2KFTA

Nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
GSKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autoimmune regulator
publication title Structure and Site-Specific Recognition of Histone H3 by the PHD Finger of Human Autoimmune Regulator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kftA00
2LGLA 4QF3A 4UI9B 2ECIA 2Y43A 1WIMA 3U5PA 1BORA 4R8PK 3ZPV1 2VPBA 3O36A 1JM7A 5DKAA 1X4JA 2L43A 4N4FA 4YBSA 2L75A 5B79A 3RTRB 2JMJA 4N3WA 5H9MA 2VPEA 4O64A 4W4UA 4MVTA 5C13A 2LV9A 2MT5A 3MHHA 2K1JA 5G05B 3HCSA 5FB0A 2RSDA 2YQMA 4B7YC 2YREA 2H0DA 2VJFA 4IC3A 3ZVZB 2KU3A 5B8DA 3N9MA 3O34A 1ZBDB 4BBQA 2EODA 3N9OA 3MHSA 3FL2A 1Z60A 4BHWA 5TRBA 1WEEA 3SOUA 2Y1MA 4WZ3B 5DINA 4GNFA 4CCGX 2UZGA 1WEVA 4I7CA 4L7XA 5B75A 2K16A 4WZ0A 5LKZA 3GV4A 5H1VA 5B78A 1RMDA 2YHNA 1LDKC 1WENA 3O7AA 2ECNA 2G6QA 4S3OB 2YSMA 4LJNA 1HYIA 4XI1A 3M62A 1WEQA 2VJEA 5FB1A 1JOCA 2ECJA 3L11A 3HCTA 2ECVA 4L58A 3U5OA 2HYED 2L80A 2FUIA 1VD4A 1X4UA 1Z6UA 3N9QA 2AN6A 3NG2A 2LGKA 3ZVYA 2M85A 4YATA 3O70A 5KH9A 4WA6A 4FIPA 2C2VS 4LK9A 2CSYA 4ZDTA 2OXQC 4B86C 5G0FA 2F6JA 4Q6FA 2MNZA 3LQHA 3M99A 2M3HA 3DPLR 2KGGA 5I3LA 2KYUA 2E6RA 2LXHC 3O35A 2K17A 1G25A 4YC9A 4YBMA 1F62A 2JRJA 1WE9A 2MD7B 1CHCA 4F52B 2F6NA 2I50A 1T1HA 2PNXA 1MM2A 3ZTGA 3C6WA 3ZPVE 2MD8C 1V87A 1WFKA 4PPEA 4A4BA 4FK5A 2PUYA 4NN2A 1JM7B 5D1MB 5TDRA 1WEOA 4GNGA 4I7BA 1VYXA 2YURA 1WGMA 5EYAF 2YUCA 3U5MA 2KE1A 4YAXA 5AITA 5LKUA 4C9ZA 4CA1A 2C2LA 4QF2A 4S3OC 2YYRA 2LQ6A 4R2YA 5J3XA 2YHOA 4LKAA 4FO9A 5AIUA 3GL6A 1Z2QA 4PTBA 3U5NA 3ZNIA 2M6MA 3EB5A 3KNVA 5LCWB 2LDRA 2KWOA 4AYCB 3PHDA 1WESA 2MNYA 3RPGB 3T7LA 4GB0A 2FUUA 4YBTA 1E4UA 4UP5A 3VK6A 2G45A 2KIZA 3L1ZB 3ZYQA 5B77A 3KQIA 4YABA 4WZ2A 5C11A 1X4IA 2F42A 2MUMA 2XEUA 3M63A 2G43A 2KGIA 4MSXA 2LGGA 2VPDA 1WEMA 2KWKA 3LQIA 2MA6A 1WEWA 4ZQLA 3L1XA 2YT5A 2KR4A 2CT2A 3LRQA 4TKPB 3QZVA 4X3GA 2ECTA 2Y1NA 2KFTA 2JMDA 2CKLB 3PUQA 2QJ0A 3EB6A 2KWNA 4IC2A 4V3LC 5KH7A 2LN0A 2KREA 3PURA 2IDAA 2QICA 3N9NA 1DVPA 1IYMA 2YU4A 5LKTA 1WEUA 5FERA 2KWJA 4UP0A 5FEYA 3KV6A 5LKXA 2MIQA 2JMIA 2M1RA 3I2DA 5D1KB 2D8SA 2BAYA 5G04B 3IHPA 1K2FA 4P5OB 3LQJA 5KH3A 3SOWA 4AP4A 2ECGA 1U6GB 2H0DB 2CSZA 2VJFB 5B76A 4I7DA 4AYCA 1WEPA 1XWHA 2XB1A 3SHBA 3KV5A 3N9PA 1LDJB 2VNFA 3ASLA 4AUQB 5TABA 2VPGA 4YADA 5D1LB 1FP0A 3SOXA 3T6RA 2ECWA 2EA6A 2L5UA 4A0CD 1MM3A 4AVXA 2FSAA 4LLBA 3C5KA 2L0BA 2YSJA 3DQVR 4LADB 2LRIC 2K4DA 5TBNA 2RI7A 3RPGC 4GNDA 1WILA 2LGVA 1HYJA 1VFYA 3V43A 2NAAA 2LXPC 2EGPA 4ZUXU 2HDPA 3HCUA 1N87A 2DX8A 3HTKC 5H1UA 4R7EA 4A49A 3O33A 2YQLA 4V3KC 1FBVA 2E6SA 2VP7A 2VJEB 2YW8A 4A4CA 4FJCA 5TDWA 2CKLA 4GNEA 2ZETC 3O37A 3N9LA 5JG6A 5H1TA 2QIZA 2MA5A
chains in the Genus database with same CATH superfamily
2LGLA 4QF3A 4UI9B 2ECIA 2Y43A 1WIMA 3U5PA 3DDTA 1BORA 4Z0OA 4R8PK 3ZPV1 2VPBA 3O36A 1JM7A 5DKAA 1X4JA 2L43A 4N4FA 4YBSA 2L75A 5B79A 3RTRB 2JMJA 4N3WA 5SVIA 2B0OE 5H9MA 2VPEA 3LVRE 4O64A 4W4UA 3O47A 4MVTA 5C13A 2LV9A 2XOYA 2MT5A 3MHHA 2K1JA 5G05B 3HCSA 5FB0A 2RSDA 2YQMA 4B7YC 2YREA 2H0DA 2VJFA 4IC3A 2KKXA 3ZVZB 2KU3A 5B8DA 3N9MA 2EXUA 3O34A 1ZBDB 4BBQA 2CRWA 2EODA 3FJUB 3T9KA 3N9OA 3MHSA 3H7HA 3FL2A 2FFWA 2XOCA 1Z60A 4BHWA 5TRBA 1WEEA 3SOUA 4Z0RA 2Y1MA 4WZ3B 5DINA 4GNFA 4CCGX 2UZGA 1WEVA 4I7CA 1MBMA 4L7XA 5B75A 2K16A 4WZ0A 5LKZA 5SVYA 3GV4A 5H1VA 5B78A 1RMDA 2YHNA 1LDKC 1WENA 3O7AA 3M7KA 2ECNA 2G6QA 4S3OB 1DCQA 2YSMA 4LJNA 1HYIA 4XI1A 3M62A 4F1PA 1WEQA 2VJEA 3FANA 5FB1A 1JOCA 2ECJA 3L11A 3HCTA 2ECVA 4L58A 3U5OA 2HYED 2L80A 4OGEA 2CRRA 2FUIA 1VD4A 1X4UA 1Z6UA 2XOZA 3N9QA 3Q1DA 2AN6A 3NG2A 2LGKA 3ZVYA 2FD4A 2M85A 4YATA 3O70A 5KH9A 2JM3A 4WA6A 4FIPA 2C2VS 4LK9A 2CSYA 4ZDTA 2OXQC 4B86C 5G0FA 2F6JA 4Q6FA 3FEHA 2MNZA 3LQHA 3M99A 2M3HA 3DPLR 2KGGA 5I3LA 2KYUA 2E6RA 2LXHC 4QQ4A 3O35A 2K17A 1G25A 4YC9A 4YBMA 1F62A 2JRJA 1WE9A 3LDYA 2MD7B 1CHCA 4F52B 2F6NA 2I50A 1T1HA 2PNXA 1MM2A 3ZTGA 3C6WA 3ZPVE 2MD8C 1V87A 1WFKA 4PPEA 4A4BA 2P57A 4FK5A 2PUYA 4NN2A 1JM7B 5D1MB 5TDRA 1WEOA 4GNGA 4I7BA 1VYXA 2YURA 1WGMA 5EYAF 2YUCA 2OWAA 3U5MA 2KE1A 4YAXA 4H9DA 5AITA 5LKUA 4C9ZA 4CA1A 2C2LA 4QF2A 2EGMA 2YYRA 4S3OC 2LQ6A 2RR4A 4R2YA 5J3XA 2CSVA 2DJAA 2YHOA 4LKAA 4FO9A 5AIUA 3GL6A 1Z2QA 4PTBA 3U5NA 3ZNIA 2M6MA 3EB5A 3KNVA 5LCWB 2M13A 2LDRA 2KWOA 4AYCB 3PHDA 3MDBC 1WESA 2MNYA 3RPGB 3T7LA 4GB0A 2FUUA 4YBTA 1E4UA 4UP5A 3VK6A 2G45A 2KIZA 3L1ZB 3ZYQA 5B77A 3FAOA 3KQIA 4YABA 4WZ2A 5C11A 2JUNA 1X4IA 2YVRA 2F42A 2MUMA 2XEUA 3M63A 2MKEA 2G43A 2KGIA 4MSXA 2LGGA 2VPDA 1WEMA 2KWKA 3LQIA 2MA6A 1WEWA 4ZQLA 3L1XA 2YT5A 5K3QA 2KR4A 2CT2A 3LRQA 4TKPB 3QZVA 4X3GA 2KKYA 2ECTA 2Y1NA 2KFTA 2JMDA 2IQJA 2E61A 2CKLB 2LAUA 3PUQA 2QJ0A 3EB6A 3KDEC 3LJUX 2KWNA 4OGCA 2D8UA 4IC2A 2L7PA 4V3LC 5KH7A 2LN0A 2KREA 3PURA 2IDAA 3LVQE 2QICA 2XP0A 3N9NA 1DVPA 3JUEA 1IYMA 2YU4A 5LKTA 1WEUA 5FERA 2KWJA 5SVIB 4UP0A 5FEYA 3KV6A 3E2DA 5LKXA 2MIQA 2JMIA 2M1RA 3I2DA 5D1KB 2D8SA 2BAYA 5G04B 3IHPA 1K2FA 4P5OB 3LQJA 5KH3A 3SOWA 4AP4A 2ECGA 1U6GB 2H0DB 2CSZA 2VJFB 5B76A 4I7DA 4AYCA 1WEPA 1XWHA 2XB1A 3SHBA 3KV5A 3N9PA 3SUBA 1LDJB 2VNFA 3PLWA 3ASLA 4AUQB 5SVXA 5TABA 2VPGA 4YADA 5D1LB 1FP0A 3SOXA 3T6RA 2ECWA 2EA6A 2L5UA 4A0CD 1MM3A 4AVXA 2FSAA 3DWDA 4LLBA 3C5KA 2L0BA 2YSJA 3DQVR 4LADB 2LRIC 2K4DA 5TBNA 2RI7A 3RPGC 4GNDA 2CONA 1WILA 4O62A 2LGVA 1HYJA 1VFYA 3V43A 2NAAA 2LXPC 2EGPA 4ZUXU 2HDPA 3HCUA 1N87A 2DSMA 2DX8A 3HTKC 5H1UA 4R7EA 4A49A 3O33A 2YQLA 4V3KC 1FBVA 2E6SA 2VP7A 2VJEB 2YW8A 4A4CA 4FJCA 5TDWA 2CKLA 4GNEA 2ZETC 3O37A 3N9LA 3FM8C 5JG6A 5H1TA 2QIZA 2MA5A
chains in the Genus database with same CATH topology
2LGLA 4QF3A 4UI9B 2ECIA 2Y43A 1WIMA 3U5PA 1BORA 4R8PK 3ZPV1 2VPBA 3O36A 1JM7A 5DKAA 1X4JA 2L43A 4N4FA 4YBSA 2L75A 5B79A 3RTRB 2JMJA 4N3WA 5H9MA 2VPEA 4O64A 4W4UA 4MVTA 5C13A 2LV9A 2MT5A 3MHHA 2K1JA 5G05B 3HCSA 5FB0A 2RSDA 2YQMA 4B7YC 2YREA 2H0DA 2VJFA 4IC3A 3ZVZB 2KU3A 5B8DA 3N9MA 3O34A 1ZBDB 4BBQA 2EODA 3N9OA 3MHSA 3FL2A 1Z60A 4BHWA 5TRBA 1WEEA 3SOUA 2Y1MA 4WZ3B 5DINA 4GNFA 4CCGX 2UZGA 1WEVA 4I7CA 4L7XA 5B75A 2K16A 4WZ0A 5LKZA 3GV4A 5H1VA 5B78A 1RMDA 2YHNA 1LDKC 1WENA 3O7AA 2ECNA 2G6QA 4S3OB 2YSMA 4LJNA 1HYIA 4XI1A 3M62A 1WEQA 2VJEA 5FB1A 1JOCA 2ECJA 3L11A 3HCTA 2ECVA 4L58A 3U5OA 2HYED 2L80A 2FUIA 1VD4A 1X4UA 1Z6UA 3N9QA 2AN6A 3NG2A 2LGKA 3ZVYA 2M85A 4YATA 3O70A 5KH9A 4WA6A 4FIPA 2C2VS 4LK9A 2CSYA 4ZDTA 2OXQC 4B86C 5G0FA 2F6JA 4Q6FA 2MNZA 3LQHA 3M99A 2M3HA 3DPLR 2KGGA 5I3LA 2KYUA 2E6RA 2LXHC 3O35A 2K17A 1G25A 4YC9A 4YBMA 1F62A 2JRJA 1WE9A 2MD7B 1CHCA 4F52B 2F6NA 2I50A 1T1HA 2PNXA 1MM2A 3ZTGA 3C6WA 3ZPVE 2MD8C 1V87A 1WFKA 4PPEA 4A4BA 4FK5A 2PUYA 4NN2A 1JM7B 5D1MB 5TDRA 1WEOA 4GNGA 4I7BA 1VYXA 2YURA 1WGMA 5EYAF 2YUCA 3U5MA 2KE1A 4YAXA 5AITA 5LKUA 4C9ZA 4CA1A 2C2LA 4QF2A 4S3OC 2YYRA 2LQ6A 4R2YA 5J3XA 2YHOA 4LKAA 4FO9A 5AIUA 3GL6A 1Z2QA 4PTBA 3U5NA 3ZNIA 2M6MA 3EB5A 3KNVA 5LCWB 2LDRA 2KWOA 4AYCB 3PHDA 1WESA 2MNYA 3RPGB 3T7LA 4GB0A 2FUUA 4YBTA 1E4UA 4UP5A 3VK6A 2G45A 2KIZA 3L1ZB 3ZYQA 5B77A 3KQIA 4YABA 4WZ2A 5C11A 1X4IA 2F42A 2MUMA 2XEUA 3M63A 2G43A 2KGIA 4MSXA 2LGGA 2VPDA 1WEMA 2KWKA 3LQIA 2MA6A 1WEWA 4ZQLA 3L1XA 2YT5A 2KR4A 2CT2A 3LRQA 4TKPB 3QZVA 4X3GA 2ECTA 2Y1NA 2KFTA 2JMDA 2CKLB 3PUQA 2QJ0A 3EB6A 2KWNA 4IC2A 4V3LC 5KH7A 2LN0A 2KREA 3PURA 2IDAA 2QICA 3N9NA 1DVPA 1IYMA 2YU4A 5LKTA 1WEUA 5FERA 2KWJA 4UP0A 5FEYA 3KV6A 5LKXA 2MIQA 2JMIA 2M1RA 3I2DA 5D1KB 2D8SA 2BAYA 5G04B 3IHPA 1K2FA 4P5OB 3LQJA 5KH3A 3SOWA 4AP4A 2ECGA 1U6GB 2H0DB 2CSZA 2VJFB 5B76A 4I7DA 4AYCA 1WEPA 1XWHA 2XB1A 3SHBA 3KV5A 3N9PA 1LDJB 2VNFA 3ASLA 4AUQB 5TABA 2VPGA 4YADA 5D1LB 1FP0A 3SOXA 3T6RA 2ECWA 2EA6A 2L5UA 4A0CD 1MM3A 4AVXA 2FSAA 4LLBA 3C5KA 2L0BA 2YSJA 3DQVR 4LADB 2LRIC 2K4DA 5TBNA 2RI7A 3RPGC 4GNDA 1WILA 2LGVA 1HYJA 1VFYA 3V43A 2NAAA 2LXPC 2EGPA 4ZUXU 2HDPA 3HCUA 1N87A 2DX8A 3HTKC 5H1UA 4R7EA 4A49A 3O33A 2YQLA 4V3KC 1FBVA 2E6SA 2VP7A 2VJEB 2YW8A 4A4CA 4FJCA 5TDWA 2CKLA 4GNEA 2ZETC 3O37A 3N9LA 5JG6A 5H1TA 2QIZA 2MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGL A;  4QF3 A;  4UI9 B;  2ECI A;  2Y43 A;  1WIM A;  3U5P A;  1BOR A;  4R8P K;  3ZPV 1;  2VPB A;  3O36 A;  1JM7 A;  5DKA A;  1X4J A;  2L43 A;  4N4F A;  4YBS A;  2L75 A;  5B79 A;  3RTR B;  2JMJ A;  4N3W A;  5H9M A;  2VPE A;  4O64 A;  4W4U A;  4MVT A;  5C13 A;  2LV9 A;  2MT5 A;  3MHH A;  2K1J A;  5G05 B;  3HCS A;  5FB0 A;  2RSD A;  2YQM A;  4B7Y C;  2YRE A;  2H0D A;  2VJF A;  4IC3 A;  3ZVZ B;  2KU3 A;  5B8D A;  3N9M A;  3O34 A;  1ZBD B;  4BBQ A;  2EOD A;  3N9O A;  3MHS A;  3FL2 A;  1Z60 A;  4BHW A;  5TRB A;  1WEE A;  3SOU A;  2Y1M A;  4WZ3 B;  5DIN A;  4GNF A;  4CCG X;  2UZG A;  1WEV A;  4I7C A;  4L7X A;  5B75 A;  2K16 A;  4WZ0 A;  5LKZ A;  3GV4 A;  5H1V A;  5B78 A;  1RMD A;  2YHN A;  1LDK C;  1WEN A;  3O7A A;  2ECN A;  2G6Q A;  4S3O B;  2YSM A;  4LJN A;  1HYI A;  4XI1 A;  3M62 A;  1WEQ A;  2VJE A;  5FB1 A;  1JOC A;  2ECJ A;  3L11 A;  3HCT A;  2ECV A;  4L58 A;  3U5O A;  2HYE D;  2L80 A;  2FUI A;  1VD4 A;  1X4U A;  1Z6U A;  3N9Q A;  2AN6 A;  3NG2 A;  2LGK A;  3ZVY A;  2M85 A;  4YAT A;  3O70 A;  5KH9 A;  4WA6 A;  4FIP A;  2C2V S;  4LK9 A;  2CSY A;  4ZDT A;  2OXQ C;  4B86 C;  5G0F A;  2F6J A;  4Q6F A;  2MNZ A;  3LQH A;  3M99 A;  2M3H A;  3DPL R;  2KGG A;  5I3L A;  2KYU A;  2E6R A;  2LXH C;  3O35 A;  2K17 A;  1G25 A;  4YC9 A;  4YBM A;  1F62 A;  2JRJ A;  1WE9 A;  2MD7 B;  1CHC A;  4F52 B;  2F6N A;  2I50 A;  1T1H A;  2PNX A;  1MM2 A;  3ZTG A;  3C6W A;  3ZPV E;  2MD8 C;  1V87 A;  1WFK A;  4PPE A;  4A4B A;  4FK5 A;  2PUY A;  4NN2 A;  1JM7 B;  5D1M B;  5TDR A;  1WEO A;  4GNG A;  4I7B A;  1VYX A;  2YUR A;  1WGM A;  5EYA F;  2YUC A;  3U5M A;  2KE1 A;  4YAX A;  5AIT A;  5LKU A;  4C9Z A;  4CA1 A;  2C2L A;  4QF2 A;  4S3O C;  2YYR A;  2LQ6 A;  4R2Y A;  5J3X A;  2YHO A;  4LKA A;  4FO9 A;  5AIU A;  3GL6 A;  1Z2Q A;  4PTB A;  3U5N A;  3ZNI A;  2M6M A;  3EB5 A;  3KNV A;  5LCW B;  2LDR A;  2KWO A;  4AYC B;  3PHD A;  1WES A;  2MNY A;  3RPG B;  3T7L A;  4GB0 A;  2FUU A;  4YBT A;  1E4U A;  4UP5 A;  3VK6 A;  2G45 A;  2KIZ A;  3L1Z B;  3ZYQ A;  5B77 A;  3KQI A;  4YAB A;  4WZ2 A;  5C11 A;  1X4I A;  2F42 A;  2MUM A;  2XEU A;  3M63 A;  2G43 A;  2KGI A;  4MSX A;  2LGG A;  2VPD A;  1WEM A;  2KWK A;  3LQI A;  2MA6 A;  1WEW A;  4ZQL A;  3L1X A;  2YT5 A;  2KR4 A;  2CT2 A;  3LRQ A;  4TKP B;  3QZV A;  4X3G A;  2ECT A;  2Y1N A;  2KFT A;  2JMD A;  2CKL B;  3PUQ A;  2QJ0 A;  3EB6 A;  2KWN A;  4IC2 A;  4V3L C;  5KH7 A;  2LN0 A;  2KRE A;  3PUR A;  2IDA A;  2QIC A;  3N9N A;  1DVP A;  1IYM A;  2YU4 A;  5LKT A;  1WEU A;  5FER A;  2KWJ A;  4UP0 A;  5FEY A;  3KV6 A;  5LKX A;  2MIQ A;  2JMI A;  2M1R A;  3I2D A;  5D1K B;  2D8S A;  2BAY A;  5G04 B;  3IHP A;  1K2F A;  4P5O B;  3LQJ A;  5KH3 A;  3SOW A;  4AP4 A;  2ECG A;  1U6G B;  2H0D B;  2CSZ A;  2VJF B;  5B76 A;  4I7D A;  4AYC A;  1WEP A;  1XWH A;  2XB1 A;  3SHB A;  3KV5 A;  3N9P A;  1LDJ B;  2VNF A;  3ASL A;  4AUQ B;  5TAB A;  2VPG A;  4YAD A;  5D1L B;  1FP0 A;  3SOX A;  3T6R A;  2ECW A;  2EA6 A;  2L5U A;  4A0C D;  1MM3 A;  4AVX A;  2FSA A;  4LLB A;  3C5K A;  2L0B A;  2YSJ A;  3DQV R;  4LAD B;  2LRI C;  2K4D A;  5TBN A;  2RI7 A;  3RPG C;  4GND A;  1WIL A;  2LGV A;  1HYJ A;  1VFY A;  3V43 A;  2NAA A;  2LXP C;  2EGP A;  4ZUX U;  2HDP A;  3HCU A;  1N87 A;  2DX8 A;  3HTK C;  5H1U A;  4R7E A;  4A49 A;  3O33 A;  2YQL A;  4V3K C;  1FBV A;  2E6S A;  2VP7 A;  2VJE B;  2YW8 A;  4A4C A;  4FJC A;  5TDW A;  2CKL A;  4GNE A;  2ZET C;  3O37 A;  3N9L A;  5JG6 A;  5H1T A;  2QIZ A;  2MA5 A; 
#chains in the Genus database with same CATH topology
 2LGL A;  4QF3 A;  4UI9 B;  2ECI A;  2Y43 A;  1WIM A;  3U5P A;  3DDT A;  1BOR A;  4Z0O A;  4R8P K;  3ZPV 1;  2VPB A;  3O36 A;  1JM7 A;  5DKA A;  1X4J A;  2L43 A;  4N4F A;  4YBS A;  2L75 A;  5B79 A;  3RTR B;  2JMJ A;  4N3W A;  5SVI A;  2B0O E;  5H9M A;  2VPE A;  3LVR E;  4O64 A;  4W4U A;  3O47 A;  4MVT A;  5C13 A;  2LV9 A;  2XOY A;  2MT5 A;  3MHH A;  2K1J A;  5G05 B;  3HCS A;  5FB0 A;  2RSD A;  2YQM A;  4B7Y C;  2YRE A;  2H0D A;  2VJF A;  4IC3 A;  2KKX A;  3ZVZ B;  2KU3 A;  5B8D A;  3N9M A;  2EXU A;  3O34 A;  1ZBD B;  4BBQ A;  2CRW A;  2EOD A;  3FJU B;  3T9K A;  3N9O A;  3MHS A;  3H7H A;  3FL2 A;  2FFW A;  2XOC A;  1Z60 A;  4BHW A;  5TRB A;  1WEE A;  3SOU A;  4Z0R A;  2Y1M A;  4WZ3 B;  5DIN A;  4GNF A;  4CCG X;  2UZG A;  1WEV A;  4I7C A;  1MBM A;  4L7X A;  5B75 A;  2K16 A;  4WZ0 A;  5LKZ A;  5SVY A;  3GV4 A;  5H1V A;  5B78 A;  1RMD A;  2YHN A;  1LDK C;  1WEN A;  3O7A A;  3M7K A;  2ECN A;  2G6Q A;  4S3O B;  1DCQ A;  2YSM A;  4LJN A;  1HYI A;  4XI1 A;  3M62 A;  4F1P A;  1WEQ A;  2VJE A;  3FAN A;  5FB1 A;  1JOC A;  2ECJ A;  3L11 A;  3HCT A;  2ECV A;  4L58 A;  3U5O A;  2HYE D;  2L80 A;  4OGE A;  2CRR A;  2FUI A;  1VD4 A;  1X4U A;  1Z6U A;  2XOZ A;  3N9Q A;  3Q1D A;  2AN6 A;  3NG2 A;  2LGK A;  3ZVY A;  2FD4 A;  2M85 A;  4YAT A;  3O70 A;  5KH9 A;  2JM3 A;  4WA6 A;  4FIP A;  2C2V S;  4LK9 A;  2CSY A;  4ZDT A;  2OXQ C;  4B86 C;  5G0F A;  2F6J A;  4Q6F A;  3FEH A;  2MNZ A;  3LQH A;  3M99 A;  2M3H A;  3DPL R;  2KGG A;  5I3L A;  2KYU A;  2E6R A;  2LXH C;  4QQ4 A;  3O35 A;  2K17 A;  1G25 A;  4YC9 A;  4YBM A;  1F62 A;  2JRJ A;  1WE9 A;  3LDY A;  2MD7 B;  1CHC A;  4F52 B;  2F6N A;  2I50 A;  1T1H A;  2PNX A;  1MM2 A;  3ZTG A;  3C6W A;  3ZPV E;  2MD8 C;  1V87 A;  1WFK A;  4PPE A;  4A4B A;  2P57 A;  4FK5 A;  2PUY A;  4NN2 A;  1JM7 B;  5D1M B;  5TDR A;  1WEO A;  4GNG A;  4I7B A;  1VYX A;  2YUR A;  1WGM A;  5EYA F;  2YUC A;  2OWA A;  3U5M A;  2KE1 A;  4YAX A;  4H9D A;  5AIT A;  5LKU A;  4C9Z A;  4CA1 A;  2C2L A;  4QF2 A;  2EGM A;  2YYR A;  4S3O C;  2LQ6 A;  2RR4 A;  4R2Y A;  5J3X A;  2CSV A;  2DJA A;  2YHO A;  4LKA A;  4FO9 A;  5AIU A;  3GL6 A;  1Z2Q A;  4PTB A;  3U5N A;  3ZNI A;  2M6M A;  3EB5 A;  3KNV A;  5LCW B;  2M13 A;  2LDR A;  2KWO A;  4AYC B;  3PHD A;  3MDB C;  1WES A;  2MNY A;  3RPG B;  3T7L A;  4GB0 A;  2FUU A;  4YBT A;  1E4U A;  4UP5 A;  3VK6 A;  2G45 A;  2KIZ A;  3L1Z B;  3ZYQ A;  5B77 A;  3FAO A;  3KQI A;  4YAB A;  4WZ2 A;  5C11 A;  2JUN A;  1X4I A;  2YVR A;  2F42 A;  2MUM A;  2XEU A;  3M63 A;  2MKE A;  2G43 A;  2KGI A;  4MSX A;  2LGG A;  2VPD A;  1WEM A;  2KWK A;  3LQI A;  2MA6 A;  1WEW A;  4ZQL A;  3L1X A;  2YT5 A;  5K3Q A;  2KR4 A;  2CT2 A;  3LRQ A;  4TKP B;  3QZV A;  4X3G A;  2KKY A;  2ECT A;  2Y1N A;  2KFT A;  2JMD A;  2IQJ A;  2E61 A;  2CKL B;  2LAU A;  3PUQ A;  2QJ0 A;  3EB6 A;  3KDE C;  3LJU X;  2KWN A;  4OGC A;  2D8U A;  4IC2 A;  2L7P A;  4V3L C;  5KH7 A;  2LN0 A;  2KRE A;  3PUR A;  2IDA A;  3LVQ E;  2QIC A;  2XP0 A;  3N9N A;  1DVP A;  3JUE A;  1IYM A;  2YU4 A;  5LKT A;  1WEU A;  5FER A;  2KWJ A;  5SVI B;  4UP0 A;  5FEY A;  3KV6 A;  3E2D A;  5LKX A;  2MIQ A;  2JMI A;  2M1R A;  3I2D A;  5D1K B;  2D8S A;  2BAY A;  5G04 B;  3IHP A;  1K2F A;  4P5O B;  3LQJ A;  5KH3 A;  3SOW A;  4AP4 A;  2ECG A;  1U6G B;  2H0D B;  2CSZ A;  2VJF B;  5B76 A;  4I7D A;  4AYC A;  1WEP A;  1XWH A;  2XB1 A;  3SHB A;  3KV5 A;  3N9P A;  3SUB A;  1LDJ B;  2VNF A;  3PLW A;  3ASL A;  4AUQ B;  5SVX A;  5TAB A;  2VPG A;  4YAD A;  5D1L B;  1FP0 A;  3SOX A;  3T6R A;  2ECW A;  2EA6 A;  2L5U A;  4A0C D;  1MM3 A;  4AVX A;  2FSA A;  3DWD A;  4LLB A;  3C5K A;  2L0B A;  2YSJ A;  3DQV R;  4LAD B;  2LRI C;  2K4D A;  5TBN A;  2RI7 A;  3RPG C;  4GND A;  2CON A;  1WIL A;  4O62 A;  2LGV A;  1HYJ A;  1VFY A;  3V43 A;  2NAA A;  2LXP C;  2EGP A;  4ZUX U;  2HDP A;  3HCU A;  1N87 A;  2DSM A;  2DX8 A;  3HTK C;  5H1U A;  4R7E A;  4A49 A;  3O33 A;  2YQL A;  4V3K C;  1FBV A;  2E6S A;  2VP7 A;  2VJE B;  2YW8 A;  4A4C A;  4FJC A;  5TDW A;  2CKL A;  4GNE A;  2ZET C;  3O37 A;  3N9L A;  3FM8 C;  5JG6 A;  5H1T A;  2QIZ A;  2MA5 A; 
#chains in the Genus database with same CATH homology
 2LGL A;  4QF3 A;  4UI9 B;  2ECI A;  2Y43 A;  1WIM A;  3U5P A;  1BOR A;  4R8P K;  3ZPV 1;  2VPB A;  3O36 A;  1JM7 A;  5DKA A;  1X4J A;  2L43 A;  4N4F A;  4YBS A;  2L75 A;  5B79 A;  3RTR B;  2JMJ A;  4N3W A;  5H9M A;  2VPE A;  4O64 A;  4W4U A;  4MVT A;  5C13 A;  2LV9 A;  2MT5 A;  3MHH A;  2K1J A;  5G05 B;  3HCS A;  5FB0 A;  2RSD A;  2YQM A;  4B7Y C;  2YRE A;  2H0D A;  2VJF A;  4IC3 A;  3ZVZ B;  2KU3 A;  5B8D A;  3N9M A;  3O34 A;  1ZBD B;  4BBQ A;  2EOD A;  3N9O A;  3MHS A;  3FL2 A;  1Z60 A;  4BHW A;  5TRB A;  1WEE A;  3SOU A;  2Y1M A;  4WZ3 B;  5DIN A;  4GNF A;  4CCG X;  2UZG A;  1WEV A;  4I7C A;  4L7X A;  5B75 A;  2K16 A;  4WZ0 A;  5LKZ A;  3GV4 A;  5H1V A;  5B78 A;  1RMD A;  2YHN A;  1LDK C;  1WEN A;  3O7A A;  2ECN A;  2G6Q A;  4S3O B;  2YSM A;  4LJN A;  1HYI A;  4XI1 A;  3M62 A;  1WEQ A;  2VJE A;  5FB1 A;  1JOC A;  2ECJ A;  3L11 A;  3HCT A;  2ECV A;  4L58 A;  3U5O A;  2HYE D;  2L80 A;  2FUI A;  1VD4 A;  1X4U A;  1Z6U A;  3N9Q A;  2AN6 A;  3NG2 A;  2LGK A;  3ZVY A;  2M85 A;  4YAT A;  3O70 A;  5KH9 A;  4WA6 A;  4FIP A;  2C2V S;  4LK9 A;  2CSY A;  4ZDT A;  2OXQ C;  4B86 C;  5G0F A;  2F6J A;  4Q6F A;  2MNZ A;  3LQH A;  3M99 A;  2M3H A;  3DPL R;  2KGG A;  5I3L A;  2KYU A;  2E6R A;  2LXH C;  3O35 A;  2K17 A;  1G25 A;  4YC9 A;  4YBM A;  1F62 A;  2JRJ A;  1WE9 A;  2MD7 B;  1CHC A;  4F52 B;  2F6N A;  2I50 A;  1T1H A;  2PNX A;  1MM2 A;  3ZTG A;  3C6W A;  3ZPV E;  2MD8 C;  1V87 A;  1WFK A;  4PPE A;  4A4B A;  4FK5 A;  2PUY A;  4NN2 A;  1JM7 B;  5D1M B;  5TDR A;  1WEO A;  4GNG A;  4I7B A;  1VYX A;  2YUR A;  1WGM A;  5EYA F;  2YUC A;  3U5M A;  2KE1 A;  4YAX A;  5AIT A;  5LKU A;  4C9Z A;  4CA1 A;  2C2L A;  4QF2 A;  4S3O C;  2YYR A;  2LQ6 A;  4R2Y A;  5J3X A;  2YHO A;  4LKA A;  4FO9 A;  5AIU A;  3GL6 A;  1Z2Q A;  4PTB A;  3U5N A;  3ZNI A;  2M6M A;  3EB5 A;  3KNV A;  5LCW B;  2LDR A;  2KWO A;  4AYC B;  3PHD A;  1WES A;  2MNY A;  3RPG B;  3T7L A;  4GB0 A;  2FUU A;  4YBT A;  1E4U A;  4UP5 A;  3VK6 A;  2G45 A;  2KIZ A;  3L1Z B;  3ZYQ A;  5B77 A;  3KQI A;  4YAB A;  4WZ2 A;  5C11 A;  1X4I A;  2F42 A;  2MUM A;  2XEU A;  3M63 A;  2G43 A;  2KGI A;  4MSX A;  2LGG A;  2VPD A;  1WEM A;  2KWK A;  3LQI A;  2MA6 A;  1WEW A;  4ZQL A;  3L1X A;  2YT5 A;  2KR4 A;  2CT2 A;  3LRQ A;  4TKP B;  3QZV A;  4X3G A;  2ECT A;  2Y1N A;  2KFT A;  2JMD A;  2CKL B;  3PUQ A;  2QJ0 A;  3EB6 A;  2KWN A;  4IC2 A;  4V3L C;  5KH7 A;  2LN0 A;  2KRE A;  3PUR A;  2IDA A;  2QIC A;  3N9N A;  1DVP A;  1IYM A;  2YU4 A;  5LKT A;  1WEU A;  5FER A;  2KWJ A;  4UP0 A;  5FEY A;  3KV6 A;  5LKX A;  2MIQ A;  2JMI A;  2M1R A;  3I2D A;  5D1K B;  2D8S A;  2BAY A;  5G04 B;  3IHP A;  1K2F A;  4P5O B;  3LQJ A;  5KH3 A;  3SOW A;  4AP4 A;  2ECG A;  1U6G B;  2H0D B;  2CSZ A;  2VJF B;  5B76 A;  4I7D A;  4AYC A;  1WEP A;  1XWH A;  2XB1 A;  3SHB A;  3KV5 A;  3N9P A;  1LDJ B;  2VNF A;  3ASL A;  4AUQ B;  5TAB A;  2VPG A;  4YAD A;  5D1L B;  1FP0 A;  3SOX A;  3T6R A;  2ECW A;  2EA6 A;  2L5U A;  4A0C D;  1MM3 A;  4AVX A;  2FSA A;  4LLB A;  3C5K A;  2L0B A;  2YSJ A;  3DQV R;  4LAD B;  2LRI C;  2K4D A;  5TBN A;  2RI7 A;  3RPG C;  4GND A;  1WIL A;  2LGV A;  1HYJ A;  1VFY A;  3V43 A;  2NAA A;  2LXP C;  2EGP A;  4ZUX U;  2HDP A;  3HCU A;  1N87 A;  2DX8 A;  3HTK C;  5H1U A;  4R7E A;  4A49 A;  3O33 A;  2YQL A;  4V3K C;  1FBV A;  2E6S A;  2VP7 A;  2VJE B;  2YW8 A;  4A4C A;  4FJC A;  5TDW A;  2CKL A;  4GNE A;  2ZET C;  3O37 A;  3N9L A;  5JG6 A;  5H1T A;  2QIZ A;  2MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...