2KFTA

Nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
GSKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/protein binding
molecule keywords Autoimmune regulator
publication title Structure and Site-Specific Recognition of Histone H3 by the PHD Finger of Human Autoimmune Regulator.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kftA00
3C5KA 3LRQA 2L0BA 2LGKA 2HYED 1ZBDB 5J3XA 2MA5A 3LQIA 4GNDA 1WEPA 2LQ6A 2JRJA 4AP4A 1T1HA 2F6JA 3PUQA 1HYIA 2FUUA 2KYUA 4C9ZA 2MUMA 1WFKA 2VJFA 4NN2A 3KNVA 5FEYA 3M63A 1X4JA 4WZ0A 5FB1A 5C13A 2MD7B 2LRIC 2PNXA 1WESA 3O34A 2YREA 4A4BA 2YQLA 2KR4A 3VK6A 5DINA 5FERA 2M3HA 4MSXA 4R7EA 3U5MA 3HCTA 2C2LA 4UI9B 2CKLB 2LGGA 2QJ0A 4N4FA 1WEVA 3ASLA 3ZPVE 1BORA 5KH3A 2Y1MA 5TABA 1Z60A 4YBTA 2AN6A 2YSJA 3L1ZB 2KGIA 4GNGA 2Y1NA 2JMIA 4L58A 2IDAA 4BHWA 1IYMA 2M6MA 2ECWA 2VPEA 3M99A 3L1XA 1X4UA 5TDWA 5TDRA 5G05B 2BAYA 1DVPA 3SOWA 2KWKA 4UP0A 2ZETC 5LKZA 2YT5A 1WGMA 2MA6A 1WIMA 3N9NA 4B7YC 2LDRA 3O70A 2VPBA 5TBNA 3GL6A 3I2DA 4S3OB 3KV5A 2I50A 4I7BA 3O35A 2LXHC 4XI1A 3MHHA 1WEUA 2MT5A 1WEOA 4FK5A 2QICA 5TRBA 3ZPV1 4A0CD 1JM7B 5D1KB 3T7LA 5I3LA 4YATA 2YSMA 4WZ2A 4S3OC 1Z2QA 3RPGB 3O7AA 4YADA 2G6QA 2L5UA 1RMDA 3M62A 5H9MA 3LQJA 2LGLA 4CCGX 2EODA 1U6GB 4WA6A 2M1RA 3C6WA 2RI7A 5LKTA 1LDKC 4WZ3B 3ZYQA 2CT2A 2K17A 2VJEA 2LGVA 3PHDA 3SOUA 2LXPC 2K1JA 4AVXA 5LKXA 4LADB 4MVTA 2YUCA 2ECGA 4YABA 4LJNA 4R2YA 1F62A 2KFTA 2G43A 3N9MA 1VYXA 2H0DA 4LK9A 2VNFA 2CSZA 2KIZA 3ZVZB 4F52B 2KU3A 3DQVR 3DPLR 2YHNA 3O33A 3IHPA 2YQMA 2CSYA 4UP5A 5C11A 2KWOA 1FBVA 1N87A 2EGPA 4B86C 2CKLA 4YAXA 1LDJB 4PPEA 3N9OA 1WEWA 3EB5A 2RSDA 4AUQB 5H1UA 2MNZA 3U5PA 4AYCB 5G0FA 2VP7A 1XWHA 4A49A 2YYRA 1VD4A 3KQIA 4YBMA 4ZQLA 5DKAA 1V87A 1FP0A 2ECIA 5AIUA 3PURA 2F6NA 4YC9A 2ECJA 2KWNA 2OXQC 4QF2A 2QIZA 2F42A 2C2VS 3N9QA 2L80A 2FSAA 3EB6A 1JOCA 2G45A 2E6SA 4ZUXU 4L7XA 2D8SA 5H1VA 4FJCA 1WE9A 2K16A 4BBQA 5H1TA 2VJFB 2VPDA 2L43A 4FO9A 4O64A 5B78A 2ECVA 5D1LB 4LLBA 2NAAA 4V3LC 2VJEB 2K4DA 5B77A 3U5OA 2HDPA 3NG2A 1JM7A 4W4UA 5EYAF 2JMJA 4CA1A 1MM2A 3RPGC 2MD8C 3GV4A 2VPGA 3FL2A 2LN0A 3N9PA 3U5NA 2H0DB 1MM3A 3HTKC 3O36A 2M85A 4IC3A 1G25A 2YU4A 4GNFA 2ECNA 3KV6A 3HCSA 2KWJA 5B76A 2YW8A 5AITA 4N3WA 2XEUA 3HCUA 4IC2A 1WEQA 4I7DA 3SHBA 1WENA 5D1MB 2JMDA 4X3GA 2XB1A 2E6RA 1VFYA 1WEMA 1K2FA 2MNYA 5LCWB 4R8PK 2KREA 5KH9A 5JG6A 3SOXA 4FIPA 1Z6UA 3LQHA 3ZNIA 5LKUA 2FUIA 2YHOA 1CHCA 4V3KC 2UZGA 2Y43A 5B75A 5B8DA 3N9LA 2LV9A 3ZTGA 3QZVA 1WEEA 3L11A 3ZVYA 4QF3A 2DX8A 3MHSA 2L75A 3RTRB 4A4CA 3T6RA 4TKPB 3V43A 4GNEA 4Q6FA 4I7CA 3O37A 2MIQA 4PTBA 2KGGA 1E4UA 5FB0A 1HYJA 4ZDTA 2YURA 4AYCA 5KH7A 4YBSA 4GB0A 1WILA 1X4IA 2KE1A 2EA6A 5G04B 2PUYA 5B79A 4P5OB 2ECTA 4LKAA
chains in the Genus database with same CATH superfamily
3FJUB 3C5KA 3LRQA 2L0BA 2LGKA 2HYED 1ZBDB 5J3XA 4H9DA 2MA5A 3LQIA 4GNDA 1WEPA 2LQ6A 2CRRA 2JRJA 4AP4A 3PLWA 1T1HA 2F6JA 3PUQA 1HYIA 2FUUA 2KYUA 4C9ZA 2MUMA 1WFKA 2JUNA 2VJFA 4NN2A 3KNVA 5FEYA 3M63A 1X4JA 5SVIB 4WZ0A 5FB1A 5C13A 2MD7B 2LRIC 2PNXA 1WESA 3O34A 2B0OE 2YREA 4A4BA 2YQLA 2KR4A 3VK6A 5DINA 2DSMA 5FERA 2M3HA 4MSXA 4R7EA 3U5MA 3HCTA 2C2LA 4UI9B 2CKLB 2LGGA 2QJ0A 4N4FA 1WEVA 3FEHA 3JUEA 3ASLA 3ZPVE 1BORA 5KH3A 2Y1MA 5TABA 2KKYA 1Z60A 4YBTA 2AN6A 2YSJA 3L1ZB 4O62A 2KKXA 2KGIA 4GNGA 2Y1NA 2JMIA 4L58A 2RR4A 2IDAA 4BHWA 1IYMA 2M6MA 2CSVA 2ECWA 2VPEA 3M99A 3L1XA 2EGMA 1X4UA 2D8UA 5TDWA 5TDRA 5G05B 2BAYA 1DVPA 3SOWA 2KWKA 3KDEC 4UP0A 2ZETC 5LKZA 2XOCA 2XP0A 3FM8C 2YT5A 1WGMA 2MA6A 1WIMA 3N9NA 4B7YC 2LDRA 2E61A 2P57A 3O70A 2VPBA 5TBNA 3GL6A 3LVRE 3I2DA 4S3OB 3FAOA 3KV5A 2MKEA 2I50A 4I7BA 3O35A 2LXHC 4XI1A 3MHHA 1WEUA 2MT5A 1WEOA 4FK5A 2QICA 5TRBA 3ZPV1 4A0CD 1JM7B 5D1KB 3T7LA 3FANA 5I3LA 4YATA 2YSMA 4WZ2A 4S3OC 1Z2QA 3RPGB 3O7AA 4YADA 2G6QA 2L5UA 1RMDA 3M62A 5H9MA 3LQJA 2LGLA 4CCGX 2EODA 1U6GB 4WA6A 2M1RA 4Z0OA 3C6WA 2RI7A 5LKTA 1LDKC 1MBMA 4WZ3B 3ZYQA 2CT2A 2K17A 2VJEA 2LGVA 3PHDA 2XOZA 3SOUA 2LXPC 2K1JA 4AVXA 5LKXA 4LADB 4MVTA 2YUCA 2ECGA 4YABA 4LJNA 2XOYA 4R2YA 1F62A 3LVQE 2KFTA 2L7PA 3Q1DA 2G43A 3N9MA 1VYXA 2H0DA 4LK9A 2VNFA 5SVIA 2CSZA 2KIZA 1DCQA 3ZVZB 2M13A 3E2DA 2KU3A 4F52B 3DQVR 3DPLR 2YHNA 3O33A 3IHPA 2YQMA 2CSYA 4UP5A 5C11A 2KWOA 1FBVA 1N87A 2EGPA 4F1PA 4B86C 2CKLA 4YAXA 1LDJB 4PPEA 3N9OA 1WEWA 3EB5A 2RSDA 4AUQB 5H1UA 2CRWA 2MNZA 3U5PA 4AYCB 5G0FA 5SVXA 2VP7A 1XWHA 4A49A 2YVRA 2YYRA 1VD4A 3H7HA 3KQIA 4YBMA 4ZQLA 5DKAA 1V87A 5K3QA 5SVYA 1FP0A 2ECIA 5AIUA 3PURA 2F6NA 4YC9A 2ECJA 2KWNA 2OXQC 4QF2A 2QIZA 2F42A 3SUBA 2DJAA 2C2VS 3N9QA 2L80A 2FSAA 3EB6A 1JOCA 2G45A 2E6SA 4ZUXU 4L7XA 3LDYA 2D8SA 3M7KA 5H1VA 4FJCA 1WE9A 2K16A 2LAUA 4OGEA 4BBQA 5H1TA 2VJFB 4Z0RA 2VPDA 2OWAA 2FD4A 2L43A 4FO9A 3T9KA 4OGCA 4O64A 5B78A 2ECVA 5D1LB 4LLBA 2NAAA 4V3LC 2CONA 2VJEB 2K4DA 5B77A 3U5OA 2HDPA 3NG2A 1JM7A 4W4UA 5EYAF 2JMJA 4CA1A 1MM2A 3RPGC 2MD8C 3GV4A 2VPGA 3FL2A 2LN0A 3N9PA 3O47A 3U5NA 2H0DB 1MM3A 2IQJA 2FFWA 3HTKC 3O36A 2M85A 2EXUA 4IC3A 1G25A 2YU4A 4GNFA 2ECNA 3KV6A 3HCSA 2KWJA 5B76A 2YW8A 5AITA 4N3WA 2XEUA 3HCUA 3MDBC 4IC2A 1WEQA 4I7DA 3SHBA 1WENA 5D1MB 2JMDA 4X3GA 2XB1A 2E6RA 1VFYA 1WEMA 1K2FA 2MNYA 5LCWB 4R8PK 2KREA 5KH9A 5JG6A 3SOXA 4FIPA 1Z6UA 3LQHA 3ZNIA 5LKUA 2FUIA 2YHOA 1CHCA 2UZGA 4V3KC 2Y43A 5B75A 5B8DA 3N9LA 2LV9A 4QQ4A 3ZTGA 3QZVA 1WEEA 3DDTA 3L11A 3ZVYA 4QF3A 2DX8A 3MHSA 2L75A 3RTRB 4A4CA 3LJUX 2JM3A 3T6RA 4TKPB 3V43A 4GNEA 4Q6FA 4I7CA 3O37A 4PTBA 2MIQA 2KGGA 1E4UA 5FB0A 1HYJA 4ZDTA 2YURA 4AYCA 5KH7A 4YBSA 4GB0A 1WILA 1X4IA 2KE1A 2EA6A 5G04B 2PUYA 5B79A 4P5OB 2ECTA 4LKAA 3DWDA
chains in the Genus database with same CATH topology
3C5KA 3LRQA 2L0BA 2LGKA 2HYED 1ZBDB 5J3XA 2MA5A 3LQIA 4GNDA 1WEPA 2LQ6A 2JRJA 4AP4A 1T1HA 2F6JA 3PUQA 1HYIA 2FUUA 2KYUA 4C9ZA 2MUMA 1WFKA 2VJFA 4NN2A 3KNVA 5FEYA 3M63A 1X4JA 4WZ0A 5FB1A 5C13A 2MD7B 2LRIC 2PNXA 1WESA 3O34A 2YREA 4A4BA 2YQLA 2KR4A 3VK6A 5DINA 5FERA 2M3HA 4MSXA 4R7EA 3U5MA 3HCTA 2C2LA 4UI9B 2CKLB 2LGGA 2QJ0A 4N4FA 1WEVA 3ASLA 3ZPVE 1BORA 5KH3A 2Y1MA 5TABA 1Z60A 4YBTA 2AN6A 2YSJA 3L1ZB 2KGIA 4GNGA 2Y1NA 2JMIA 4L58A 2IDAA 4BHWA 1IYMA 2M6MA 2ECWA 2VPEA 3M99A 3L1XA 1X4UA 5TDWA 5TDRA 5G05B 2BAYA 1DVPA 3SOWA 2KWKA 4UP0A 2ZETC 5LKZA 2YT5A 1WGMA 2MA6A 1WIMA 3N9NA 4B7YC 2LDRA 3O70A 2VPBA 5TBNA 3GL6A 3I2DA 4S3OB 3KV5A 2I50A 4I7BA 3O35A 2LXHC 4XI1A 3MHHA 1WEUA 2MT5A 1WEOA 4FK5A 2QICA 5TRBA 3ZPV1 4A0CD 1JM7B 5D1KB 3T7LA 5I3LA 4YATA 2YSMA 4WZ2A 4S3OC 1Z2QA 3RPGB 3O7AA 4YADA 2G6QA 2L5UA 1RMDA 3M62A 5H9MA 3LQJA 2LGLA 4CCGX 2EODA 1U6GB 4WA6A 2M1RA 3C6WA 2RI7A 5LKTA 1LDKC 4WZ3B 3ZYQA 2CT2A 2K17A 2VJEA 2LGVA 3PHDA 3SOUA 2LXPC 2K1JA 4AVXA 5LKXA 4LADB 4MVTA 2YUCA 2ECGA 4YABA 4LJNA 4R2YA 1F62A 2KFTA 2G43A 3N9MA 1VYXA 2H0DA 4LK9A 2VNFA 2CSZA 2KIZA 3ZVZB 4F52B 2KU3A 3DQVR 3DPLR 2YHNA 3O33A 3IHPA 2YQMA 2CSYA 4UP5A 5C11A 2KWOA 1FBVA 1N87A 2EGPA 4B86C 2CKLA 4YAXA 1LDJB 4PPEA 3N9OA 1WEWA 3EB5A 2RSDA 4AUQB 5H1UA 2MNZA 3U5PA 4AYCB 5G0FA 2VP7A 1XWHA 4A49A 2YYRA 1VD4A 3KQIA 4YBMA 4ZQLA 5DKAA 1V87A 1FP0A 2ECIA 5AIUA 3PURA 2F6NA 4YC9A 2ECJA 2KWNA 2OXQC 4QF2A 2QIZA 2F42A 2C2VS 3N9QA 2L80A 2FSAA 3EB6A 1JOCA 2G45A 2E6SA 4ZUXU 4L7XA 2D8SA 5H1VA 4FJCA 1WE9A 2K16A 4BBQA 5H1TA 2VJFB 2VPDA 2L43A 4FO9A 4O64A 5B78A 2ECVA 5D1LB 4LLBA 2NAAA 4V3LC 2VJEB 2K4DA 5B77A 3U5OA 2HDPA 3NG2A 1JM7A 4W4UA 5EYAF 2JMJA 4CA1A 1MM2A 3RPGC 2MD8C 3GV4A 2VPGA 3FL2A 2LN0A 3N9PA 3U5NA 2H0DB 1MM3A 3HTKC 3O36A 2M85A 4IC3A 1G25A 2YU4A 4GNFA 2ECNA 3KV6A 3HCSA 2KWJA 5B76A 2YW8A 5AITA 4N3WA 2XEUA 3HCUA 4IC2A 1WEQA 4I7DA 3SHBA 1WENA 5D1MB 2JMDA 4X3GA 2XB1A 2E6RA 1VFYA 1WEMA 1K2FA 2MNYA 5LCWB 4R8PK 2KREA 5KH9A 5JG6A 3SOXA 4FIPA 1Z6UA 3LQHA 3ZNIA 5LKUA 2FUIA 2YHOA 1CHCA 4V3KC 2UZGA 2Y43A 5B75A 5B8DA 3N9LA 2LV9A 3ZTGA 3QZVA 1WEEA 3L11A 3ZVYA 4QF3A 2DX8A 3MHSA 2L75A 3RTRB 4A4CA 3T6RA 4TKPB 3V43A 4GNEA 4Q6FA 4I7CA 3O37A 2MIQA 4PTBA 2KGGA 1E4UA 5FB0A 1HYJA 4ZDTA 2YURA 4AYCA 5KH7A 4YBSA 4GB0A 1WILA 1X4IA 2KE1A 2EA6A 5G04B 2PUYA 5B79A 4P5OB 2ECTA 4LKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  3LRQ A;  2L0B A;  2LGK A;  2HYE D;  1ZBD B;  5J3X A;  2MA5 A;  3LQI A;  4GND A;  1WEP A;  2LQ6 A;  2JRJ A;  4AP4 A;  1T1H A;  2F6J A;  3PUQ A;  1HYI A;  2FUU A;  2KYU A;  4C9Z A;  2MUM A;  1WFK A;  2VJF A;  4NN2 A;  3KNV A;  5FEY A;  3M63 A;  1X4J A;  4WZ0 A;  5FB1 A;  5C13 A;  2MD7 B;  2LRI C;  2PNX A;  1WES A;  3O34 A;  2YRE A;  4A4B A;  2YQL A;  2KR4 A;  3VK6 A;  5DIN A;  5FER A;  2M3H A;  4MSX A;  4R7E A;  3U5M A;  3HCT A;  2C2L A;  4UI9 B;  2CKL B;  2LGG A;  2QJ0 A;  4N4F A;  1WEV A;  3ASL A;  3ZPV E;  1BOR A;  5KH3 A;  2Y1M A;  5TAB A;  1Z60 A;  4YBT A;  2AN6 A;  2YSJ A;  3L1Z B;  2KGI A;  4GNG A;  2Y1N A;  2JMI A;  4L58 A;  2IDA A;  4BHW A;  1IYM A;  2M6M A;  2ECW A;  2VPE A;  3M99 A;  3L1X A;  1X4U A;  5TDW A;  5TDR A;  5G05 B;  2BAY A;  1DVP A;  3SOW A;  2KWK A;  4UP0 A;  2ZET C;  5LKZ A;  2YT5 A;  1WGM A;  2MA6 A;  1WIM A;  3N9N A;  4B7Y C;  2LDR A;  3O70 A;  2VPB A;  5TBN A;  3GL6 A;  3I2D A;  4S3O B;  3KV5 A;  2I50 A;  4I7B A;  3O35 A;  2LXH C;  4XI1 A;  3MHH A;  1WEU A;  2MT5 A;  1WEO A;  4FK5 A;  2QIC A;  5TRB A;  3ZPV 1;  4A0C D;  1JM7 B;  5D1K B;  3T7L A;  5I3L A;  4YAT A;  2YSM A;  4WZ2 A;  4S3O C;  1Z2Q A;  3RPG B;  3O7A A;  4YAD A;  2G6Q A;  2L5U A;  1RMD A;  3M62 A;  5H9M A;  3LQJ A;  2LGL A;  4CCG X;  2EOD A;  1U6G B;  4WA6 A;  2M1R A;  3C6W A;  2RI7 A;  5LKT A;  1LDK C;  4WZ3 B;  3ZYQ A;  2CT2 A;  2K17 A;  2VJE A;  2LGV A;  3PHD A;  3SOU A;  2LXP C;  2K1J A;  4AVX A;  5LKX A;  4LAD B;  4MVT A;  2YUC A;  2ECG A;  4YAB A;  4LJN A;  4R2Y A;  1F62 A;  2KFT A;  2G43 A;  3N9M A;  1VYX A;  2H0D A;  4LK9 A;  2VNF A;  2CSZ A;  2KIZ A;  3ZVZ B;  4F52 B;  2KU3 A;  3DQV R;  3DPL R;  2YHN A;  3O33 A;  3IHP A;  2YQM A;  2CSY A;  4UP5 A;  5C11 A;  2KWO A;  1FBV A;  1N87 A;  2EGP A;  4B86 C;  2CKL A;  4YAX A;  1LDJ B;  4PPE A;  3N9O A;  1WEW A;  3EB5 A;  2RSD A;  4AUQ B;  5H1U A;  2MNZ A;  3U5P A;  4AYC B;  5G0F A;  2VP7 A;  1XWH A;  4A49 A;  2YYR A;  1VD4 A;  3KQI A;  4YBM A;  4ZQL A;  5DKA A;  1V87 A;  1FP0 A;  2ECI A;  5AIU A;  3PUR A;  2F6N A;  4YC9 A;  2ECJ A;  2KWN A;  2OXQ C;  4QF2 A;  2QIZ A;  2F42 A;  2C2V S;  3N9Q A;  2L80 A;  2FSA A;  3EB6 A;  1JOC A;  2G45 A;  2E6S A;  4ZUX U;  4L7X A;  2D8S A;  5H1V A;  4FJC A;  1WE9 A;  2K16 A;  4BBQ A;  5H1T A;  2VJF B;  2VPD A;  2L43 A;  4FO9 A;  4O64 A;  5B78 A;  2ECV A;  5D1L B;  4LLB A;  2NAA A;  4V3L C;  2VJE B;  2K4D A;  5B77 A;  3U5O A;  2HDP A;  3NG2 A;  1JM7 A;  4W4U A;  5EYA F;  2JMJ A;  4CA1 A;  1MM2 A;  3RPG C;  2MD8 C;  3GV4 A;  2VPG A;  3FL2 A;  2LN0 A;  3N9P A;  3U5N A;  2H0D B;  1MM3 A;  3HTK C;  3O36 A;  2M85 A;  4IC3 A;  1G25 A;  2YU4 A;  4GNF A;  2ECN A;  3KV6 A;  3HCS A;  2KWJ A;  5B76 A;  2YW8 A;  5AIT A;  4N3W A;  2XEU A;  3HCU A;  4IC2 A;  1WEQ A;  4I7D A;  3SHB A;  1WEN A;  5D1M B;  2JMD A;  4X3G A;  2XB1 A;  2E6R A;  1VFY A;  1WEM A;  1K2F A;  2MNY A;  5LCW B;  4R8P K;  2KRE A;  5KH9 A;  5JG6 A;  3SOX A;  4FIP A;  1Z6U A;  3LQH A;  3ZNI A;  5LKU A;  2FUI A;  2YHO A;  1CHC A;  4V3K C;  2UZG A;  2Y43 A;  5B75 A;  5B8D A;  3N9L A;  2LV9 A;  3ZTG A;  3QZV A;  1WEE A;  3L11 A;  3ZVY A;  4QF3 A;  2DX8 A;  3MHS A;  2L75 A;  3RTR B;  4A4C A;  3T6R A;  4TKP B;  3V43 A;  4GNE A;  4Q6F A;  4I7C A;  3O37 A;  2MIQ A;  4PTB A;  2KGG A;  1E4U A;  5FB0 A;  1HYJ A;  4ZDT A;  2YUR A;  4AYC A;  5KH7 A;  4YBS A;  4GB0 A;  1WIL A;  1X4I A;  2KE1 A;  2EA6 A;  5G04 B;  2PUY A;  5B79 A;  4P5O B;  2ECT A;  4LKA A; 
#chains in the Genus database with same CATH topology
 3FJU B;  3C5K A;  3LRQ A;  2L0B A;  2LGK A;  2HYE D;  1ZBD B;  5J3X A;  4H9D A;  2MA5 A;  3LQI A;  4GND A;  1WEP A;  2LQ6 A;  2CRR A;  2JRJ A;  4AP4 A;  3PLW A;  1T1H A;  2F6J A;  3PUQ A;  1HYI A;  2FUU A;  2KYU A;  4C9Z A;  2MUM A;  1WFK A;  2JUN A;  2VJF A;  4NN2 A;  3KNV A;  5FEY A;  3M63 A;  1X4J A;  5SVI B;  4WZ0 A;  5FB1 A;  5C13 A;  2MD7 B;  2LRI C;  2PNX A;  1WES A;  3O34 A;  2B0O E;  2YRE A;  4A4B A;  2YQL A;  2KR4 A;  3VK6 A;  5DIN A;  2DSM A;  5FER A;  2M3H A;  4MSX A;  4R7E A;  3U5M A;  3HCT A;  2C2L A;  4UI9 B;  2CKL B;  2LGG A;  2QJ0 A;  4N4F A;  1WEV A;  3FEH A;  3JUE A;  3ASL A;  3ZPV E;  1BOR A;  5KH3 A;  2Y1M A;  5TAB A;  2KKY A;  1Z60 A;  4YBT A;  2AN6 A;  2YSJ A;  3L1Z B;  4O62 A;  2KKX A;  2KGI A;  4GNG A;  2Y1N A;  2JMI A;  4L58 A;  2RR4 A;  2IDA A;  4BHW A;  1IYM A;  2M6M A;  2CSV A;  2ECW A;  2VPE A;  3M99 A;  3L1X A;  2EGM A;  1X4U A;  2D8U A;  5TDW A;  5TDR A;  5G05 B;  2BAY A;  1DVP A;  3SOW A;  2KWK A;  3KDE C;  4UP0 A;  2ZET C;  5LKZ A;  2XOC A;  2XP0 A;  3FM8 C;  2YT5 A;  1WGM A;  2MA6 A;  1WIM A;  3N9N A;  4B7Y C;  2LDR A;  2E61 A;  2P57 A;  3O70 A;  2VPB A;  5TBN A;  3GL6 A;  3LVR E;  3I2D A;  4S3O B;  3FAO A;  3KV5 A;  2MKE A;  2I50 A;  4I7B A;  3O35 A;  2LXH C;  4XI1 A;  3MHH A;  1WEU A;  2MT5 A;  1WEO A;  4FK5 A;  2QIC A;  5TRB A;  3ZPV 1;  4A0C D;  1JM7 B;  5D1K B;  3T7L A;  3FAN A;  5I3L A;  4YAT A;  2YSM A;  4WZ2 A;  4S3O C;  1Z2Q A;  3RPG B;  3O7A A;  4YAD A;  2G6Q A;  2L5U A;  1RMD A;  3M62 A;  5H9M A;  3LQJ A;  2LGL A;  4CCG X;  2EOD A;  1U6G B;  4WA6 A;  2M1R A;  4Z0O A;  3C6W A;  2RI7 A;  5LKT A;  1LDK C;  1MBM A;  4WZ3 B;  3ZYQ A;  2CT2 A;  2K17 A;  2VJE A;  2LGV A;  3PHD A;  2XOZ A;  3SOU A;  2LXP C;  2K1J A;  4AVX A;  5LKX A;  4LAD B;  4MVT A;  2YUC A;  2ECG A;  4YAB A;  4LJN A;  2XOY A;  4R2Y A;  1F62 A;  3LVQ E;  2KFT A;  2L7P A;  3Q1D A;  2G43 A;  3N9M A;  1VYX A;  2H0D A;  4LK9 A;  2VNF A;  5SVI A;  2CSZ A;  2KIZ A;  1DCQ A;  3ZVZ B;  2M13 A;  3E2D A;  2KU3 A;  4F52 B;  3DQV R;  3DPL R;  2YHN A;  3O33 A;  3IHP A;  2YQM A;  2CSY A;  4UP5 A;  5C11 A;  2KWO A;  1FBV A;  1N87 A;  2EGP A;  4F1P A;  4B86 C;  2CKL A;  4YAX A;  1LDJ B;  4PPE A;  3N9O A;  1WEW A;  3EB5 A;  2RSD A;  4AUQ B;  5H1U A;  2CRW A;  2MNZ A;  3U5P A;  4AYC B;  5G0F A;  5SVX A;  2VP7 A;  1XWH A;  4A49 A;  2YVR A;  2YYR A;  1VD4 A;  3H7H A;  3KQI A;  4YBM A;  4ZQL A;  5DKA A;  1V87 A;  5K3Q A;  5SVY A;  1FP0 A;  2ECI A;  5AIU A;  3PUR A;  2F6N A;  4YC9 A;  2ECJ A;  2KWN A;  2OXQ C;  4QF2 A;  2QIZ A;  2F42 A;  3SUB A;  2DJA A;  2C2V S;  3N9Q A;  2L80 A;  2FSA A;  3EB6 A;  1JOC A;  2G45 A;  2E6S A;  4ZUX U;  4L7X A;  3LDY A;  2D8S A;  3M7K A;  5H1V A;  4FJC A;  1WE9 A;  2K16 A;  2LAU A;  4OGE A;  4BBQ A;  5H1T A;  2VJF B;  4Z0R A;  2VPD A;  2OWA A;  2FD4 A;  2L43 A;  4FO9 A;  3T9K A;  4OGC A;  4O64 A;  5B78 A;  2ECV A;  5D1L B;  4LLB A;  2NAA A;  4V3L C;  2CON A;  2VJE B;  2K4D A;  5B77 A;  3U5O A;  2HDP A;  3NG2 A;  1JM7 A;  4W4U A;  5EYA F;  2JMJ A;  4CA1 A;  1MM2 A;  3RPG C;  2MD8 C;  3GV4 A;  2VPG A;  3FL2 A;  2LN0 A;  3N9P A;  3O47 A;  3U5N A;  2H0D B;  1MM3 A;  2IQJ A;  2FFW A;  3HTK C;  3O36 A;  2M85 A;  2EXU A;  4IC3 A;  1G25 A;  2YU4 A;  4GNF A;  2ECN A;  3KV6 A;  3HCS A;  2KWJ A;  5B76 A;  2YW8 A;  5AIT A;  4N3W A;  2XEU A;  3HCU A;  3MDB C;  4IC2 A;  1WEQ A;  4I7D A;  3SHB A;  1WEN A;  5D1M B;  2JMD A;  4X3G A;  2XB1 A;  2E6R A;  1VFY A;  1WEM A;  1K2F A;  2MNY A;  5LCW B;  4R8P K;  2KRE A;  5KH9 A;  5JG6 A;  3SOX A;  4FIP A;  1Z6U A;  3LQH A;  3ZNI A;  5LKU A;  2FUI A;  2YHO A;  1CHC A;  2UZG A;  4V3K C;  2Y43 A;  5B75 A;  5B8D A;  3N9L A;  2LV9 A;  4QQ4 A;  3ZTG A;  3QZV A;  1WEE A;  3DDT A;  3L11 A;  3ZVY A;  4QF3 A;  2DX8 A;  3MHS A;  2L75 A;  3RTR B;  4A4C A;  3LJU X;  2JM3 A;  3T6R A;  4TKP B;  3V43 A;  4GNE A;  4Q6F A;  4I7C A;  3O37 A;  4PTB A;  2MIQ A;  2KGG A;  1E4U A;  5FB0 A;  1HYJ A;  4ZDT A;  2YUR A;  4AYC A;  5KH7 A;  4YBS A;  4GB0 A;  1WIL A;  1X4I A;  2KE1 A;  2EA6 A;  5G04 B;  2PUY A;  5B79 A;  4P5O B;  2ECT A;  4LKA A;  3DWD A; 
#chains in the Genus database with same CATH homology
 3C5K A;  3LRQ A;  2L0B A;  2LGK A;  2HYE D;  1ZBD B;  5J3X A;  2MA5 A;  3LQI A;  4GND A;  1WEP A;  2LQ6 A;  2JRJ A;  4AP4 A;  1T1H A;  2F6J A;  3PUQ A;  1HYI A;  2FUU A;  2KYU A;  4C9Z A;  2MUM A;  1WFK A;  2VJF A;  4NN2 A;  3KNV A;  5FEY A;  3M63 A;  1X4J A;  4WZ0 A;  5FB1 A;  5C13 A;  2MD7 B;  2LRI C;  2PNX A;  1WES A;  3O34 A;  2YRE A;  4A4B A;  2YQL A;  2KR4 A;  3VK6 A;  5DIN A;  5FER A;  2M3H A;  4MSX A;  4R7E A;  3U5M A;  3HCT A;  2C2L A;  4UI9 B;  2CKL B;  2LGG A;  2QJ0 A;  4N4F A;  1WEV A;  3ASL A;  3ZPV E;  1BOR A;  5KH3 A;  2Y1M A;  5TAB A;  1Z60 A;  4YBT A;  2AN6 A;  2YSJ A;  3L1Z B;  2KGI A;  4GNG A;  2Y1N A;  2JMI A;  4L58 A;  2IDA A;  4BHW A;  1IYM A;  2M6M A;  2ECW A;  2VPE A;  3M99 A;  3L1X A;  1X4U A;  5TDW A;  5TDR A;  5G05 B;  2BAY A;  1DVP A;  3SOW A;  2KWK A;  4UP0 A;  2ZET C;  5LKZ A;  2YT5 A;  1WGM A;  2MA6 A;  1WIM A;  3N9N A;  4B7Y C;  2LDR A;  3O70 A;  2VPB A;  5TBN A;  3GL6 A;  3I2D A;  4S3O B;  3KV5 A;  2I50 A;  4I7B A;  3O35 A;  2LXH C;  4XI1 A;  3MHH A;  1WEU A;  2MT5 A;  1WEO A;  4FK5 A;  2QIC A;  5TRB A;  3ZPV 1;  4A0C D;  1JM7 B;  5D1K B;  3T7L A;  5I3L A;  4YAT A;  2YSM A;  4WZ2 A;  4S3O C;  1Z2Q A;  3RPG B;  3O7A A;  4YAD A;  2G6Q A;  2L5U A;  1RMD A;  3M62 A;  5H9M A;  3LQJ A;  2LGL A;  4CCG X;  2EOD A;  1U6G B;  4WA6 A;  2M1R A;  3C6W A;  2RI7 A;  5LKT A;  1LDK C;  4WZ3 B;  3ZYQ A;  2CT2 A;  2K17 A;  2VJE A;  2LGV A;  3PHD A;  3SOU A;  2LXP C;  2K1J A;  4AVX A;  5LKX A;  4LAD B;  4MVT A;  2YUC A;  2ECG A;  4YAB A;  4LJN A;  4R2Y A;  1F62 A;  2KFT A;  2G43 A;  3N9M A;  1VYX A;  2H0D A;  4LK9 A;  2VNF A;  2CSZ A;  2KIZ A;  3ZVZ B;  4F52 B;  2KU3 A;  3DQV R;  3DPL R;  2YHN A;  3O33 A;  3IHP A;  2YQM A;  2CSY A;  4UP5 A;  5C11 A;  2KWO A;  1FBV A;  1N87 A;  2EGP A;  4B86 C;  2CKL A;  4YAX A;  1LDJ B;  4PPE A;  3N9O A;  1WEW A;  3EB5 A;  2RSD A;  4AUQ B;  5H1U A;  2MNZ A;  3U5P A;  4AYC B;  5G0F A;  2VP7 A;  1XWH A;  4A49 A;  2YYR A;  1VD4 A;  3KQI A;  4YBM A;  4ZQL A;  5DKA A;  1V87 A;  1FP0 A;  2ECI A;  5AIU A;  3PUR A;  2F6N A;  4YC9 A;  2ECJ A;  2KWN A;  2OXQ C;  4QF2 A;  2QIZ A;  2F42 A;  2C2V S;  3N9Q A;  2L80 A;  2FSA A;  3EB6 A;  1JOC A;  2G45 A;  2E6S A;  4ZUX U;  4L7X A;  2D8S A;  5H1V A;  4FJC A;  1WE9 A;  2K16 A;  4BBQ A;  5H1T A;  2VJF B;  2VPD A;  2L43 A;  4FO9 A;  4O64 A;  5B78 A;  2ECV A;  5D1L B;  4LLB A;  2NAA A;  4V3L C;  2VJE B;  2K4D A;  5B77 A;  3U5O A;  2HDP A;  3NG2 A;  1JM7 A;  4W4U A;  5EYA F;  2JMJ A;  4CA1 A;  1MM2 A;  3RPG C;  2MD8 C;  3GV4 A;  2VPG A;  3FL2 A;  2LN0 A;  3N9P A;  3U5N A;  2H0D B;  1MM3 A;  3HTK C;  3O36 A;  2M85 A;  4IC3 A;  1G25 A;  2YU4 A;  4GNF A;  2ECN A;  3KV6 A;  3HCS A;  2KWJ A;  5B76 A;  2YW8 A;  5AIT A;  4N3W A;  2XEU A;  3HCU A;  4IC2 A;  1WEQ A;  4I7D A;  3SHB A;  1WEN A;  5D1M B;  2JMD A;  4X3G A;  2XB1 A;  2E6R A;  1VFY A;  1WEM A;  1K2F A;  2MNY A;  5LCW B;  4R8P K;  2KRE A;  5KH9 A;  5JG6 A;  3SOX A;  4FIP A;  1Z6U A;  3LQH A;  3ZNI A;  5LKU A;  2FUI A;  2YHO A;  1CHC A;  4V3K C;  2UZG A;  2Y43 A;  5B75 A;  5B8D A;  3N9L A;  2LV9 A;  3ZTG A;  3QZV A;  1WEE A;  3L11 A;  3ZVY A;  4QF3 A;  2DX8 A;  3MHS A;  2L75 A;  3RTR B;  4A4C A;  3T6R A;  4TKP B;  3V43 A;  4GNE A;  4Q6F A;  4I7C A;  3O37 A;  2MIQ A;  4PTB A;  2KGG A;  1E4U A;  5FB0 A;  1HYJ A;  4ZDT A;  2YUR A;  4AYC A;  5KH7 A;  4YBS A;  4GB0 A;  1WIL A;  1X4I A;  2KE1 A;  2EA6 A;  5G04 B;  2PUY A;  5B79 A;  4P5O B;  2ECT A;  4LKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...