5TBNA

Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'GHMDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20
publication title PHF20 Readers Link Methylation of Histone H3K4 and p53 with H4K16 Acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription / structural protein
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tbnA00
4ZDTA 1MM2A 2LGLA 5FB1A 5FERA 3M63A 2MNYA 1G25A 2L80A 2RI7A 2C2VS 3U5NA 2ECWA 4B7YC 1WEPA 4A4BA 1BORA 3VK6A 2K1JA 3L1ZB 2LV9A 3KV5A 3PHDA 2EODA 1JOCA 2KREA 2PNXA 4ZUXU 3ZNIA 3IHPA 1U6GB 1CHCA 3ZYQA 2M1RA 1WEOA 4TKPB 2MIQA 4N3WA 4I7DA 5TBNA 4V3LC 1WE9A 3HCUA 3C6WA 2E6SA 4L58A 1WEEA 2G43A 5TRBA 4NN2A 4LJNA 3O35A 1WGMA 1XWHA 2RSDA 2MD7B 4LK9A 5D1LB 2CT2A 2ECNA 2YURA 3LQIA 4AUQB 2L5UA 2KU3A 2VP7A 2ECTA 5B76A 4A49A 3RPGB 4GB0A 3DQVR 3DPLR 4FO9A 1X4UA 2KGGA 4S3OB 5G04B 3O34A 3HTKC 2Y43A 2KYUA 4FK5A 1DVPA 1LDKC 1JM7B 2HDPA 4WZ2A 4GNFA 3RTRB 2ECGA 2F42A 1Z2QA 3M62A 4MVTA 1JM7A 4AVXA 4QF3A 2YQLA 2YSJA 2YQMA 1LDJB 2YSMA 3U5PA 2AN6A 3SOUA 4F52B 1WEUA 4YAXA 3LQHA 2LXHC 3ZPVE 5DINA 1RMDA 4YATA 2LN0A 5AITA 4O64A 2E6RA 2L0BA 2YW8A 5TDRA 3O70A 2F6JA 2KWJA 2VJEA 2LQ6A 1WEWA 3GL6A 4CCGX 2CKLA 2HYED 3QZVA 3HCTA 2MD8C 1WFKA 5B75A 4LADB 2MT5A 2MNZA 4I7BA 2YHOA 5KH9A 5JG6A 2G45A 3HCSA 4B86C 3V43A 5B77A 2VNFA 2PUYA 5H1UA 2KWNA 4YBMA 5H1VA 1WESA 4BHWA 2YYRA 2MA6A 5LKXA 3N9OA 3ZTGA 5H1TA 4WZ0A 2XEUA 3I2DA 4AYCB 5B8DA 3N9NA 4AP4A 4YABA 5B78A 5G0FA 5LKUA 4LKAA 3ZVZB 5D1KB 2IDAA 3MHSA 3RPGC 2KE1A 2G6QA 2D8SA 4S3OC 4Q6FA 1WIMA 5TDWA 4V3KC 5LKTA 2L75A 3KV6A 2OXQC 4R7EA 2XB1A 5KH3A 2C2LA 2FUIA 2LRIC 4N4FA 2UZGA 5FEYA 4MSXA 4FIPA 1MM3A 2ZETC 3N9MA 1VYXA 4YADA 2EA6A 2LGVA 2QIZA 2M6MA 1E4UA 4PTBA 2M3HA 1VFYA 2VJFB 1VD4A 4UP0A 1X4JA 5KH7A 3O36A 3O33A 2H0DB 2JMJA 2JMIA 2LXPC 4C9ZA 4I7CA 2ECVA 4GNDA 4YC9A 3MHHA 3KNVA 4XI1A 3LQJA 2FSAA 3C5KA 2LGGA 3M99A 3NG2A 1Z6UA 2KWOA 2H0DA 2ECIA 2VPBA 2YHNA 3O7AA 5DKAA 5I3LA 4LLBA 4A0CD 5AIUA 2JRJA 3GV4A 2YT5A 2KGIA 2Y1MA 2KWKA 4UP5A 2YU4A 2CSYA 1WENA 3L1XA 1F62A 2K4DA 5TABA 4GNEA 3ASLA 3L11A 1Z60A 4GNGA 5J3XA 2Y1NA 3ZVYA 1V87A 5G05B 3SOXA 3ZPV1 2LDRA 1HYIA 4A4CA 5C13A 2QICA 2K16A 4IC3A 3PUQA 4CA1A 5C11A 5B79A 2KIZA 3O37A 4BBQA 1N87A 2M85A 5H9MA 3SOWA 3N9LA 3T6RA 4L7XA 3U5OA 4UI9B 2FUUA 4PPEA 3T7LA 4X3GA 1FBVA 4IC2A 2KR4A 2NAAA 2VPGA 2BAYA 2MA5A 4AYCA 4YBSA 4FJCA 4ZQLA 2F6NA 4QF2A 2DX8A 2ECJA 3SHBA 4R2YA 1X4IA 2EGPA 2KFTA 2MUMA 3N9PA 1WEQA 2YUCA 2CSZA 2VPEA 4YBTA 1WEVA 1HYJA 3EB6A 4WZ3B 2I50A 5FB0A 1ZBDB 2JMDA 4R8PK 5LKZA 5EYAF 3U5MA 2YREA 3LRQA 2QJ0A 3EB5A 4W4UA 5D1MB 1WEMA 4P5OB 2L43A 2K17A 3PURA 1T1HA 3N9QA 2VJFA 2VPDA 3FL2A 4WA6A 2VJEB 1K2FA 1WILA 1FP0A 3KQIA 1IYMA 2CKLB 5LCWB 2LGKA
chains in the Genus database with same CATH superfamily
2XOYA 4ZDTA 1MM2A 2LGLA 5FB1A 4QQ4A 5FERA 3M63A 2MNYA 1G25A 2L80A 2RI7A 2C2VS 3U5NA 2ECWA 4B7YC 1WEPA 4A4BA 1BORA 3VK6A 2K1JA 3L1ZB 2LV9A 3KV5A 3PHDA 2EODA 1JOCA 2KREA 2XOCA 2PNXA 4ZUXU 2JM3A 3ZNIA 3IHPA 1U6GB 1CHCA 3ZYQA 2M1RA 1WEOA 4TKPB 2MIQA 4N3WA 4I7DA 5TBNA 4V3LC 1WE9A 3HCUA 3FEHA 3C6WA 5SVIA 2E6SA 4L58A 1WEEA 2G43A 5TRBA 4NN2A 4LJNA 3O35A 1WGMA 1XWHA 2RSDA 3PLWA 2MD7B 4LK9A 5D1LB 2CT2A 2ECNA 2YURA 3LQIA 4AUQB 2L5UA 2KU3A 2VP7A 2ECTA 5B76A 4A49A 3RPGB 4GB0A 3DQVR 3DPLR 2CSVA 4FO9A 5SVYA 1X4UA 2E61A 2KGGA 4S3OB 5G04B 3O34A 3HTKC 2Y43A 2KYUA 3FAOA 4FK5A 1DVPA 1LDKC 1MBMA 1JM7B 2HDPA 4WZ2A 4GNFA 3RTRB 2CONA 2ECGA 3T9KA 2F42A 1Z2QA 2MKEA 3M62A 4MVTA 3MDBC 3O47A 1JM7A 4AVXA 4QF3A 2YQLA 2YSJA 2YQMA 1LDJB 2YSMA 3U5PA 2AN6A 4Z0RA 3SOUA 4F52B 1WEUA 4YAXA 3LQHA 2LXHC 3ZPVE 5DINA 1RMDA 3FJUB 3LJUX 4YATA 2LN0A 5AITA 4O64A 2E6RA 2L0BA 2YW8A 5TDRA 3O70A 2F6JA 2KWJA 2VJEA 3GL6A 1WEWA 2LQ6A 2XOZA 4CCGX 2CKLA 2HYED 3QZVA 3HCTA 2MD8C 1WFKA 5B75A 4LADB 2MT5A 2MNZA 3FM8C 2KKXA 4I7BA 1DCQA 2YHOA 5KH9A 5JG6A 2G45A 3HCSA 2P57A 4B86C 3V43A 5B77A 2VNFA 2PUYA 5H1UA 2KWNA 4YBMA 3LDYA 5H1VA 2DSMA 3JUEA 1WESA 4H9DA 4BHWA 2YYRA 2MA6A 5LKXA 2IQJA 3N9OA 3ZTGA 5H1TA 4WZ0A 2XEUA 3I2DA 3LVRE 4AYCB 5B8DA 3N9NA 4AP4A 4YABA 5B78A 5G0FA 2RR4A 3DWDA 4O62A 5LKUA 3DDTA 4LKAA 3ZVZB 5D1KB 2IDAA 3MHSA 3RPGC 2KE1A 2M13A 2CRWA 2G6QA 2D8SA 3FANA 4S3OC 4Q6FA 1WIMA 5TDWA 4V3KC 5LKTA 2L75A 3KV6A 2OWAA 2OXQC 4R7EA 2XB1A 5KH3A 2C2LA 2LAUA 2JUNA 2FUIA 2LRIC 4N4FA 2B0OE 2UZGA 5FEYA 4MSXA 4FIPA 1MM3A 2ZETC 3H7HA 3N9MA 1VYXA 2KKYA 4YADA 2EA6A 2LGVA 2QIZA 2M6MA 1E4UA 4PTBA 2M3HA 1VFYA 2VJFB 1VD4A 4UP0A 1X4JA 5KH7A 3LVQE 3O36A 3SUBA 2FFWA 3O33A 2H0DB 2JMJA 2JMIA 2LXPC 4C9ZA 2CRRA 4I7CA 2ECVA 4GNDA 4YC9A 3KDEC 3MHHA 2XP0A 3KNVA 4XI1A 3LQJA 2FSAA 3C5KA 2LGGA 3M99A 3NG2A 1Z6UA 2KWOA 2H0DA 2ECIA 2VPBA 2YHNA 3O7AA 4OGCA 5DKAA 5I3LA 4LLBA 4A0CD 5AIUA 2JRJA 3GV4A 2L7PA 2YT5A 2KGIA 2Y1MA 2KWKA 4UP5A 2YU4A 2CSYA 1WENA 3L1XA 1F62A 2K4DA 5TABA 4GNEA 3ASLA 3L11A 1Z60A 5SVIB 4GNGA 5J3XA 2Y1NA 3ZVYA 1V87A 5G05B 3SOXA 3ZPV1 2LDRA 4OGEA 1HYIA 4A4CA 5C13A 2QICA 2K16A 4IC3A 3PUQA 4CA1A 5C11A 3M7KA 5B79A 2KIZA 3O37A 4BBQA 1N87A 2M85A 5H9MA 3SOWA 3N9LA 3T6RA 4L7XA 3U5OA 4UI9B 2FUUA 4PPEA 3T7LA 4X3GA 1FBVA 4IC2A 2EGMA 2KR4A 2FD4A 2NAAA 2EXUA 2VPGA 2BAYA 2MA5A 4AYCA 4YBSA 4FJCA 4ZQLA 2F6NA 4QF2A 2DX8A 2ECJA 3SHBA 4F1PA 4R2YA 1X4IA 2EGPA 2YVRA 2KFTA 2MUMA 3N9PA 1WEQA 2YUCA 2CSZA 2VPEA 4YBTA 1WEVA 1HYJA 3EB6A 5K3QA 3E2DA 4WZ3B 2I50A 5FB0A 1ZBDB 2JMDA 4R8PK 5SVXA 5LKZA 5EYAF 2DJAA 3U5MA 2YREA 4Z0OA 3LRQA 2QJ0A 3EB5A 4W4UA 5D1MB 1WEMA 4P5OB 2L43A 2K17A 3PURA 1T1HA 3N9QA 2VJFA 2VPDA 3FL2A 4WA6A 2VJEB 1K2FA 1WILA 3Q1DA 1FP0A 3KQIA 1IYMA 2CKLB 5LCWB 2D8UA 2LGKA
chains in the Genus database with same CATH topology
4ZDTA 1MM2A 2LGLA 5FB1A 5FERA 3M63A 2MNYA 1G25A 2L80A 2RI7A 2C2VS 3U5NA 2ECWA 4B7YC 1WEPA 4A4BA 1BORA 3VK6A 2K1JA 3L1ZB 2LV9A 3KV5A 3PHDA 2EODA 1JOCA 2KREA 2PNXA 4ZUXU 3ZNIA 3IHPA 1U6GB 1CHCA 3ZYQA 2M1RA 1WEOA 4TKPB 2MIQA 4N3WA 4I7DA 5TBNA 4V3LC 1WE9A 3HCUA 3C6WA 2E6SA 4L58A 1WEEA 2G43A 5TRBA 4NN2A 4LJNA 3O35A 1WGMA 1XWHA 2RSDA 2MD7B 4LK9A 5D1LB 2CT2A 2ECNA 2YURA 3LQIA 4AUQB 2L5UA 2KU3A 2VP7A 2ECTA 5B76A 4A49A 3RPGB 4GB0A 3DQVR 3DPLR 4FO9A 1X4UA 2KGGA 4S3OB 5G04B 3O34A 3HTKC 2Y43A 2KYUA 4FK5A 1DVPA 1LDKC 1JM7B 2HDPA 4WZ2A 4GNFA 3RTRB 2ECGA 2F42A 1Z2QA 3M62A 4MVTA 1JM7A 4AVXA 4QF3A 2YQLA 2YSJA 2YQMA 1LDJB 2YSMA 3U5PA 2AN6A 3SOUA 4F52B 1WEUA 4YAXA 3LQHA 2LXHC 3ZPVE 5DINA 1RMDA 4YATA 2LN0A 5AITA 4O64A 2E6RA 2L0BA 2YW8A 5TDRA 3O70A 2F6JA 2KWJA 2VJEA 2LQ6A 1WEWA 3GL6A 4CCGX 2CKLA 2HYED 3QZVA 3HCTA 2MD8C 1WFKA 5B75A 4LADB 2MT5A 2MNZA 4I7BA 2YHOA 5KH9A 5JG6A 2G45A 3HCSA 4B86C 3V43A 5B77A 2VNFA 2PUYA 5H1UA 2KWNA 4YBMA 5H1VA 1WESA 4BHWA 2YYRA 2MA6A 5LKXA 3N9OA 3ZTGA 5H1TA 4WZ0A 2XEUA 3I2DA 4AYCB 5B8DA 3N9NA 4AP4A 4YABA 5B78A 5G0FA 5LKUA 4LKAA 3ZVZB 5D1KB 2IDAA 3MHSA 3RPGC 2KE1A 2G6QA 2D8SA 4S3OC 4Q6FA 1WIMA 5TDWA 4V3KC 5LKTA 2L75A 3KV6A 2OXQC 4R7EA 2XB1A 5KH3A 2C2LA 2FUIA 2LRIC 4N4FA 2UZGA 5FEYA 4MSXA 4FIPA 1MM3A 2ZETC 3N9MA 1VYXA 4YADA 2EA6A 2LGVA 2QIZA 2M6MA 1E4UA 4PTBA 2M3HA 1VFYA 2VJFB 1VD4A 4UP0A 1X4JA 5KH7A 3O36A 3O33A 2H0DB 2JMJA 2JMIA 2LXPC 4C9ZA 4I7CA 2ECVA 4GNDA 4YC9A 3MHHA 3KNVA 4XI1A 3LQJA 2FSAA 3C5KA 2LGGA 3M99A 3NG2A 1Z6UA 2KWOA 2H0DA 2ECIA 2VPBA 2YHNA 3O7AA 5DKAA 5I3LA 4LLBA 4A0CD 5AIUA 2JRJA 3GV4A 2YT5A 2KGIA 2Y1MA 2KWKA 4UP5A 2YU4A 2CSYA 1WENA 3L1XA 1F62A 2K4DA 5TABA 4GNEA 3ASLA 3L11A 1Z60A 4GNGA 5J3XA 2Y1NA 3ZVYA 1V87A 5G05B 3SOXA 3ZPV1 2LDRA 1HYIA 4A4CA 5C13A 2QICA 2K16A 4IC3A 3PUQA 4CA1A 5C11A 5B79A 2KIZA 3O37A 4BBQA 1N87A 2M85A 5H9MA 3SOWA 3N9LA 3T6RA 4L7XA 3U5OA 4UI9B 2FUUA 4PPEA 3T7LA 4X3GA 1FBVA 4IC2A 2KR4A 2NAAA 2VPGA 2BAYA 2MA5A 4AYCA 4YBSA 4FJCA 4ZQLA 2F6NA 4QF2A 2DX8A 2ECJA 3SHBA 4R2YA 1X4IA 2EGPA 2KFTA 2MUMA 3N9PA 1WEQA 2YUCA 2CSZA 2VPEA 4YBTA 1WEVA 1HYJA 3EB6A 4WZ3B 2I50A 5FB0A 1ZBDB 2JMDA 4R8PK 5LKZA 5EYAF 3U5MA 2YREA 3LRQA 2QJ0A 3EB5A 4W4UA 5D1MB 1WEMA 4P5OB 2L43A 2K17A 3PURA 1T1HA 3N9QA 2VJFA 2VPDA 3FL2A 4WA6A 2VJEB 1K2FA 1WILA 1FP0A 3KQIA 1IYMA 2CKLB 5LCWB 2LGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDT A;  1MM2 A;  2LGL A;  5FB1 A;  5FER A;  3M63 A;  2MNY A;  1G25 A;  2L80 A;  2RI7 A;  2C2V S;  3U5N A;  2ECW A;  4B7Y C;  1WEP A;  4A4B A;  1BOR A;  3VK6 A;  2K1J A;  3L1Z B;  2LV9 A;  3KV5 A;  3PHD A;  2EOD A;  1JOC A;  2KRE A;  2PNX A;  4ZUX U;  3ZNI A;  3IHP A;  1U6G B;  1CHC A;  3ZYQ A;  2M1R A;  1WEO A;  4TKP B;  2MIQ A;  4N3W A;  4I7D A;  5TBN A;  4V3L C;  1WE9 A;  3HCU A;  3C6W A;  2E6S A;  4L58 A;  1WEE A;  2G43 A;  5TRB A;  4NN2 A;  4LJN A;  3O35 A;  1WGM A;  1XWH A;  2RSD A;  2MD7 B;  4LK9 A;  5D1L B;  2CT2 A;  2ECN A;  2YUR A;  3LQI A;  4AUQ B;  2L5U A;  2KU3 A;  2VP7 A;  2ECT A;  5B76 A;  4A49 A;  3RPG B;  4GB0 A;  3DQV R;  3DPL R;  4FO9 A;  1X4U A;  2KGG A;  4S3O B;  5G04 B;  3O34 A;  3HTK C;  2Y43 A;  2KYU A;  4FK5 A;  1DVP A;  1LDK C;  1JM7 B;  2HDP A;  4WZ2 A;  4GNF A;  3RTR B;  2ECG A;  2F42 A;  1Z2Q A;  3M62 A;  4MVT A;  1JM7 A;  4AVX A;  4QF3 A;  2YQL A;  2YSJ A;  2YQM A;  1LDJ B;  2YSM A;  3U5P A;  2AN6 A;  3SOU A;  4F52 B;  1WEU A;  4YAX A;  3LQH A;  2LXH C;  3ZPV E;  5DIN A;  1RMD A;  4YAT A;  2LN0 A;  5AIT A;  4O64 A;  2E6R A;  2L0B A;  2YW8 A;  5TDR A;  3O70 A;  2F6J A;  2KWJ A;  2VJE A;  2LQ6 A;  1WEW A;  3GL6 A;  4CCG X;  2CKL A;  2HYE D;  3QZV A;  3HCT A;  2MD8 C;  1WFK A;  5B75 A;  4LAD B;  2MT5 A;  2MNZ A;  4I7B A;  2YHO A;  5KH9 A;  5JG6 A;  2G45 A;  3HCS A;  4B86 C;  3V43 A;  5B77 A;  2VNF A;  2PUY A;  5H1U A;  2KWN A;  4YBM A;  5H1V A;  1WES A;  4BHW A;  2YYR A;  2MA6 A;  5LKX A;  3N9O A;  3ZTG A;  5H1T A;  4WZ0 A;  2XEU A;  3I2D A;  4AYC B;  5B8D A;  3N9N A;  4AP4 A;  4YAB A;  5B78 A;  5G0F A;  5LKU A;  4LKA A;  3ZVZ B;  5D1K B;  2IDA A;  3MHS A;  3RPG C;  2KE1 A;  2G6Q A;  2D8S A;  4S3O C;  4Q6F A;  1WIM A;  5TDW A;  4V3K C;  5LKT A;  2L75 A;  3KV6 A;  2OXQ C;  4R7E A;  2XB1 A;  5KH3 A;  2C2L A;  2FUI A;  2LRI C;  4N4F A;  2UZG A;  5FEY A;  4MSX A;  4FIP A;  1MM3 A;  2ZET C;  3N9M A;  1VYX A;  4YAD A;  2EA6 A;  2LGV A;  2QIZ A;  2M6M A;  1E4U A;  4PTB A;  2M3H A;  1VFY A;  2VJF B;  1VD4 A;  4UP0 A;  1X4J A;  5KH7 A;  3O36 A;  3O33 A;  2H0D B;  2JMJ A;  2JMI A;  2LXP C;  4C9Z A;  4I7C A;  2ECV A;  4GND A;  4YC9 A;  3MHH A;  3KNV A;  4XI1 A;  3LQJ A;  2FSA A;  3C5K A;  2LGG A;  3M99 A;  3NG2 A;  1Z6U A;  2KWO A;  2H0D A;  2ECI A;  2VPB A;  2YHN A;  3O7A A;  5DKA A;  5I3L A;  4LLB A;  4A0C D;  5AIU A;  2JRJ A;  3GV4 A;  2YT5 A;  2KGI A;  2Y1M A;  2KWK A;  4UP5 A;  2YU4 A;  2CSY A;  1WEN A;  3L1X A;  1F62 A;  2K4D A;  5TAB A;  4GNE A;  3ASL A;  3L11 A;  1Z60 A;  4GNG A;  5J3X A;  2Y1N A;  3ZVY A;  1V87 A;  5G05 B;  3SOX A;  3ZPV 1;  2LDR A;  1HYI A;  4A4C A;  5C13 A;  2QIC A;  2K16 A;  4IC3 A;  3PUQ A;  4CA1 A;  5C11 A;  5B79 A;  2KIZ A;  3O37 A;  4BBQ A;  1N87 A;  2M85 A;  5H9M A;  3SOW A;  3N9L A;  3T6R A;  4L7X A;  3U5O A;  4UI9 B;  2FUU A;  4PPE A;  3T7L A;  4X3G A;  1FBV A;  4IC2 A;  2KR4 A;  2NAA A;  2VPG A;  2BAY A;  2MA5 A;  4AYC A;  4YBS A;  4FJC A;  4ZQL A;  2F6N A;  4QF2 A;  2DX8 A;  2ECJ A;  3SHB A;  4R2Y A;  1X4I A;  2EGP A;  2KFT A;  2MUM A;  3N9P A;  1WEQ A;  2YUC A;  2CSZ A;  2VPE A;  4YBT A;  1WEV A;  1HYJ A;  3EB6 A;  4WZ3 B;  2I50 A;  5FB0 A;  1ZBD B;  2JMD A;  4R8P K;  5LKZ A;  5EYA F;  3U5M A;  2YRE A;  3LRQ A;  2QJ0 A;  3EB5 A;  4W4U A;  5D1M B;  1WEM A;  4P5O B;  2L43 A;  2K17 A;  3PUR A;  1T1H A;  3N9Q A;  2VJF A;  2VPD A;  3FL2 A;  4WA6 A;  2VJE B;  1K2F A;  1WIL A;  1FP0 A;  3KQI A;  1IYM A;  2CKL B;  5LCW B;  2LGK A; 
#chains in the Genus database with same CATH topology
 2XOY A;  4ZDT A;  1MM2 A;  2LGL A;  5FB1 A;  4QQ4 A;  5FER A;  3M63 A;  2MNY A;  1G25 A;  2L80 A;  2RI7 A;  2C2V S;  3U5N A;  2ECW A;  4B7Y C;  1WEP A;  4A4B A;  1BOR A;  3VK6 A;  2K1J A;  3L1Z B;  2LV9 A;  3KV5 A;  3PHD A;  2EOD A;  1JOC A;  2KRE A;  2XOC A;  2PNX A;  4ZUX U;  2JM3 A;  3ZNI A;  3IHP A;  1U6G B;  1CHC A;  3ZYQ A;  2M1R A;  1WEO A;  4TKP B;  2MIQ A;  4N3W A;  4I7D A;  5TBN A;  4V3L C;  1WE9 A;  3HCU A;  3FEH A;  3C6W A;  5SVI A;  2E6S A;  4L58 A;  1WEE A;  2G43 A;  5TRB A;  4NN2 A;  4LJN A;  3O35 A;  1WGM A;  1XWH A;  2RSD A;  3PLW A;  2MD7 B;  4LK9 A;  5D1L B;  2CT2 A;  2ECN A;  2YUR A;  3LQI A;  4AUQ B;  2L5U A;  2KU3 A;  2VP7 A;  2ECT A;  5B76 A;  4A49 A;  3RPG B;  4GB0 A;  3DQV R;  3DPL R;  2CSV A;  4FO9 A;  5SVY A;  1X4U A;  2E61 A;  2KGG A;  4S3O B;  5G04 B;  3O34 A;  3HTK C;  2Y43 A;  2KYU A;  3FAO A;  4FK5 A;  1DVP A;  1LDK C;  1MBM A;  1JM7 B;  2HDP A;  4WZ2 A;  4GNF A;  3RTR B;  2CON A;  2ECG A;  3T9K A;  2F42 A;  1Z2Q A;  2MKE A;  3M62 A;  4MVT A;  3MDB C;  3O47 A;  1JM7 A;  4AVX A;  4QF3 A;  2YQL A;  2YSJ A;  2YQM A;  1LDJ B;  2YSM A;  3U5P A;  2AN6 A;  4Z0R A;  3SOU A;  4F52 B;  1WEU A;  4YAX A;  3LQH A;  2LXH C;  3ZPV E;  5DIN A;  1RMD A;  3FJU B;  3LJU X;  4YAT A;  2LN0 A;  5AIT A;  4O64 A;  2E6R A;  2L0B A;  2YW8 A;  5TDR A;  3O70 A;  2F6J A;  2KWJ A;  2VJE A;  3GL6 A;  1WEW A;  2LQ6 A;  2XOZ A;  4CCG X;  2CKL A;  2HYE D;  3QZV A;  3HCT A;  2MD8 C;  1WFK A;  5B75 A;  4LAD B;  2MT5 A;  2MNZ A;  3FM8 C;  2KKX A;  4I7B A;  1DCQ A;  2YHO A;  5KH9 A;  5JG6 A;  2G45 A;  3HCS A;  2P57 A;  4B86 C;  3V43 A;  5B77 A;  2VNF A;  2PUY A;  5H1U A;  2KWN A;  4YBM A;  3LDY A;  5H1V A;  2DSM A;  3JUE A;  1WES A;  4H9D A;  4BHW A;  2YYR A;  2MA6 A;  5LKX A;  2IQJ A;  3N9O A;  3ZTG A;  5H1T A;  4WZ0 A;  2XEU A;  3I2D A;  3LVR E;  4AYC B;  5B8D A;  3N9N A;  4AP4 A;  4YAB A;  5B78 A;  5G0F A;  2RR4 A;  3DWD A;  4O62 A;  5LKU A;  3DDT A;  4LKA A;  3ZVZ B;  5D1K B;  2IDA A;  3MHS A;  3RPG C;  2KE1 A;  2M13 A;  2CRW A;  2G6Q A;  2D8S A;  3FAN A;  4S3O C;  4Q6F A;  1WIM A;  5TDW A;  4V3K C;  5LKT A;  2L75 A;  3KV6 A;  2OWA A;  2OXQ C;  4R7E A;  2XB1 A;  5KH3 A;  2C2L A;  2LAU A;  2JUN A;  2FUI A;  2LRI C;  4N4F A;  2B0O E;  2UZG A;  5FEY A;  4MSX A;  4FIP A;  1MM3 A;  2ZET C;  3H7H A;  3N9M A;  1VYX A;  2KKY A;  4YAD A;  2EA6 A;  2LGV A;  2QIZ A;  2M6M A;  1E4U A;  4PTB A;  2M3H A;  1VFY A;  2VJF B;  1VD4 A;  4UP0 A;  1X4J A;  5KH7 A;  3LVQ E;  3O36 A;  3SUB A;  2FFW A;  3O33 A;  2H0D B;  2JMJ A;  2JMI A;  2LXP C;  4C9Z A;  2CRR A;  4I7C A;  2ECV A;  4GND A;  4YC9 A;  3KDE C;  3MHH A;  2XP0 A;  3KNV A;  4XI1 A;  3LQJ A;  2FSA A;  3C5K A;  2LGG A;  3M99 A;  3NG2 A;  1Z6U A;  2KWO A;  2H0D A;  2ECI A;  2VPB A;  2YHN A;  3O7A A;  4OGC A;  5DKA A;  5I3L A;  4LLB A;  4A0C D;  5AIU A;  2JRJ A;  3GV4 A;  2L7P A;  2YT5 A;  2KGI A;  2Y1M A;  2KWK A;  4UP5 A;  2YU4 A;  2CSY A;  1WEN A;  3L1X A;  1F62 A;  2K4D A;  5TAB A;  4GNE A;  3ASL A;  3L11 A;  1Z60 A;  5SVI B;  4GNG A;  5J3X A;  2Y1N A;  3ZVY A;  1V87 A;  5G05 B;  3SOX A;  3ZPV 1;  2LDR A;  4OGE A;  1HYI A;  4A4C A;  5C13 A;  2QIC A;  2K16 A;  4IC3 A;  3PUQ A;  4CA1 A;  5C11 A;  3M7K A;  5B79 A;  2KIZ A;  3O37 A;  4BBQ A;  1N87 A;  2M85 A;  5H9M A;  3SOW A;  3N9L A;  3T6R A;  4L7X A;  3U5O A;  4UI9 B;  2FUU A;  4PPE A;  3T7L A;  4X3G A;  1FBV A;  4IC2 A;  2EGM A;  2KR4 A;  2FD4 A;  2NAA A;  2EXU A;  2VPG A;  2BAY A;  2MA5 A;  4AYC A;  4YBS A;  4FJC A;  4ZQL A;  2F6N A;  4QF2 A;  2DX8 A;  2ECJ A;  3SHB A;  4F1P A;  4R2Y A;  1X4I A;  2EGP A;  2YVR A;  2KFT A;  2MUM A;  3N9P A;  1WEQ A;  2YUC A;  2CSZ A;  2VPE A;  4YBT A;  1WEV A;  1HYJ A;  3EB6 A;  5K3Q A;  3E2D A;  4WZ3 B;  2I50 A;  5FB0 A;  1ZBD B;  2JMD A;  4R8P K;  5SVX A;  5LKZ A;  5EYA F;  2DJA A;  3U5M A;  2YRE A;  4Z0O A;  3LRQ A;  2QJ0 A;  3EB5 A;  4W4U A;  5D1M B;  1WEM A;  4P5O B;  2L43 A;  2K17 A;  3PUR A;  1T1H A;  3N9Q A;  2VJF A;  2VPD A;  3FL2 A;  4WA6 A;  2VJE B;  1K2F A;  1WIL A;  3Q1D A;  1FP0 A;  3KQI A;  1IYM A;  2CKL B;  5LCW B;  2D8U A;  2LGK A; 
#chains in the Genus database with same CATH homology
 4ZDT A;  1MM2 A;  2LGL A;  5FB1 A;  5FER A;  3M63 A;  2MNY A;  1G25 A;  2L80 A;  2RI7 A;  2C2V S;  3U5N A;  2ECW A;  4B7Y C;  1WEP A;  4A4B A;  1BOR A;  3VK6 A;  2K1J A;  3L1Z B;  2LV9 A;  3KV5 A;  3PHD A;  2EOD A;  1JOC A;  2KRE A;  2PNX A;  4ZUX U;  3ZNI A;  3IHP A;  1U6G B;  1CHC A;  3ZYQ A;  2M1R A;  1WEO A;  4TKP B;  2MIQ A;  4N3W A;  4I7D A;  5TBN A;  4V3L C;  1WE9 A;  3HCU A;  3C6W A;  2E6S A;  4L58 A;  1WEE A;  2G43 A;  5TRB A;  4NN2 A;  4LJN A;  3O35 A;  1WGM A;  1XWH A;  2RSD A;  2MD7 B;  4LK9 A;  5D1L B;  2CT2 A;  2ECN A;  2YUR A;  3LQI A;  4AUQ B;  2L5U A;  2KU3 A;  2VP7 A;  2ECT A;  5B76 A;  4A49 A;  3RPG B;  4GB0 A;  3DQV R;  3DPL R;  4FO9 A;  1X4U A;  2KGG A;  4S3O B;  5G04 B;  3O34 A;  3HTK C;  2Y43 A;  2KYU A;  4FK5 A;  1DVP A;  1LDK C;  1JM7 B;  2HDP A;  4WZ2 A;  4GNF A;  3RTR B;  2ECG A;  2F42 A;  1Z2Q A;  3M62 A;  4MVT A;  1JM7 A;  4AVX A;  4QF3 A;  2YQL A;  2YSJ A;  2YQM A;  1LDJ B;  2YSM A;  3U5P A;  2AN6 A;  3SOU A;  4F52 B;  1WEU A;  4YAX A;  3LQH A;  2LXH C;  3ZPV E;  5DIN A;  1RMD A;  4YAT A;  2LN0 A;  5AIT A;  4O64 A;  2E6R A;  2L0B A;  2YW8 A;  5TDR A;  3O70 A;  2F6J A;  2KWJ A;  2VJE A;  2LQ6 A;  1WEW A;  3GL6 A;  4CCG X;  2CKL A;  2HYE D;  3QZV A;  3HCT A;  2MD8 C;  1WFK A;  5B75 A;  4LAD B;  2MT5 A;  2MNZ A;  4I7B A;  2YHO A;  5KH9 A;  5JG6 A;  2G45 A;  3HCS A;  4B86 C;  3V43 A;  5B77 A;  2VNF A;  2PUY A;  5H1U A;  2KWN A;  4YBM A;  5H1V A;  1WES A;  4BHW A;  2YYR A;  2MA6 A;  5LKX A;  3N9O A;  3ZTG A;  5H1T A;  4WZ0 A;  2XEU A;  3I2D A;  4AYC B;  5B8D A;  3N9N A;  4AP4 A;  4YAB A;  5B78 A;  5G0F A;  5LKU A;  4LKA A;  3ZVZ B;  5D1K B;  2IDA A;  3MHS A;  3RPG C;  2KE1 A;  2G6Q A;  2D8S A;  4S3O C;  4Q6F A;  1WIM A;  5TDW A;  4V3K C;  5LKT A;  2L75 A;  3KV6 A;  2OXQ C;  4R7E A;  2XB1 A;  5KH3 A;  2C2L A;  2FUI A;  2LRI C;  4N4F A;  2UZG A;  5FEY A;  4MSX A;  4FIP A;  1MM3 A;  2ZET C;  3N9M A;  1VYX A;  4YAD A;  2EA6 A;  2LGV A;  2QIZ A;  2M6M A;  1E4U A;  4PTB A;  2M3H A;  1VFY A;  2VJF B;  1VD4 A;  4UP0 A;  1X4J A;  5KH7 A;  3O36 A;  3O33 A;  2H0D B;  2JMJ A;  2JMI A;  2LXP C;  4C9Z A;  4I7C A;  2ECV A;  4GND A;  4YC9 A;  3MHH A;  3KNV A;  4XI1 A;  3LQJ A;  2FSA A;  3C5K A;  2LGG A;  3M99 A;  3NG2 A;  1Z6U A;  2KWO A;  2H0D A;  2ECI A;  2VPB A;  2YHN A;  3O7A A;  5DKA A;  5I3L A;  4LLB A;  4A0C D;  5AIU A;  2JRJ A;  3GV4 A;  2YT5 A;  2KGI A;  2Y1M A;  2KWK A;  4UP5 A;  2YU4 A;  2CSY A;  1WEN A;  3L1X A;  1F62 A;  2K4D A;  5TAB A;  4GNE A;  3ASL A;  3L11 A;  1Z60 A;  4GNG A;  5J3X A;  2Y1N A;  3ZVY A;  1V87 A;  5G05 B;  3SOX A;  3ZPV 1;  2LDR A;  1HYI A;  4A4C A;  5C13 A;  2QIC A;  2K16 A;  4IC3 A;  3PUQ A;  4CA1 A;  5C11 A;  5B79 A;  2KIZ A;  3O37 A;  4BBQ A;  1N87 A;  2M85 A;  5H9M A;  3SOW A;  3N9L A;  3T6R A;  4L7X A;  3U5O A;  4UI9 B;  2FUU A;  4PPE A;  3T7L A;  4X3G A;  1FBV A;  4IC2 A;  2KR4 A;  2NAA A;  2VPG A;  2BAY A;  2MA5 A;  4AYC A;  4YBS A;  4FJC A;  4ZQL A;  2F6N A;  4QF2 A;  2DX8 A;  2ECJ A;  3SHB A;  4R2Y A;  1X4I A;  2EGP A;  2KFT A;  2MUM A;  3N9P A;  1WEQ A;  2YUC A;  2CSZ A;  2VPE A;  4YBT A;  1WEV A;  1HYJ A;  3EB6 A;  4WZ3 B;  2I50 A;  5FB0 A;  1ZBD B;  2JMD A;  4R8P K;  5LKZ A;  5EYA F;  3U5M A;  2YRE A;  3LRQ A;  2QJ0 A;  3EB5 A;  4W4U A;  5D1M B;  1WEM A;  4P5O B;  2L43 A;  2K17 A;  3PUR A;  1T1H A;  3N9Q A;  2VJF A;  2VPD A;  3FL2 A;  4WA6 A;  2VJE B;  1K2F A;  1WIL A;  1FP0 A;  3KQI A;  1IYM A;  2CKL B;  5LCW B;  2LGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...