2KIZA

Solution structure of arkadia ring-h2 finger domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIEAQLPSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase Arkadia
publication title NMR-based insights into the conformational and interaction properties of Arkadia RING-H2 E3 Ub ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kizA01
4B86C 2YYRA 4A4BA 2ECIA 4UP5A 3GL6A 5G04B 2YQMA 2QJ0A 3L11A 4AYCB 2YHOA 4YADA 3VK6A 2VPGA 1WESA 1HYIA 1VFYA 3U5PA 5LKXA 2MUMA 1X4IA 1FP0A 1WE9A 2M1RA 5B8DA 4UP0A 2L75A 4YABA 2YURA 2MT5A 5H9MA 2JMJA 3L1ZB 2YSMA 3DQVR 4WZ3B 2G45A 1HYJA 5LKTA 4A0CD 2K1JA 2Y1MA 3PHDA 2VJFA 3HCSA 2ECWA 2Y1NA 3M99A 1LDJB 4BBQA 4IC3A 3MHHA 5H1UA 5FERA 2MNYA 4A49A 1G25A 3LQIA 4Q6FA 2YT5A 3O35A 2ECGA 3ZVZB 1WEWA 1JM7A 4GB0A 2ECNA 2RSDA 2RI7A 5B76A 4WZ0A 3SOWA 2ECTA 3N9PA 2LXHC 3RTRB 1U6GB 4TKPB 1WFKA 4B7YC 3I2DA 3T7LA 4N4FA 2MNZA 3QZVA 3N9NA 2EODA 2ECVA 2KE1A 4X3GA 3U5OA 5TRBA 5B78A 1DVPA 3SOUA 2KWKA 2I50A 2EGPA 4P5OB 2HDPA 5AIUA 2LGKA 2YHNA 2IDAA 3ZYQA 2G6QA 3EB6A 5G0FA 2E6SA 4YBTA 4MVTA 1MM2A 1WEQA 2KGIA 4YAXA 1RMDA 2VJFB 2PUYA 3O36A 5FEYA 2KWJA 4XI1A 4FIPA 2OXQC 1JM7B 3IHPA 2C2VS 1Z60A 4YATA 2LV9A 2E6RA 4YBSA 4O64A 2KREA 2K4DA 3ZPVE 1X4UA 3FL2A 4N3WA 2VP7A 3ZPV1 1X4JA 1E4UA 2ECJA 3ZTGA 2VPDA 3ASLA 1WEEA 4BHWA 4CCGX 1Z6UA 2VPBA 3PURA 1WIMA 3RPGB 2EA6A 3N9MA 4A4CA 1LDKC 4ZQLA 2CKLA 4LKAA 3O7AA 3L1XA 3ZNIA 2KYUA 2M6MA 1BORA 2C2LA 2DX8A 1WENA 1WEPA 2G43A 3HCUA 3LQHA 3KV5A 3C5KA 2JMDA 2VJEA 3U5MA 2LGVA 2PNXA 1VYXA 5G05B 2JRJA 5KH7A 1JOCA 4AUQB 1IYMA 3C6WA 2D8SA 5I3LA 3LRQA 5C13A 4R2YA 3PUQA 4PTBA 2L0BA 2CT2A 4MSXA 1WEVA 5KH3A 4IC2A 4QF3A 2F6NA 2MA5A 2FUIA 2YUCA 5D1KB 2HYED 5DINA 4LK9A 4WA6A 2LGLA 3KQIA 3SHBA 4R8PK 3RPGC 3V43A 2L5UA 4GNDA 2LQ6A 3NG2A 3SOXA 2CKLB 2LGGA 5D1LB 4GNEA 2CSYA 2KIZA 2AN6A 3N9QA 2KR4A 4C9ZA 2MIQA 3N9OA 5J3XA 4F52B 2BAYA 5TDRA 2VJEB 4S3OC 4ZUXU 2LRIC 2MA6A 4GNFA 1F62A 2M85A 2UZGA 2MD7B 2MD8C 4YBMA 5DKAA 2H0DA 5LKZA 1WEUA 2YW8A 1CHCA 5EYAF 3O70A 2NAAA 3U5NA 3DPLR 4YC9A 4V3LC 5TDWA 1T1HA 1WGMA 5TBNA 4LJNA 4LLBA 2FSAA 4L58A 4PPEA 2K17A 2LXPC 5C11A 3HCTA 3EB5A 2L80A 3O34A 3KV6A 4FJCA 4LADB 2K16A 2VNFA 1Z2QA 4UI9B 1WILA 2KU3A 3M62A 5LCWB 5B79A 2VPEA 2YQLA 1WEOA 4FO9A 5TABA 5JG6A 3N9LA 2FUUA 2QICA 4S3OB 4WZ2A 3KNVA 2YU4A 5D1MB 1VD4A 1MM3A 2KFTA 2Y43A 3O37A 5H1VA 2LN0A 2H0DB 5FB1A 2L43A 3M63A 4AVXA 4R7EA 2KWNA 2KWOA 4AYCA 5AITA 4QF2A 5H1TA 4I7DA 5LKUA 2YREA 2XB1A 4GNGA 1V87A 4CA1A 4L7XA 4FK5A 4AP4A 2ZETC 3O33A 5B75A 3T6RA 4W4UA 2F6JA 2M3HA 3ZVYA 3MHSA 1XWHA 4I7BA 1WEMA 2JMIA 2KGGA 2LDRA 5FB0A 4ZDTA 4I7CA 2YSJA 1N87A 4V3KC 2XEUA 1K2FA 5B77A 1FBVA 2F42A 5KH9A 3HTKC 2CSZA 2QIZA 3GV4A 1ZBDB 3LQJA 4NN2A
chains in the Genus database with same CATH superfamily
4B86C 2YYRA 4A4BA 2ECIA 3E2DA 3GL6A 4UP5A 5G04B 2YQMA 2QJ0A 3L11A 4AYCB 2YHOA 4YADA 3VK6A 2VPGA 1WESA 1HYIA 5K3QA 3DDTA 1VFYA 3U5PA 5LKXA 2MUMA 1X4IA 1FP0A 1WE9A 2M1RA 2OWAA 5B8DA 5SVIA 4UP0A 2L75A 4YABA 2YURA 2MT5A 5H9MA 2JMJA 2XOCA 2KKXA 1DCQA 3L1ZB 2YSMA 3DQVR 4WZ3B 2G45A 2XOZA 1HYJA 3FM8C 5LKTA 4A0CD 2K1JA 2Y1MA 3PHDA 2VJFA 3HCSA 2ECWA 2Y1NA 3M99A 1LDJB 3LJUX 4BBQA 4IC3A 3MHHA 5H1UA 5FERA 2MNYA 4A49A 1G25A 3LQIA 4Q6FA 2YT5A 3O35A 2ECGA 3ZVZB 1WEWA 3O47A 1JM7A 4GB0A 2ECNA 2RSDA 2RI7A 5B76A 4WZ0A 3SOWA 2ECTA 3N9PA 2LXHC 3RTRB 4Z0OA 1U6GB 4TKPB 1WFKA 4B7YC 3I2DA 3T7LA 4N4FA 2MNZA 3Q1DA 3QZVA 3FEHA 3N9NA 2EODA 2ECVA 2KE1A 4X3GA 3U5OA 5TRBA 5B78A 1DVPA 3SOUA 2KWKA 2I50A 2EGPA 4P5OB 5SVIB 2HDPA 3FANA 5AIUA 3SUBA 2LGKA 2YHNA 2IDAA 3DWDA 2XP0A 3ZYQA 2G6QA 3EB6A 5G0FA 2E6SA 4YBTA 4MVTA 1MM2A 1WEQA 2KGIA 4YAXA 2FD4A 1RMDA 2XOYA 2VJFB 2JM3A 2PUYA 3O36A 5FEYA 2KWJA 2CRWA 4XI1A 4FIPA 2OXQC 1JM7B 2P57A 2E61A 3IHPA 2C2VS 1Z60A 4YATA 2LV9A 2E6RA 4YBSA 4O64A 2KREA 2K4DA 3ZPVE 1MBMA 1X4UA 3FL2A 2CRRA 4N3WA 2VP7A 3ZPV1 1X4JA 1E4UA 2ECJA 3ZTGA 2VPDA 3ASLA 1WEEA 4BHWA 4CCGX 1Z6UA 2VPBA 3PURA 3LVQE 1WIMA 3RPGB 2EA6A 3N9MA 4A4CA 1LDKC 4ZQLA 2CKLA 4LKAA 3FJUB 2FFWA 3O7AA 3L1XA 3ZNIA 2KYUA 3JUEA 2IQJA 2D8UA 2M6MA 1BORA 2C2LA 2DX8A 1WENA 1WEPA 2G43A 3HCUA 3LQHA 3KV5A 3C5KA 2JMDA 2VJEA 3U5MA 2LGVA 2PNXA 1VYXA 5G05B 2JRJA 5KH7A 1JOCA 2CSVA 4AUQB 1IYMA 3C6WA 3PLWA 2DSMA 2D8SA 5I3LA 3LRQA 5C13A 4R2YA 2LAUA 3PUQA 4OGCA 4PTBA 5SVYA 2L0BA 2CT2A 4MSXA 1WEVA 4F1PA 5KH3A 4IC2A 4QF3A 2F6NA 2MA5A 2FUIA 2YUCA 5D1KB 2HYED 5DINA 4LK9A 4WA6A 2LGLA 3KQIA 3SHBA 4R8PK 3RPGC 3V43A 2L5UA 4GNDA 5SVXA 4H9DA 2LQ6A 3NG2A 2KKYA 3SOXA 2CKLB 2LGGA 5D1LB 4GNEA 2CSYA 2KIZA 2AN6A 3N9QA 2MKEA 2KR4A 2B0OE 4C9ZA 2MIQA 3N9OA 5J3XA 4F52B 2BAYA 5TDRA 2VJEB 4S3OC 4ZUXU 2LRIC 2DJAA 2MA6A 4GNFA 1F62A 2M85A 2UZGA 2MD7B 2MD8C 4YBMA 5DKAA 2H0DA 5LKZA 1WEUA 2YW8A 1CHCA 4Z0RA 3MDBC 5EYAF 2YVRA 3O70A 2NAAA 3U5NA 3DPLR 2JUNA 4YC9A 4V3LC 4O62A 5TDWA 1T1HA 1WGMA 5TBNA 4LJNA 4LLBA 3FAOA 2FSAA 4L58A 4PPEA 2K17A 2LXPC 5C11A 2M13A 3HCTA 3EB5A 2L80A 3O34A 3KV6A 2EXUA 4FJCA 4LADB 2K16A 2VNFA 1Z2QA 4UI9B 1WILA 3T9KA 2KU3A 3M62A 5LCWB 5B79A 2VPEA 2YQLA 1WEOA 4FO9A 5TABA 5JG6A 3N9LA 2FUUA 2QICA 4S3OB 4WZ2A 3KNVA 2YU4A 5D1MB 1VD4A 1MM3A 2KFTA 2Y43A 3O37A 5H1VA 2LN0A 2H0DB 5FB1A 2L43A 3M63A 4AVXA 4R7EA 2KWNA 2KWOA 3LDYA 4AYCA 5AITA 4QF2A 5H1TA 4I7DA 5LKUA 2YREA 2XB1A 4GNGA 1V87A 4CA1A 4OGEA 4L7XA 4FK5A 4AP4A 2ZETC 3O33A 5B75A 3T6RA 4QQ4A 4W4UA 2F6JA 2M3HA 3ZVYA 2L7PA 3MHSA 1XWHA 4I7BA 1WEMA 3H7HA 3M7KA 2JMIA 2KGGA 2LDRA 5FB0A 4ZDTA 4I7CA 2EGMA 2YSJA 1N87A 2CONA 4V3KC 2XEUA 1K2FA 5B77A 1FBVA 2F42A 2RR4A 5KH9A 3HTKC 3KDEC 2CSZA 2QIZA 3GV4A 1ZBDB 3LQJA 3LVRE 4NN2A
chains in the Genus database with same CATH topology
4B86C 2YYRA 4A4BA 2ECIA 4UP5A 3GL6A 5G04B 2YQMA 2QJ0A 3L11A 4AYCB 2YHOA 4YADA 3VK6A 2VPGA 1WESA 1HYIA 1VFYA 3U5PA 5LKXA 2MUMA 1X4IA 1FP0A 1WE9A 2M1RA 5B8DA 4UP0A 2L75A 4YABA 2YURA 2MT5A 5H9MA 2JMJA 3L1ZB 2YSMA 3DQVR 4WZ3B 2G45A 1HYJA 5LKTA 4A0CD 2K1JA 2Y1MA 3PHDA 2VJFA 3HCSA 2ECWA 2Y1NA 3M99A 1LDJB 4BBQA 4IC3A 3MHHA 5H1UA 5FERA 2MNYA 4A49A 1G25A 3LQIA 4Q6FA 2YT5A 3O35A 2ECGA 3ZVZB 1WEWA 1JM7A 4GB0A 2ECNA 2RSDA 2RI7A 5B76A 4WZ0A 3SOWA 2ECTA 3N9PA 2LXHC 3RTRB 1U6GB 4TKPB 1WFKA 4B7YC 3I2DA 3T7LA 4N4FA 2MNZA 3QZVA 3N9NA 2EODA 2ECVA 2KE1A 4X3GA 3U5OA 5TRBA 5B78A 1DVPA 3SOUA 2KWKA 2I50A 2EGPA 4P5OB 2HDPA 5AIUA 2LGKA 2YHNA 2IDAA 3ZYQA 2G6QA 3EB6A 5G0FA 2E6SA 4YBTA 4MVTA 1MM2A 1WEQA 2KGIA 4YAXA 1RMDA 2VJFB 2PUYA 3O36A 5FEYA 2KWJA 4XI1A 4FIPA 2OXQC 1JM7B 3IHPA 2C2VS 1Z60A 4YATA 2LV9A 2E6RA 4YBSA 4O64A 2KREA 2K4DA 3ZPVE 1X4UA 3FL2A 4N3WA 2VP7A 3ZPV1 1X4JA 1E4UA 2ECJA 3ZTGA 2VPDA 3ASLA 1WEEA 4BHWA 4CCGX 1Z6UA 2VPBA 3PURA 1WIMA 3RPGB 2EA6A 3N9MA 4A4CA 1LDKC 4ZQLA 2CKLA 4LKAA 3O7AA 3L1XA 3ZNIA 2KYUA 2M6MA 1BORA 2C2LA 2DX8A 1WENA 1WEPA 2G43A 3HCUA 3LQHA 3KV5A 3C5KA 2JMDA 2VJEA 3U5MA 2LGVA 2PNXA 1VYXA 5G05B 2JRJA 5KH7A 1JOCA 4AUQB 1IYMA 3C6WA 2D8SA 5I3LA 3LRQA 5C13A 4R2YA 3PUQA 4PTBA 2L0BA 2CT2A 4MSXA 1WEVA 5KH3A 4IC2A 4QF3A 2F6NA 2MA5A 2FUIA 2YUCA 5D1KB 2HYED 5DINA 4LK9A 4WA6A 2LGLA 3KQIA 3SHBA 4R8PK 3RPGC 3V43A 2L5UA 4GNDA 2LQ6A 3NG2A 3SOXA 2CKLB 2LGGA 5D1LB 4GNEA 2CSYA 2KIZA 2AN6A 3N9QA 2KR4A 4C9ZA 2MIQA 3N9OA 5J3XA 4F52B 2BAYA 5TDRA 2VJEB 4S3OC 4ZUXU 2LRIC 2MA6A 4GNFA 1F62A 2M85A 2UZGA 2MD7B 2MD8C 4YBMA 5DKAA 2H0DA 5LKZA 1WEUA 2YW8A 1CHCA 5EYAF 3O70A 2NAAA 3U5NA 3DPLR 4YC9A 4V3LC 5TDWA 1T1HA 1WGMA 5TBNA 4LJNA 4LLBA 2FSAA 4L58A 4PPEA 2K17A 2LXPC 5C11A 3HCTA 3EB5A 2L80A 3O34A 3KV6A 4FJCA 4LADB 2K16A 2VNFA 1Z2QA 4UI9B 1WILA 2KU3A 3M62A 5LCWB 5B79A 2VPEA 2YQLA 1WEOA 4FO9A 5TABA 5JG6A 3N9LA 2FUUA 2QICA 4S3OB 4WZ2A 3KNVA 2YU4A 5D1MB 1VD4A 1MM3A 2KFTA 2Y43A 3O37A 5H1VA 2LN0A 2H0DB 5FB1A 2L43A 3M63A 4AVXA 4R7EA 2KWNA 2KWOA 4AYCA 5AITA 4QF2A 5H1TA 4I7DA 5LKUA 2YREA 2XB1A 4GNGA 1V87A 4CA1A 4L7XA 4FK5A 4AP4A 2ZETC 3O33A 5B75A 3T6RA 4W4UA 2F6JA 2M3HA 3ZVYA 3MHSA 1XWHA 4I7BA 1WEMA 2JMIA 2KGGA 2LDRA 5FB0A 4ZDTA 4I7CA 2YSJA 1N87A 4V3KC 2XEUA 1K2FA 5B77A 1FBVA 2F42A 5KH9A 3HTKC 2CSZA 2QIZA 3GV4A 1ZBDB 3LQJA 4NN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B86 C;  2YYR A;  4A4B A;  2ECI A;  4UP5 A;  3GL6 A;  5G04 B;  2YQM A;  2QJ0 A;  3L11 A;  4AYC B;  2YHO A;  4YAD A;  3VK6 A;  2VPG A;  1WES A;  1HYI A;  1VFY A;  3U5P A;  5LKX A;  2MUM A;  1X4I A;  1FP0 A;  1WE9 A;  2M1R A;  5B8D A;  4UP0 A;  2L75 A;  4YAB A;  2YUR A;  2MT5 A;  5H9M A;  2JMJ A;  3L1Z B;  2YSM A;  3DQV R;  4WZ3 B;  2G45 A;  1HYJ A;  5LKT A;  4A0C D;  2K1J A;  2Y1M A;  3PHD A;  2VJF A;  3HCS A;  2ECW A;  2Y1N A;  3M99 A;  1LDJ B;  4BBQ A;  4IC3 A;  3MHH A;  5H1U A;  5FER A;  2MNY A;  4A49 A;  1G25 A;  3LQI A;  4Q6F A;  2YT5 A;  3O35 A;  2ECG A;  3ZVZ B;  1WEW A;  1JM7 A;  4GB0 A;  2ECN A;  2RSD A;  2RI7 A;  5B76 A;  4WZ0 A;  3SOW A;  2ECT A;  3N9P A;  2LXH C;  3RTR B;  1U6G B;  4TKP B;  1WFK A;  4B7Y C;  3I2D A;  3T7L A;  4N4F A;  2MNZ A;  3QZV A;  3N9N A;  2EOD A;  2ECV A;  2KE1 A;  4X3G A;  3U5O A;  5TRB A;  5B78 A;  1DVP A;  3SOU A;  2KWK A;  2I50 A;  2EGP A;  4P5O B;  2HDP A;  5AIU A;  2LGK A;  2YHN A;  2IDA A;  3ZYQ A;  2G6Q A;  3EB6 A;  5G0F A;  2E6S A;  4YBT A;  4MVT A;  1MM2 A;  1WEQ A;  2KGI A;  4YAX A;  1RMD A;  2VJF B;  2PUY A;  3O36 A;  5FEY A;  2KWJ A;  4XI1 A;  4FIP A;  2OXQ C;  1JM7 B;  3IHP A;  2C2V S;  1Z60 A;  4YAT A;  2LV9 A;  2E6R A;  4YBS A;  4O64 A;  2KRE A;  2K4D A;  3ZPV E;  1X4U A;  3FL2 A;  4N3W A;  2VP7 A;  3ZPV 1;  1X4J A;  1E4U A;  2ECJ A;  3ZTG A;  2VPD A;  3ASL A;  1WEE A;  4BHW A;  4CCG X;  1Z6U A;  2VPB A;  3PUR A;  1WIM A;  3RPG B;  2EA6 A;  3N9M A;  4A4C A;  1LDK C;  4ZQL A;  2CKL A;  4LKA A;  3O7A A;  3L1X A;  3ZNI A;  2KYU A;  2M6M A;  1BOR A;  2C2L A;  2DX8 A;  1WEN A;  1WEP A;  2G43 A;  3HCU A;  3LQH A;  3KV5 A;  3C5K A;  2JMD A;  2VJE A;  3U5M A;  2LGV A;  2PNX A;  1VYX A;  5G05 B;  2JRJ A;  5KH7 A;  1JOC A;  4AUQ B;  1IYM A;  3C6W A;  2D8S A;  5I3L A;  3LRQ A;  5C13 A;  4R2Y A;  3PUQ A;  4PTB A;  2L0B A;  2CT2 A;  4MSX A;  1WEV A;  5KH3 A;  4IC2 A;  4QF3 A;  2F6N A;  2MA5 A;  2FUI A;  2YUC A;  5D1K B;  2HYE D;  5DIN A;  4LK9 A;  4WA6 A;  2LGL A;  3KQI A;  3SHB A;  4R8P K;  3RPG C;  3V43 A;  2L5U A;  4GND A;  2LQ6 A;  3NG2 A;  3SOX A;  2CKL B;  2LGG A;  5D1L B;  4GNE A;  2CSY A;  2KIZ A;  2AN6 A;  3N9Q A;  2KR4 A;  4C9Z A;  2MIQ A;  3N9O A;  5J3X A;  4F52 B;  2BAY A;  5TDR A;  2VJE B;  4S3O C;  4ZUX U;  2LRI C;  2MA6 A;  4GNF A;  1F62 A;  2M85 A;  2UZG A;  2MD7 B;  2MD8 C;  4YBM A;  5DKA A;  2H0D A;  5LKZ A;  1WEU A;  2YW8 A;  1CHC A;  5EYA F;  3O70 A;  2NAA A;  3U5N A;  3DPL R;  4YC9 A;  4V3L C;  5TDW A;  1T1H A;  1WGM A;  5TBN A;  4LJN A;  4LLB A;  2FSA A;  4L58 A;  4PPE A;  2K17 A;  2LXP C;  5C11 A;  3HCT A;  3EB5 A;  2L80 A;  3O34 A;  3KV6 A;  4FJC A;  4LAD B;  2K16 A;  2VNF A;  1Z2Q A;  4UI9 B;  1WIL A;  2KU3 A;  3M62 A;  5LCW B;  5B79 A;  2VPE A;  2YQL A;  1WEO A;  4FO9 A;  5TAB A;  5JG6 A;  3N9L A;  2FUU A;  2QIC A;  4S3O B;  4WZ2 A;  3KNV A;  2YU4 A;  5D1M B;  1VD4 A;  1MM3 A;  2KFT A;  2Y43 A;  3O37 A;  5H1V A;  2LN0 A;  2H0D B;  5FB1 A;  2L43 A;  3M63 A;  4AVX A;  4R7E A;  2KWN A;  2KWO A;  4AYC A;  5AIT A;  4QF2 A;  5H1T A;  4I7D A;  5LKU A;  2YRE A;  2XB1 A;  4GNG A;  1V87 A;  4CA1 A;  4L7X A;  4FK5 A;  4AP4 A;  2ZET C;  3O33 A;  5B75 A;  3T6R A;  4W4U A;  2F6J A;  2M3H A;  3ZVY A;  3MHS A;  1XWH A;  4I7B A;  1WEM A;  2JMI A;  2KGG A;  2LDR A;  5FB0 A;  4ZDT A;  4I7C A;  2YSJ A;  1N87 A;  4V3K C;  2XEU A;  1K2F A;  5B77 A;  1FBV A;  2F42 A;  5KH9 A;  3HTK C;  2CSZ A;  2QIZ A;  3GV4 A;  1ZBD B;  3LQJ A;  4NN2 A; 
#chains in the Genus database with same CATH topology
 4B86 C;  2YYR A;  4A4B A;  2ECI A;  3E2D A;  3GL6 A;  4UP5 A;  5G04 B;  2YQM A;  2QJ0 A;  3L11 A;  4AYC B;  2YHO A;  4YAD A;  3VK6 A;  2VPG A;  1WES A;  1HYI A;  5K3Q A;  3DDT A;  1VFY A;  3U5P A;  5LKX A;  2MUM A;  1X4I A;  1FP0 A;  1WE9 A;  2M1R A;  2OWA A;  5B8D A;  5SVI A;  4UP0 A;  2L75 A;  4YAB A;  2YUR A;  2MT5 A;  5H9M A;  2JMJ A;  2XOC A;  2KKX A;  1DCQ A;  3L1Z B;  2YSM A;  3DQV R;  4WZ3 B;  2G45 A;  2XOZ A;  1HYJ A;  3FM8 C;  5LKT A;  4A0C D;  2K1J A;  2Y1M A;  3PHD A;  2VJF A;  3HCS A;  2ECW A;  2Y1N A;  3M99 A;  1LDJ B;  3LJU X;  4BBQ A;  4IC3 A;  3MHH A;  5H1U A;  5FER A;  2MNY A;  4A49 A;  1G25 A;  3LQI A;  4Q6F A;  2YT5 A;  3O35 A;  2ECG A;  3ZVZ B;  1WEW A;  3O47 A;  1JM7 A;  4GB0 A;  2ECN A;  2RSD A;  2RI7 A;  5B76 A;  4WZ0 A;  3SOW A;  2ECT A;  3N9P A;  2LXH C;  3RTR B;  4Z0O A;  1U6G B;  4TKP B;  1WFK A;  4B7Y C;  3I2D A;  3T7L A;  4N4F A;  2MNZ A;  3Q1D A;  3QZV A;  3FEH A;  3N9N A;  2EOD A;  2ECV A;  2KE1 A;  4X3G A;  3U5O A;  5TRB A;  5B78 A;  1DVP A;  3SOU A;  2KWK A;  2I50 A;  2EGP A;  4P5O B;  5SVI B;  2HDP A;  3FAN A;  5AIU A;  3SUB A;  2LGK A;  2YHN A;  2IDA A;  3DWD A;  2XP0 A;  3ZYQ A;  2G6Q A;  3EB6 A;  5G0F A;  2E6S A;  4YBT A;  4MVT A;  1MM2 A;  1WEQ A;  2KGI A;  4YAX A;  2FD4 A;  1RMD A;  2XOY A;  2VJF B;  2JM3 A;  2PUY A;  3O36 A;  5FEY A;  2KWJ A;  2CRW A;  4XI1 A;  4FIP A;  2OXQ C;  1JM7 B;  2P57 A;  2E61 A;  3IHP A;  2C2V S;  1Z60 A;  4YAT A;  2LV9 A;  2E6R A;  4YBS A;  4O64 A;  2KRE A;  2K4D A;  3ZPV E;  1MBM A;  1X4U A;  3FL2 A;  2CRR A;  4N3W A;  2VP7 A;  3ZPV 1;  1X4J A;  1E4U A;  2ECJ A;  3ZTG A;  2VPD A;  3ASL A;  1WEE A;  4BHW A;  4CCG X;  1Z6U A;  2VPB A;  3PUR A;  3LVQ E;  1WIM A;  3RPG B;  2EA6 A;  3N9M A;  4A4C A;  1LDK C;  4ZQL A;  2CKL A;  4LKA A;  3FJU B;  2FFW A;  3O7A A;  3L1X A;  3ZNI A;  2KYU A;  3JUE A;  2IQJ A;  2D8U A;  2M6M A;  1BOR A;  2C2L A;  2DX8 A;  1WEN A;  1WEP A;  2G43 A;  3HCU A;  3LQH A;  3KV5 A;  3C5K A;  2JMD A;  2VJE A;  3U5M A;  2LGV A;  2PNX A;  1VYX A;  5G05 B;  2JRJ A;  5KH7 A;  1JOC A;  2CSV A;  4AUQ B;  1IYM A;  3C6W A;  3PLW A;  2DSM A;  2D8S A;  5I3L A;  3LRQ A;  5C13 A;  4R2Y A;  2LAU A;  3PUQ A;  4OGC A;  4PTB A;  5SVY A;  2L0B A;  2CT2 A;  4MSX A;  1WEV A;  4F1P A;  5KH3 A;  4IC2 A;  4QF3 A;  2F6N A;  2MA5 A;  2FUI A;  2YUC A;  5D1K B;  2HYE D;  5DIN A;  4LK9 A;  4WA6 A;  2LGL A;  3KQI A;  3SHB A;  4R8P K;  3RPG C;  3V43 A;  2L5U A;  4GND A;  5SVX A;  4H9D A;  2LQ6 A;  3NG2 A;  2KKY A;  3SOX A;  2CKL B;  2LGG A;  5D1L B;  4GNE A;  2CSY A;  2KIZ A;  2AN6 A;  3N9Q A;  2MKE A;  2KR4 A;  2B0O E;  4C9Z A;  2MIQ A;  3N9O A;  5J3X A;  4F52 B;  2BAY A;  5TDR A;  2VJE B;  4S3O C;  4ZUX U;  2LRI C;  2DJA A;  2MA6 A;  4GNF A;  1F62 A;  2M85 A;  2UZG A;  2MD7 B;  2MD8 C;  4YBM A;  5DKA A;  2H0D A;  5LKZ A;  1WEU A;  2YW8 A;  1CHC A;  4Z0R A;  3MDB C;  5EYA F;  2YVR A;  3O70 A;  2NAA A;  3U5N A;  3DPL R;  2JUN A;  4YC9 A;  4V3L C;  4O62 A;  5TDW A;  1T1H A;  1WGM A;  5TBN A;  4LJN A;  4LLB A;  3FAO A;  2FSA A;  4L58 A;  4PPE A;  2K17 A;  2LXP C;  5C11 A;  2M13 A;  3HCT A;  3EB5 A;  2L80 A;  3O34 A;  3KV6 A;  2EXU A;  4FJC A;  4LAD B;  2K16 A;  2VNF A;  1Z2Q A;  4UI9 B;  1WIL A;  3T9K A;  2KU3 A;  3M62 A;  5LCW B;  5B79 A;  2VPE A;  2YQL A;  1WEO A;  4FO9 A;  5TAB A;  5JG6 A;  3N9L A;  2FUU A;  2QIC A;  4S3O B;  4WZ2 A;  3KNV A;  2YU4 A;  5D1M B;  1VD4 A;  1MM3 A;  2KFT A;  2Y43 A;  3O37 A;  5H1V A;  2LN0 A;  2H0D B;  5FB1 A;  2L43 A;  3M63 A;  4AVX A;  4R7E A;  2KWN A;  2KWO A;  3LDY A;  4AYC A;  5AIT A;  4QF2 A;  5H1T A;  4I7D A;  5LKU A;  2YRE A;  2XB1 A;  4GNG A;  1V87 A;  4CA1 A;  4OGE A;  4L7X A;  4FK5 A;  4AP4 A;  2ZET C;  3O33 A;  5B75 A;  3T6R A;  4QQ4 A;  4W4U A;  2F6J A;  2M3H A;  3ZVY A;  2L7P A;  3MHS A;  1XWH A;  4I7B A;  1WEM A;  3H7H A;  3M7K A;  2JMI A;  2KGG A;  2LDR A;  5FB0 A;  4ZDT A;  4I7C A;  2EGM A;  2YSJ A;  1N87 A;  2CON A;  4V3K C;  2XEU A;  1K2F A;  5B77 A;  1FBV A;  2F42 A;  2RR4 A;  5KH9 A;  3HTK C;  3KDE C;  2CSZ A;  2QIZ A;  3GV4 A;  1ZBD B;  3LQJ A;  3LVR E;  4NN2 A; 
#chains in the Genus database with same CATH homology
 4B86 C;  2YYR A;  4A4B A;  2ECI A;  4UP5 A;  3GL6 A;  5G04 B;  2YQM A;  2QJ0 A;  3L11 A;  4AYC B;  2YHO A;  4YAD A;  3VK6 A;  2VPG A;  1WES A;  1HYI A;  1VFY A;  3U5P A;  5LKX A;  2MUM A;  1X4I A;  1FP0 A;  1WE9 A;  2M1R A;  5B8D A;  4UP0 A;  2L75 A;  4YAB A;  2YUR A;  2MT5 A;  5H9M A;  2JMJ A;  3L1Z B;  2YSM A;  3DQV R;  4WZ3 B;  2G45 A;  1HYJ A;  5LKT A;  4A0C D;  2K1J A;  2Y1M A;  3PHD A;  2VJF A;  3HCS A;  2ECW A;  2Y1N A;  3M99 A;  1LDJ B;  4BBQ A;  4IC3 A;  3MHH A;  5H1U A;  5FER A;  2MNY A;  4A49 A;  1G25 A;  3LQI A;  4Q6F A;  2YT5 A;  3O35 A;  2ECG A;  3ZVZ B;  1WEW A;  1JM7 A;  4GB0 A;  2ECN A;  2RSD A;  2RI7 A;  5B76 A;  4WZ0 A;  3SOW A;  2ECT A;  3N9P A;  2LXH C;  3RTR B;  1U6G B;  4TKP B;  1WFK A;  4B7Y C;  3I2D A;  3T7L A;  4N4F A;  2MNZ A;  3QZV A;  3N9N A;  2EOD A;  2ECV A;  2KE1 A;  4X3G A;  3U5O A;  5TRB A;  5B78 A;  1DVP A;  3SOU A;  2KWK A;  2I50 A;  2EGP A;  4P5O B;  2HDP A;  5AIU A;  2LGK A;  2YHN A;  2IDA A;  3ZYQ A;  2G6Q A;  3EB6 A;  5G0F A;  2E6S A;  4YBT A;  4MVT A;  1MM2 A;  1WEQ A;  2KGI A;  4YAX A;  1RMD A;  2VJF B;  2PUY A;  3O36 A;  5FEY A;  2KWJ A;  4XI1 A;  4FIP A;  2OXQ C;  1JM7 B;  3IHP A;  2C2V S;  1Z60 A;  4YAT A;  2LV9 A;  2E6R A;  4YBS A;  4O64 A;  2KRE A;  2K4D A;  3ZPV E;  1X4U A;  3FL2 A;  4N3W A;  2VP7 A;  3ZPV 1;  1X4J A;  1E4U A;  2ECJ A;  3ZTG A;  2VPD A;  3ASL A;  1WEE A;  4BHW A;  4CCG X;  1Z6U A;  2VPB A;  3PUR A;  1WIM A;  3RPG B;  2EA6 A;  3N9M A;  4A4C A;  1LDK C;  4ZQL A;  2CKL A;  4LKA A;  3O7A A;  3L1X A;  3ZNI A;  2KYU A;  2M6M A;  1BOR A;  2C2L A;  2DX8 A;  1WEN A;  1WEP A;  2G43 A;  3HCU A;  3LQH A;  3KV5 A;  3C5K A;  2JMD A;  2VJE A;  3U5M A;  2LGV A;  2PNX A;  1VYX A;  5G05 B;  2JRJ A;  5KH7 A;  1JOC A;  4AUQ B;  1IYM A;  3C6W A;  2D8S A;  5I3L A;  3LRQ A;  5C13 A;  4R2Y A;  3PUQ A;  4PTB A;  2L0B A;  2CT2 A;  4MSX A;  1WEV A;  5KH3 A;  4IC2 A;  4QF3 A;  2F6N A;  2MA5 A;  2FUI A;  2YUC A;  5D1K B;  2HYE D;  5DIN A;  4LK9 A;  4WA6 A;  2LGL A;  3KQI A;  3SHB A;  4R8P K;  3RPG C;  3V43 A;  2L5U A;  4GND A;  2LQ6 A;  3NG2 A;  3SOX A;  2CKL B;  2LGG A;  5D1L B;  4GNE A;  2CSY A;  2KIZ A;  2AN6 A;  3N9Q A;  2KR4 A;  4C9Z A;  2MIQ A;  3N9O A;  5J3X A;  4F52 B;  2BAY A;  5TDR A;  2VJE B;  4S3O C;  4ZUX U;  2LRI C;  2MA6 A;  4GNF A;  1F62 A;  2M85 A;  2UZG A;  2MD7 B;  2MD8 C;  4YBM A;  5DKA A;  2H0D A;  5LKZ A;  1WEU A;  2YW8 A;  1CHC A;  5EYA F;  3O70 A;  2NAA A;  3U5N A;  3DPL R;  4YC9 A;  4V3L C;  5TDW A;  1T1H A;  1WGM A;  5TBN A;  4LJN A;  4LLB A;  2FSA A;  4L58 A;  4PPE A;  2K17 A;  2LXP C;  5C11 A;  3HCT A;  3EB5 A;  2L80 A;  3O34 A;  3KV6 A;  4FJC A;  4LAD B;  2K16 A;  2VNF A;  1Z2Q A;  4UI9 B;  1WIL A;  2KU3 A;  3M62 A;  5LCW B;  5B79 A;  2VPE A;  2YQL A;  1WEO A;  4FO9 A;  5TAB A;  5JG6 A;  3N9L A;  2FUU A;  2QIC A;  4S3O B;  4WZ2 A;  3KNV A;  2YU4 A;  5D1M B;  1VD4 A;  1MM3 A;  2KFT A;  2Y43 A;  3O37 A;  5H1V A;  2LN0 A;  2H0D B;  5FB1 A;  2L43 A;  3M63 A;  4AVX A;  4R7E A;  2KWN A;  2KWO A;  4AYC A;  5AIT A;  4QF2 A;  5H1T A;  4I7D A;  5LKU A;  2YRE A;  2XB1 A;  4GNG A;  1V87 A;  4CA1 A;  4L7X A;  4FK5 A;  4AP4 A;  2ZET C;  3O33 A;  5B75 A;  3T6R A;  4W4U A;  2F6J A;  2M3H A;  3ZVY A;  3MHS A;  1XWH A;  4I7B A;  1WEM A;  2JMI A;  2KGG A;  2LDR A;  5FB0 A;  4ZDT A;  4I7C A;  2YSJ A;  1N87 A;  4V3K C;  2XEU A;  1K2F A;  5B77 A;  1FBV A;  2F42 A;  5KH9 A;  3HTK C;  2CSZ A;  2QIZ A;  3GV4 A;  1ZBD B;  3LQJ A;  4NN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...