FO9A 2D8UA 5FEYA 5SVIB 1WGMA 1WEEA 2YU4A 5D1LB 2FSAA 4LKAA 2KIZA 2JM3A 2OXQC 4L7XA 3U5OA 1F62A 2YURA 3T9KA 2LGLA 4H9DA 5LKZA 3T7LA 2L80A 2F6NA 2HYED 4O62A 5H1TA 4LJNA 3N9LA 2YSJA 3KV5A 2MA6A 3M99A 1BORA 1U6GB 5FB0A 2ECWA 2C2VS 3EB5A 2JMJA 2ECIA 2YQMA 1RMDA 5B76A 2VJFA 4XI1A 2LDRA 1E4UA 5K3QA 2PUYA 3N9MA 4Z0OA 1N87A 4N4FA 3V43A 4GB0A 3C6WA 1DCQA 5EYAF 4YC9A 2MNZA 4FJCA 2KGGA 3H7HA 3HCUA 4AYCB 1CHCA 5I3LA 5SVIA 3SHBA 2PNXA 2YREA 2M6MA 2MKEA 2XP0A 4LADB 2M85A 5C13A 1X4JA 4X3GA 2OWAA 4YBSA 2CRWA 2LQ6A 3L1XA 2VPGA 3ZVZB 2ECNA 1WEMA 3T6RA 4WA6A 4V3KC 5TDWA 4UP0A 3C5KA 2ECGA 2CRRA 4NN2A 3KNVA 2EGMA 4IC3A 1HYIA 2ECTA 2E6SA 5DKAA 2RI7A 2LN0A 2QICA 2EXUA 2D8SA 2MT5A 4UI9B 3ZPVE 1WEOA 3ZPV1 4L58A 4F52B 1WILA 4AYCA 2ECJA 3GV4A 3U5MA 4MSXA 4S3OB 2LXHC 2E6RA 2XEUA 4IC2A 3L1ZB 2YQLA 3ZYQA 3RPGB 2EGPA 1WEUA 3O35A 3SUBA 3VK6A 5DINA 4WZ3B 2YHNA 1MM3A 4Q6FA 5H1VA 4BHWA 5B75A 1WEWA 2DSMA 2FUIA 2KKXA 5B79A 2DJAA 2FFWA 3ZVYA 2KGIA 3PUQA 2G6QA 2DX8A 3O7AA 5C11A 5H9MA 4WZ2A 3HTKC 4V3LC 3SOWA 4CCGX 2XOCA 3Q1DA 2JUNA 3MHSA 3FJUB 2KREA 3L11A 4CA1A 3LRQA 4R2YA 4LLBA 2MA5A 2VJEB 2KWNA 3ASLA 5KH9A 1MBMA 2RR4A 3QZVA 4YAXA 5LKUA 4Z0RA 1XWHA 2Y43A 3LJUX 5TDRA 2F42A 3LQIA 4BBQA 2YSMA 3DDTA 2JMDA 2L0BA 2EA6A 3ZTGA 1HYJA 2ECVA 2K17A 4YADA 1WESA 4A4BA 2VPBA 2KYUA 2YHOA 2CSVA 3N9NA 5KH3A 4WZ0A 4F1PA 5AIUA 1FBVA 3KDEC 4C9ZA 3FEHA 4B86C 2KR4A 2KWJA 5B77A 3N9OA 2FUUA 2MUMA 4O64A 5SVYA 5FERA 4QQ4A 2MD8C 2VJEA 2C2LA 5B8DA 2JMIA 3GL6A 2Y1NA 1JM7B 4FIPA 3O37A 4GNGA 2KFTA 3ZNIA 3IHPA 2LGKA 4YABA 2CONA 2EODA 1G25A 4MVTA 1VFYA 5D1KB 2LAUA 1WE9A 1FP0A 3O70A 4S3OC 1V87A 2LGGA 4LK9A 2YUCA 1X4IA 2KU3A 2QJ0A 1LDJB 2RSDA 3FL2A 3LQHA 2YT5A 1WENA 2H0DB 2M13A 4N3WA 3SOXA 1X4UA 4W4UA 3DPLR 3M7KA 4R8PK 4PTBA 4GNEA 2CSYA 2Y1MA 2AN6A 3U5NA 4I7CA 1JM7A 2K16A 3LQJA 4AP4A 2XOYA 2LXPC 5LKXA 5FB1A 3KQIA 5LKTA 5LCWB 3EB6A 3O33A 2L75A 5SVXA 4OGCA 1T1HA 1WIMA 2KKYA 5G04B 2KWOA 2L5UA 4B7YC 5TBNA 1Z6UA 2LV9A 1WEQA 1Z2QA 3O34A 5TABA 5JG6A 4FK5A 2VNFA 3M62A 3MHHA 4R7EA 5AITA 3HCSA 2VPDA 3HCTA 5G0FA 2MNYA 3O47A 1VD4A 2B0OE 4A49A 2H0DA 2IQJA 3JUEA 2KE1A 3U5PA 3FANA 5TRBA 3LVRE 4I7BA
chains in the Genus database with same CATH topology
2UZGA 1DVPA 1VYXA 2CKLB 5G05B 2BAYA 2M1RA 4ZUXU 3M63A 3RTRB 1Z60A 2IDAA 2M3HA 2VP7A 3DQVR 3NG2A 1WEVA 4YBMA 2MIQA 4AUQB 2ZETC 2NAAA 4UP5A 1IYMA 4QF3A 2XB1A 3N9PA 2LGVA 2VPEA 2K4DA 4AVXA 2QIZA 4ZDTA 5J3XA 3O36A 2K1JA 3N9QA 4ZQLA 4P5OB 2YW8A 4YATA 2G45A 2L43A 4TKPB 4A4CA 4YBTA 4A0CD 2HDPA 5H1UA 3RPGC 2CSZA 1LDKC 4GNFA 3PURA 1K2FA 1WEPA 2CKLA 1JOCA 2VJFB 4GNDA 4PPEA 4BBQA 1MM2A 4I7DA 3KV6A 2F6JA 3SOUA 2CT2A 2G43A 5KH7A 5D1MB 3I2DA 2I50A 2MD7B 1WFKA 2YYRA 2LRIC 5B78A 4QF2A 2KWKA 1ZBDB 3PHDA 2JRJA 4FO9A 5FEYA 1WGMA 1WEEA 2YU4A 5D1LB 2FSAA 4LKAA 2KIZA 4L7XA 2OXQC 3U5OA 1F62A 2YURA 2LGLA 5LKZA 3T7LA 2L80A 2F6NA 2HYED 5H1TA 4LJNA 3N9LA 2YSJA 3KV5A 2MA6A 3M99A 1BORA 1U6GB 5FB0A 2ECWA 2C2VS 3EB5A 2JMJA 2ECIA 2YQMA 1RMDA 5B76A 2VJFA 4XI1A 2LDRA 1E4UA 2PUYA 3N9MA 1N87A 4N4FA 3V43A 4GB0A 3C6WA 5EYAF 4YC9A 2MNZA 4FJCA 2KGGA 3HCUA 4AYCB 1CHCA 5I3LA 3SHBA 2PNXA 2YREA 2M6MA 4LADB 2M85A 5C13A 1X4JA 4X3GA 4YBSA 2LQ6A 3L1XA 2VPGA 3ZVZB 2ECNA 1WEMA 3T6RA 4WA6A 4V3KC 5TDWA 4UP0A 3C5KA 2ECGA 4NN2A 3KNVA 4IC3A 1HYIA 2ECTA 2E6SA 5DKAA 2RI7A 2LN0A 2QICA 2D8SA 2MT5A 4UI9B 3ZPVE 1WEOA 3ZPV1 4L58A 4F52B 1WILA 4AYCA 2ECJA 3GV4A 3U5MA 4MSXA 4S3OB 2LXHC 2E6RA 2XEUA 4IC2A 3L1ZB 2YQLA 3ZYQA 3RPGB 2EGPA 1WEUA 3O35A 3VK6A 5DINA 4WZ3B 2YHNA 1MM3A 4Q6FA 5H1VA 4BHWA 5B75A 1WEWA 2FUIA 5B79A 3ZVYA 2KGIA 3PUQA 2G6QA 2DX8A 3O7AA 5C11A 5H9MA 4WZ2A 3HTKC 4V3LC 3SOWA 4CCGX 3MHSA 2KREA 3L11A 4CA1A 3LRQA 4R2YA 4LLBA 2MA5A 2VJEB 2KWNA 3ASLA 5KH9A 3QZVA 4YAXA 5LKUA 1XWHA 2Y43A 5TDRA 2F42A 3LQIA 2YSMA 2JMDA 2L0BA 2EA6A 3ZTGA 1HYJA 2ECVA 2K17A 4YADA 1WESA 4A4BA 2VPBA 2KYUA 2YHOA 3N9NA 5KH3A 4WZ0A 5AIUA 1FBVA 4C9ZA 4B86C 2KR4A 2KWJA 5B77A 3N9OA 2FUUA 2MUMA 4O64A 5FERA 2MD8C 2VJEA 2C2LA 5B8DA 2JMIA 3GL6A 2Y1NA 1JM7B 4FIPA 3O37A 4GNGA 2KFTA 3ZNIA 3IHPA 2LGKA 4YABA 2EODA 1G25A 4MVTA 1VFYA 5D1KB 1WE9A 1FP0A 3O70A 4S3OC 1V87A 2LGGA 4LK9A 2YUCA 1X4IA 2KU3A 2QJ0A 1LDJB 2RSDA 3FL2A 3LQHA 2YT5A 1WENA 2H0DB 4N3WA 3SOXA 1X4UA 4W4UA 3DPLR 4R8PK 4PTBA 4GNEA 2CSYA 2Y1MA 2AN6A 3U5NA 4I7CA 1JM7A 2K16A 3LQJA 4AP4A 5LKXA 2LXPC 5FB1A 3KQIA 5LKTA 5LCWB 3EB6A 3O33A 2L75A 1T1HA 1WIMA 5G04B 2KWOA 2L5UA 4B7YC 5TBNA 1Z6UA 2LV9A 1WEQA 1Z2QA 3O34A 5TABA 5JG6A 4FK5A 2VNFA 3M62A 3MHHA 4R7EA 5AITA 3HCSA 2VPDA 3HCTA 5G0FA 2MNYA 1VD4A 4A49A 2H0DA 2KE1A 3U5PA 5TRBA 4I7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZG A;  1DVP A;  1VYX A;  2CKL B;  5G05 B;  2BAY A;  2M1R A;  4ZUX U;  3M63 A;  3RTR B;  1Z60 A;  2IDA A;  2M3H A;  2VP7 A;  3DQV R;  3NG2 A;  1WEV A;  4YBM A;  2MIQ A;  4AUQ B;  2ZET C;  2NAA A;  4UP5 A;  1IYM A;  4QF3 A;  2XB1 A;  3N9P A;  2LGV A;  2VPE A;  2K4D A;  4AVX A;  2QIZ A;  4ZDT A;  5J3X A;  3O36 A;  2K1J A;  3N9Q A;  4ZQL A;  4P5O B;  2YW8 A;  4YAT A;  2G45 A;  2L43 A;  4TKP B;  4A4C A;  4YBT A;  4A0C D;  2HDP A;  5H1U A;  3RPG C;  2CSZ A;  1LDK C;  4GNF A;  3PUR A;  1K2F A;  1WEP A;  2CKL A;  1JOC A;  2VJF B;  4GND A;  4PPE A;  4BBQ A;  1MM2 A;  4I7D A;  3KV6 A;  2F6J A;  3SOU A;  2CT2 A;  2G43 A;  5KH7 A;  5D1M B;  3I2D A;  2I50 A;  2MD7 B;  1WFK A;  2YYR A;  2LRI C;  5B78 A;  4QF2 A;  2KWK A;  1ZBD B;  3PHD A;  2JRJ A;  4FO9 A;  5FEY A;  1WGM A;  1WEE A;  2YU4 A;  5D1L B;  2FSA A;  4LKA A;  2KIZ A;  4L7X A;  2OXQ C;  3U5O A;  1F62 A;  2YUR A;  2LGL A;  5LKZ A;  3T7L A;  2L80 A;  2F6N A;  2HYE D;  5H1T A;  4LJN A;  3N9L A;  2YSJ A;  3KV5 A;  2MA6 A;  3M99 A;  1BOR A;  1U6G B;  5FB0 A;  2ECW A;  2C2V S;  3EB5 A;  2JMJ A;  2ECI A;  2YQM A;  1RMD A;  5B76 A;  2VJF A;  4XI1 A;  2LDR A;  1E4U A;  2PUY A;  3N9M A;  1N87 A;  4N4F A;  3V43 A;  4GB0 A;  3C6W A;  5EYA F;  4YC9 A;  2MNZ A;  4FJC A;  2KGG A;  3HCU A;  4AYC B;  1CHC A;  5I3L A;  3SHB A;  2PNX A;  2YRE A;  2M6M A;  4LAD B;  2M85 A;  5C13 A;  1X4J A;  4X3G A;  4YBS A;  2LQ6 A;  3L1X A;  2VPG A;  3ZVZ B;  2ECN A;  1WEM A;  3T6R A;  4WA6 A;  4V3K C;  5TDW A;  4UP0 A;  3C5K A;  2ECG A;  4NN2 A;  3KNV A;  4IC3 A;  1HYI A;  2ECT A;  2E6S A;  5DKA A;  2RI7 A;  2LN0 A;  2QIC A;  2D8S A;  2MT5 A;  4UI9 B;  3ZPV E;  1WEO A;  3ZPV 1;  4L58 A;  4F52 B;  1WIL A;  4AYC A;  2ECJ A;  3GV4 A;  3U5M A;  4MSX A;  4S3O B;  2LXH C;  2E6R A;  2XEU A;  4IC2 A;  3L1Z B;  2YQL A;  3ZYQ A;  3RPG B;  2EGP A;  1WEU A;  3O35 A;  3VK6 A;  5DIN A;  4WZ3 B;  2YHN A;  1MM3 A;  4Q6F A;  5H1V A;  4BHW A;  5B75 A;  1WEW A;  2FUI A;  5B79 A;  3ZVY A;  2KGI A;  3PUQ A;  2G6Q A;  2DX8 A;  3O7A A;  5C11 A;  5H9M A;  4WZ2 A;  3HTK C;  4V3L C;  3SOW A;  4CCG X;  3MHS A;  2KRE A;  3L11 A;  4CA1 A;  3LRQ A;  4R2Y A;  4LLB A;  2MA5 A;  2VJE B;  2KWN A;  3ASL A;  5KH9 A;  3QZV A;  4YAX A;  5LKU A;  1XWH A;  2Y43 A;  5TDR A;  2F42 A;  3LQI A;  2YSM A;  2JMD A;  2L0B A;  2EA6 A;  3ZTG A;  1HYJ A;  2ECV A;  2K17 A;  4YAD A;  1WES A;  4A4B A;  2VPB A;  2KYU A;  2YHO A;  3N9N A;  5KH3 A;  4WZ0 A;  5AIU A;  1FBV A;  4C9Z A;  4B86 C;  2KR4 A;  2KWJ A;  5B77 A;  3N9O A;  2FUU A;  2MUM A;  4O64 A;  5FER A;  2MD8 C;  2VJE A;  2C2L A;  5B8D A;  2JMI A;  3GL6 A;  2Y1N A;  1JM7 B;  4FIP A;  3O37 A;  4GNG A;  2KFT A;  3ZNI A;  3IHP A;  2LGK A;  4YAB A;  2EOD A;  1G25 A;  4MVT A;  1VFY A;  5D1K B;  1WE9 A;  1FP0 A;  3O70 A;  4S3O C;  1V87 A;  2LGG A;  4LK9 A;  2YUC A;  1X4I A;  2KU3 A;  2QJ0 A;  1LDJ B;  2RSD A;  3FL2 A;  3LQH A;  2YT5 A;  1WEN A;  2H0D B;  4N3W A;  3SOX A;  1X4U A;  4W4U A;  3DPL R;  4R8P K;  4PTB A;  4GNE A;  2CSY A;  2Y1M A;  2AN6 A;  3U5N A;  4I7C A;  1JM7 A;  2K16 A;  3LQJ A;  4AP4 A;  5LKX A;  2LXP C;  5FB1 A;  3KQI A;  5LKT A;  5LCW B;  3EB6 A;  3O33 A;  2L75 A;  1T1H A;  1WIM A;  5G04 B;  2KWO A;  2L5U A;  4B7Y C;  5TBN A;  1Z6U A;  2LV9 A;  1WEQ A;  1Z2Q A;  3O34 A;  5TAB A;  5JG6 A;  4FK5 A;  2VNF A;  3M62 A;  3MHH A;  4R7E A;  5AIT A;  3HCS A;  2VPD A;  3HCT A;  5G0F A;  2MNY A;  1VD4 A;  4A49 A;  2H0D A;  2KE1 A;  3U5P A;  5TRB A;  4I7B A; 
#chains in the Genus database with same CATH topology
 2UZG A;  1DVP A;  1VYX A;  2E61 A;  2CKL B;  5G05 B;  3FAO A;  2BAY A;  2M1R A;  4ZUX U;  3M63 A;  3RTR B;  2XOZ A;  1Z60 A;  2IDA A;  2M3H A;  3E2D A;  2P57 A;  2VP7 A;  3DQV R;  3NG2 A;  1WEV A;  4YBM A;  2MIQ A;  3DWD A;  4AUQ B;  2ZET C;  2NAA A;  4UP5 A;  1IYM A;  4QF3 A;  2XB1 A;  3N9P A;  2LGV A;  2VPE A;  2K4D A;  4AVX A;  2QIZ A;  4OGE A;  4ZDT A;  5J3X A;  3O36 A;  2K1J A;  3N9Q A;  4ZQL A;  4P5O B;  2YVR A;  2YW8 A;  4YAT A;  3MDB C;  2G45 A;  2L43 A;  3FM8 C;  4TKP B;  4A4C A;  4YBT A;  4A0C D;  2HDP A;  5H1U A;  3RPG C;  2CSZ A;  1LDK C;  4GNF A;  3PUR A;  1K2F A;  1WEP A;  2CKL A;  1JOC A;  4PPE A;  2VJF B;  3LVQ E;  3PLW A;  1MM2 A;  4GND A;  4I7D A;  3KV6 A;  2F6J A;  3SOU A;  3LDY A;  2CT2 A;  2G43 A;  5KH7 A;  5D1M B;  3I2D A;  2I50 A;  2MD7 B;  1WFK A;  2YYR A;  2LRI C;  5B78 A;  4QF2 A;  2FD4 A;  2KWK A;  1ZBD B;  3PHD A;  2JRJ A;  2L7P A;  4FO9 A;  2D8U A;  5FEY A;  5SVI B;  1WGM A;  1WEE A;  2YU4 A;  5D1L B;  2FSA A;  4LKA A;  2KIZ A;  2JM3 A;  2OXQ C;  4L7X A;  3U5O A;  1F62 A;  2YUR A;  3T9K A;  2LGL A;  4H9D A;  5LKZ A;  3T7L A;  2L80 A;  2F6N A;  2HYE D;  4O62 A;  5H1T A;  4LJN A;  3N9L A;  2YSJ A;  3KV5 A;  2MA6 A;  3M99 A;  1BOR A;  1U6G B;  5FB0 A;  2ECW A;  2C2V S;  3EB5 A;  2JMJ A;  2ECI A;  2YQM A;  1RMD A;  5B76 A;  2VJF A;  4XI1 A;  2LDR A;  1E4U A;  5K3Q A;  2PUY A;  3N9M A;  4Z0O A;  1N87 A;  4N4F A;  3V43 A;  4GB0 A;  3C6W A;  1DCQ A;  5EYA F;  4YC9 A;  2MNZ A;  4FJC A;  2KGG A;  3H7H A;  3HCU A;  4AYC B;  1CHC A;  5I3L A;  5SVI A;  3SHB A;  2PNX A;  2YRE A;  2M6M A;  2MKE A;  2XP0 A;  4LAD B;  2M85 A;  5C13 A;  1X4J A;  4X3G A;  2OWA A;  4YBS A;  2CRW A;  2LQ6 A;  3L1X A;  2VPG A;  3ZVZ B;  2ECN A;  1WEM A;  3T6R A;  4WA6 A;  4V3K C;  5TDW A;  4UP0 A;  3C5K A;  2ECG A;  2CRR A;  4NN2 A;  3KNV A;  2EGM A;  4IC3 A;  1HYI A;  2ECT A;  2E6S A;  5DKA A;  2RI7 A;  2LN0 A;  2QIC A;  2EXU A;  2D8S A;  2MT5 A;  4UI9 B;  3ZPV E;  1WEO A;  3ZPV 1;  4L58 A;  4F52 B;  1WIL A;  4AYC A;  2ECJ A;  3GV4 A;  3U5M A;  4MSX A;  4S3O B;  2LXH C;  2E6R A;  2XEU A;  4IC2 A;  3L1Z B;  2YQL A;  3ZYQ A;  3RPG B;  2EGP A;  1WEU A;  3O35 A;  3SUB A;  3VK6 A;  5DIN A;  4WZ3 B;  2YHN A;  1MM3 A;  4Q6F A;  5H1V A;  4BHW A;  5B75 A;  1WEW A;  2DSM A;  2FUI A;  2KKX A;  5B79 A;  2DJA A;  2FFW A;  3ZVY A;  2KGI A;  3PUQ A;  2G6Q A;  2DX8 A;  3O7A A;  5C11 A;  5H9M A;  4WZ2 A;  3HTK C;  4V3L C;  3SOW A;  4CCG X;  2XOC A;  3Q1D A;  2JUN A;  3MHS A;  3FJU B;  2KRE A;  3L11 A;  4CA1 A;  3LRQ A;  4R2Y A;  4LLB A;  2MA5 A;  2VJE B;  2KWN A;  3ASL A;  5KH9 A;  1MBM A;  2RR4 A;  3QZV A;  4YAX A;  5LKU A;  4Z0R A;  1XWH A;  2Y43 A;  3LJU X;  5TDR A;  2F42 A;  3LQI A;  4BBQ A;  2YSM A;  3DDT A;  2JMD A;  2L0B A;  2EA6 A;  3ZTG A;  1HYJ A;  2ECV A;  2K17 A;  4YAD A;  1WES A;  4A4B A;  2VPB A;  2KYU A;  2YHO A;  2CSV A;  3N9N A;  5KH3 A;  4WZ0 A;  4F1P A;  5AIU A;  1FBV A;  3KDE C;  4C9Z A;  3FEH A;  4B86 C;  2KR4 A;  2KWJ A;  5B77 A;  3N9O A;  2FUU A;  2MUM A;  4O64 A;  5SVY A;  5FER A;  4QQ4 A;  2MD8 C;  2VJE A;  2C2L A;  5B8D A;  2JMI A;  3GL6 A;  2Y1N A;  1JM7 B;  4FIP A;  3O37 A;  4GNG A;  2KFT A;  3ZNI A;  3IHP A;  2LGK A;  4YAB A;  2CON A;  2EOD A;  1G25 A;  4MVT A;  1VFY A;  5D1K B;  2LAU A;  1WE9 A;  1FP0 A;  3O70 A;  4S3O C;  1V87 A;  2LGG A;  4LK9 A;  2YUC A;  1X4I A;  2KU3 A;  2QJ0 A;  1LDJ B;  2RSD A;  3FL2 A;  3LQH A;  2YT5 A;  1WEN A;  2H0D B;  2M13 A;  4N3W A;  3SOX A;  1X4U A;  4W4U A;  3DPL R;  3M7K A;  4R8P K;  4PTB A;  4GNE A;  2CSY A;  2Y1M A;  2AN6 A;  3U5N A;  4I7C A;  1JM7 A;  2K16 A;  3LQJ A;  4AP4 A;  2XOY A;  2LXP C;  5LKX A;  5FB1 A;  3KQI A;  5LKT A;  5LCW B;  3EB6 A;  3O33 A;  2L75 A;  5SVX A;  4OGC A;  1T1H A;  1WIM A;  2KKY A;  5G04 B;  2KWO A;  2L5U A;  4B7Y C;  5TBN A;  1Z6U A;  2LV9 A;  1WEQ A;  1Z2Q A;  3O34 A;  5TAB A;  5JG6 A;  4FK5 A;  2VNF A;  3M62 A;  3MHH A;  4R7E A;  5AIT A;  3HCS A;  2VPD A;  3HCT A;  5G0F A;  2MNY A;  3O47 A;  1VD4 A;  2B0O E;  4A49 A;  2H0D A;  2IQJ A;  3JUE A;  2KE1 A;  3U5P A;  3FAN A;  5TRB A;  3LVR E;  4I7B A; 
#chains in the Genus database with same CATH homology
 2UZG A;  1DVP A;  1VYX A;  2CKL B;  5G05 B;  2BAY A;  2M1R A;  4ZUX U;  3M63 A;  3RTR B;  1Z60 A;  2IDA A;  2M3H A;  2VP7 A;  3DQV R;  3NG2 A;  1WEV A;  4YBM A;  2MIQ A;  4AUQ B;  2ZET C;  2NAA A;  4UP5 A;  1IYM A;  4QF3 A;  2XB1 A;  3N9P A;  2LGV A;  2VPE A;  2K4D A;  4AVX A;  2QIZ A;  4ZDT A;  5J3X A;  3O36 A;  2K1J A;  3N9Q A;  4ZQL A;  4P5O B;  2YW8 A;  4YAT A;  2G45 A;  2L43 A;  4TKP B;  4A4C A;  4YBT A;  4A0C D;  2HDP A;  5H1U A;  3RPG C;  2CSZ A;  1LDK C;  4GNF A;  3PUR A;  1K2F A;  1WEP A;  2CKL A;  1JOC A;  2VJF B;  4GND A;  4PPE A;  4BBQ A;  1MM2 A;  4I7D A;  3KV6 A;  2F6J A;  3SOU A;  2CT2 A;  2G43 A;  5KH7 A;  5D1M B;  3I2D A;  2I50 A;  2MD7 B;  1WFK A;  2YYR A;  2LRI C;  5B78 A;  4QF2 A;  2KWK A;  1ZBD B;  3PHD A;  2JRJ A;  4FO9 A;  5FEY A;  1WGM A;  1WEE A;  2YU4 A;  5D1L B;  2FSA A;  4LKA A;  2KIZ A;  4L7X A;  2OXQ C;  3U5O A;  1F62 A;  2YUR A;  2LGL A;  5LKZ A;  3T7L A;  2L80 A;  2F6N A;  2HYE D;  5H1T A;  4LJN A;  3N9L A;  2YSJ A;  3KV5 A;  2MA6 A;  3M99 A;  1BOR A;  1U6G B;  5FB0 A;  2ECW A;  2C2V S;  3EB5 A;  2JMJ A;  2ECI A;  2YQM A;  1RMD A;  5B76 A;  2VJF A;  4XI1 A;  2LDR A;  1E4U A;  2PUY A;  3N9M A;  1N87 A;  4N4F A;  3V43 A;  4GB0 A;  3C6W A;  5EYA F;  4YC9 A;  2MNZ A;  4FJC A;  2KGG A;  3HCU A;  4AYC B;  1CHC A;  5I3L A;  3SHB A;  2PNX A;  2YRE A;  2M6M A;  4LAD B;  2M85 A;  5C13 A;  1X4J A;  4X3G A;  4YBS A;  2LQ6 A;  3L1X A;  2VPG A;  3ZVZ B;  2ECN A;  1WEM A;  3T6R A;  4WA6 A;  4V3K C;  5TDW A;  4UP0 A;  3C5K A;  2ECG A;  4NN2 A;  3KNV A;  4IC3 A;  1HYI A;  2ECT A;  2E6S A;  5DKA A;  2RI7 A;  2LN0 A;  2QIC A;  2D8S A;  2MT5 A;  4UI9 B;  3ZPV E;  1WEO A;  3ZPV 1;  4L58 A;  4F52 B;  1WIL A;  4AYC A;  2ECJ A;  3GV4 A;  3U5M A;  4MSX A;  4S3O B;  2LXH C;  2E6R A;  2XEU A;  4IC2 A;  3L1Z B;  2YQL A;  3ZYQ A;  3RPG B;  2EGP A;  1WEU A;  3O35 A;  3VK6 A;  5DIN A;  4WZ3 B;  2YHN A;  1MM3 A;  4Q6F A;  5H1V A;  4BHW A;  5B75 A;  1WEW A;  2FUI A;  5B79 A;  3ZVY A;  2KGI A;  3PUQ A;  2G6Q A;  2DX8 A;  3O7A A;  5C11 A;  5H9M A;  4WZ2 A;  3HTK C;  4V3L C;  3SOW A;  4CCG X;  3MHS A;  2KRE A;  3L11 A;  4CA1 A;  3LRQ A;  4R2Y A;  4LLB A;  2MA5 A;  2VJE B;  2KWN A;  3ASL A;  5KH9 A;  3QZV A;  4YAX A;  5LKU A;  1XWH A;  2Y43 A;  5TDR A;  2F42 A;  3LQI A;  2YSM A;  2JMD A;  2L0B A;  2EA6 A;  3ZTG A;  1HYJ A;  2ECV A;  2K17 A;  4YAD A;  1WES A;  4A4B A;  2VPB A;  2KYU A;  2YHO A;  3N9N A;  5KH3 A;  4WZ0 A;  5AIU A;  1FBV A;  4C9Z A;  4B86 C;  2KR4 A;  2KWJ A;  5B77 A;  3N9O A;  2FUU A;  2MUM A;  4O64 A;  5FER A;  2MD8 C;  2VJE A;  2C2L A;  5B8D A;  2JMI A;  3GL6 A;  2Y1N A;  1JM7 B;  4FIP A;  3O37 A;  4GNG A;  2KFT A;  3ZNI A;  3IHP A;  2LGK A;  4YAB A;  2EOD A;  1G25 A;  4MVT A;  1VFY A;  5D1K B;  1WE9 A;  1FP0 A;  3O70 A;  4S3O C;  1V87 A;  2LGG A;  4LK9 A;  2YUC A;  1X4I A;  2KU3 A;  2QJ0 A;  1LDJ B;  2RSD A;  3FL2 A;  3LQH A;  2YT5 A;  1WEN A;  2H0D B;  4N3W A;  3SOX A;  1X4U A;  4W4U A;  3DPL R;  4R8P K;  4PTB A;  4GNE A;  2CSY A;  2Y1M A;  2AN6 A;  3U5N A;  4I7C A;  1JM7 A;  2K16 A;  3LQJ A;  4AP4 A;  5LKX A;  2LXP C;  5FB1 A;  3KQI A;  5LKT A;  5LCW B;  3EB6 A;  3O33 A;  2L75 A;  1T1H A;  1WIM A;  5G04 B;  2KWO A;  2L5U A;  4B7Y C;  5TBN A;  1Z6U A;  2LV9 A;  1WEQ A;  1Z2Q A;  3O34 A;  5TAB A;  5JG6 A;  4FK5 A;  2VNF A;  3M62 A;  3MHH A;  4R7E A;  5AIT A;  3HCS A;  2VPD A;  3HCT A;  5G0F A;  2MNY A;  1VD4 A;  4A49 A;  2H0D A;  2KE1 A;  3U5P A;  5TRB A;  4I7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...