2KIZA

Solution structure of arkadia ring-h2 finger domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
b'MKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIEAQLPSES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase Arkadia
publication title NMR-based insights into the conformational and interaction properties of Arkadia RING-H2 E3 Ub ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kizA01
3MHSA 1XWHA 3N9OA 5FERA 2UZGA 2LN0A 5D1KB 3LRQA 3ZVYA 4GNEA 1V87A 3M62A 3VK6A 2VPBA 3KNVA 3O36A 4I7CA 3T7LA 2VPDA 2Y43A 3EB5A 3O37A 3SOXA 1HYJA 1U6GB 1LDJB 4P5OB 3SOWA 2HYED 2VJFB 4B86C 5TDRA 2H0DB 2YU4A 2ECIA 4O64A 5H1UA 2NAAA 2K1JA 2KFTA 2MNZA 4A0CD 4YAXA 2KR4A 3U5PA 2JRJA 4FK5A 4AYCA 2FUUA 3N9NA 2JMDA 2IDAA 3KQIA 3EB6A 5EYAF 1T1HA 4CA1A 5JG6A 2LXHC 1WIMA 1CHCA 2YSJA 2M1RA 4B7YC 2CKLA 5C11A 3RTRB 2KYUA 2KWJA 1VFYA 5TBNA 1WEWA 5FB0A 1WE9A 1VD4A 2YW8A 5H1TA 2KE1A 4PPEA 4WZ3B 2F6NA 5B77A 2QICA 1VYXA 2KGIA 2MNYA 2M85A 2YHOA 1X4IA 2L5UA 5LKZA 1JM7B 3PUQA 2YYRA 3N9QA 4S3OB 4AUQB 3SOUA 1WEMA 3O35A 5B79A 4I7BA 2LV9A 1IYMA 2KWKA 2YQMA 2VP7A 1F62A 2Y1MA 1WEVA 5TABA 4NN2A 4BBQA 5KH3A 4C9ZA 5LCWB 5G04B 2Y1NA 3ZNIA 2K4DA 2F42A 5B76A 2L75A 5TRBA 2G45A 3PHDA 2MT5A 3QZVA 4F52B 2KWOA 5TDWA 2ECJA 2CSZA 3L11A 2YHNA 2JMIA 4QF2A 2DX8A 4PTBA 4UP5A 2L43A 4IC3A 4FO9A 2D8SA 5J3XA 3MHHA 2XB1A 1X4JA 3C5KA 2M3HA 4AVXA 4R8PK 2LGGA 2MUMA 4L58A 4N4FA 4L7XA 5H1VA 2RSDA 1LDKC 3ZYQA 2FSAA 1E4UA 1WFKA 2LQ6A 4ZDTA 2VJEB 2JMJA 4I7DA 1Z6UA 2LDRA 3ZPVE 1X4UA 5LKTA 4AYCB 3O33A 2VNFA 2YURA 4GNFA 2LGLA 1FP0A 4A4CA 5H9MA 5I3LA 2ECNA 4UP0A 3ZPV1 3C6WA 4WZ0A 2G43A 2MIQA 5B75A 4R7EA 2LGKA 2CKLB 3RPGC 3O7AA 3M63A 4YABA 3LQJA 5AIUA 3U5NA 2RI7A 4MVTA 3U5OA 3ASLA 3HCTA 2YREA 2YUCA 4W4UA 4UI9B 2YSMA 3NG2A 1WILA 5KH9A 2ECGA 2FUIA 2KIZA 5FB1A 2PUYA 1WENA 1FBVA 4GB0A 3L1ZB 2CT2A 4WZ2A 3GV4A 4GNDA 4LADB 4ZQLA 2ZETC 4V3LC 1WEOA 1JM7A 4BHWA 3SHBA 3DQVR 3LQIA 4MSXA 4X3GA 4QF3A 4S3OC 1Z2QA 5AITA 2OXQC 1WESA 2LGVA 1JOCA 2QIZA 4LLBA 2HDPA 2G6QA 1G25A 1WEEA 4ZUXU 4LK9A 5KH7A 5G05B 4YBMA 2EGPA 4LKAA 2LXPC 2YQLA 1WGMA 4A4BA 2K16A 2MA5A 3M99A 2L80A 5DINA 2MD7B 2KGGA 1MM2A 1HYIA 4GNGA 1MM3A 3T6RA 2BAYA 2C2VS 3N9MA 3GL6A 1K2FA 3I2DA 2CSYA 4IC2A 5C13A 4YC9A 4YBSA 2KREA 2VJFA 5G0FA 2L0BA 2H0DA 4LJNA 2KU3A 5LKUA 3N9PA 2ECWA 4R2YA 3N9LA 2M6MA 2MA6A 4WA6A 1BORA 3LQHA 2VJEA 3HCSA 1WEQA 3O34A 1DVPA 5FEYA 2ECTA 2LRIC 4AP4A 4Q6FA 3ZVZB 2PNXA 3RPGB 2YT5A 4CCGX 5LKXA 3HTKC 2E6RA 2E6SA 2QJ0A 5DKAA 3DPLR 4A49A 4YATA 3O70A 2EODA 5D1LB 4XI1A 3KV5A 2I50A 1WEUA 3KV6A 3ZTGA 4YADA 3U5MA 5D1MB 4N3WA 1ZBDB 2VPEA 2C2LA 2K17A 2KWNA 5B8DA 1N87A 3IHPA 3HCUA 2MD8C 3L1XA 1Z60A 2F6JA 2EA6A 4YBTA 5B78A 4V3KC 2VPGA 4TKPB 4FJCA 3V43A 2XEUA 1RMDA 2AN6A 3PURA 1WEPA 3FL2A 2ECVA 4FIPA
chains in the Genus database with same CATH superfamily
3MHSA 1XWHA 3N9OA 5FERA 2UZGA 2LN0A 5D1KB 3LRQA 2XOZA 4GNEA 3ZVYA 1V87A 4Z0OA 3M62A 3VK6A 2VPBA 2JM3A 3KNVA 3O36A 5SVYA 4I7CA 4F1PA 3T7LA 2VPDA 2Y43A 3EB5A 3O37A 2OWAA 3SOXA 1HYJA 1U6GB 1LDJB 4P5OB 3SOWA 2HYED 2VJFB 4B86C 5TDRA 2EXUA 2H0DB 3PLWA 2YU4A 2ECIA 4O64A 5H1UA 2NAAA 2K1JA 2KFTA 2MNZA 4A0CD 4YAXA 2KR4A 3U5PA 2JRJA 3JUEA 4FK5A 4AYCA 2FUUA 3N9NA 2JMDA 2DSMA 2IDAA 2XOCA 3KQIA 3EB6A 5EYAF 1T1HA 4CA1A 5JG6A 2LXHC 1WIMA 1CHCA 2YSJA 2M1RA 4B7YC 2CKLA 5C11A 3RTRB 2KYUA 2KWJA 1VFYA 5TBNA 1WEWA 5FB0A 1WE9A 3MDBC 1VD4A 2CSVA 2YW8A 5H1TA 2KE1A 4PPEA 4WZ3B 2F6NA 5SVIA 5B77A 2QICA 1MBMA 1VYXA 2KGIA 2MNYA 2M85A 2YHOA 1X4IA 2L5UA 5LKZA 1JM7B 3PUQA 3LVRE 2YYRA 2JUNA 3N9QA 4S3OB 4AUQB 2LAUA 2CONA 3SOUA 1WEMA 3O35A 2L7PA 5B79A 4I7BA 2LV9A 1IYMA 2KWKA 2YQMA 2VP7A 1F62A 2Y1MA 1WEVA 5TABA 4NN2A 4BBQA 5KH3A 4C9ZA 5LCWB 5G04B 2Y1NA 3ZNIA 2K4DA 2F42A 5B76A 2KKYA 2L75A 2YVRA 5TRBA 2G45A 2E61A 3PHDA 2MT5A 3QZVA 4F52B 2KWOA 5TDWA 2ECJA 2CSZA 3L11A 3T9KA 2YHNA 3DDTA 2JMIA 4QF2A 2DX8A 4PTBA 3E2DA 4UP5A 2L43A 4IC3A 4FO9A 2D8SA 5J3XA 3MHHA 2XB1A 1X4JA 3C5KA 2D8UA 2M3HA 4AVXA 2FD4A 4R8PK 2LGGA 2MUMA 4L58A 4N4FA 4L7XA 5H1VA 2RSDA 1LDKC 3ZYQA 2FSAA 1E4UA 1WFKA 2LQ6A 4ZDTA 2VJEB 2JMJA 4I7DA 1Z6UA 2LDRA 3ZPVE 1X4UA 5LKTA 4AYCB 3O33A 3M7KA 2VNFA 2YURA 4GNFA 2LGLA 1FP0A 4A4CA 5H9MA 5I3LA 2ECNA 4UP0A 3ZPV1 3C6WA 4WZ0A 2G43A 2MIQA 5B75A 4R7EA 4QQ4A 1DCQA 2LGKA 2CKLB 2B0OE 3RPGC 3O7AA 3M63A 4YABA 3LQJA 5AIUA 3U5NA 2RI7A 4MVTA 3U5OA 2M13A 3ASLA 3HCTA 2YREA 2YUCA 4W4UA 4UI9B 2YSMA 3NG2A 1WILA 5KH9A 2ECGA 5SVIB 2FUIA 2KIZA 5FB1A 2PUYA 1WENA 1FBVA 4GB0A 2EGMA 2FFWA 3L1ZB 5K3QA 2CT2A 4WZ2A 3GV4A 4GNDA 4LADB 4ZQLA 2ZETC 4V3LC 1WEOA 1JM7A 4BHWA 3SHBA 3DQVR 3LQIA 4MSXA 4X3GA 4QF3A 4S3OC 1Z2QA 5AITA 2OXQC 1WESA 5SVXA 2LGVA 1JOCA 2CRWA 2QIZA 4LLBA 2HDPA 3FJUB 2G6QA 3FANA 1G25A 1WEEA 4ZUXU 4LK9A 5KH7A 3KDEC 5G05B 4YBMA 2EGPA 4LKAA 2LXPC 2YQLA 1WGMA 4A4BA 2K16A 2MA5A 3M99A 2L80A 5DINA 2MD7B 2KGGA 1MM2A 1HYIA 4GNGA 4OGCA 1MM3A 3T6RA 2BAYA 2C2VS 2DJAA 3N9MA 3GL6A 1K2FA 3I2DA 2CSYA 4IC2A 5C13A 4YC9A 4YBSA 2KREA 2VJFA 5G0FA 2L0BA 2H0DA 4LJNA 3FM8C 2KU3A 5LKUA 3N9PA 2ECWA 4R2YA 3N9LA 2MKEA 2M6MA 2MA6A 4WA6A 1BORA 3LQHA 2VJEA 3HCSA 3LVQE 1WEQA 3LJUX 3O34A 1DVPA 5FEYA 3FEHA 2ECTA 2LRIC 4AP4A 4Q6FA 3ZVZB 3Q1DA 2PNXA 3RPGB 2YT5A 3O47A 4CCGX 5LKXA 3HTKC 2E6RA 3FAOA 2E6SA 2QJ0A 5DKAA 3DPLR 4A49A 4O62A 4YATA 3O70A 2EODA 5D1LB 2IQJA 4XI1A 3KV5A 2I50A 4OGEA 1WEUA 3KV6A 3ZTGA 4YADA 3U5MA 2XP0A 5D1MB 4N3WA 1ZBDB 2VPEA 2C2LA 2K17A 2KWNA 5B8DA 1N87A 3IHPA 2CRRA 3HCUA 2MD8C 3L1XA 3SUBA 2P57A 1Z60A 2F6JA 2EA6A 4YBTA 3H7HA 3DWDA 5B78A 4V3KC 2VPGA 4TKPB 4FJCA 3LDYA 3V43A 2XEUA 1RMDA 2AN6A 2KKXA 3PURA 1WEPA 3FL2A 4H9DA 4Z0RA 2ECVA 2RR4A 2XOYA 4FIPA
chains in the Genus database with same CATH topology
3MHSA 1XWHA 3N9OA 5FERA 2UZGA 2LN0A 5D1KB 3LRQA 3ZVYA 4GNEA 1V87A 3M62A 3VK6A 2VPBA 3KNVA 3O36A 4I7CA 3T7LA 2VPDA 2Y43A 3EB5A 3O37A 3SOXA 1HYJA 1U6GB 1LDJB 4P5OB 3SOWA 2HYED 2VJFB 4B86C 5TDRA 2H0DB 2YU4A 2ECIA 4O64A 5H1UA 2NAAA 2K1JA 2KFTA 2MNZA 4A0CD 4YAXA 2KR4A 3U5PA 2JRJA 4FK5A 4AYCA 2FUUA 3N9NA 2JMDA 2IDAA 3KQIA 3EB6A 5EYAF 1T1HA 4CA1A 5JG6A 2LXHC 1WIMA 1CHCA 2YSJA 2M1RA 4B7YC 2CKLA 5C11A 3RTRB 2KYUA 2KWJA 1VFYA 5TBNA 1WEWA 5FB0A 1WE9A 1VD4A 2YW8A 5H1TA 2KE1A 4PPEA 4WZ3B 2F6NA 5B77A 2QICA 1VYXA 2KGIA 2MNYA 2M85A 2YHOA 1X4IA 2L5UA 5LKZA 1JM7B 3PUQA 2YYRA 3N9QA 4S3OB 4AUQB 3SOUA 1WEMA 3O35A 5B79A 4I7BA 2LV9A 1IYMA 2KWKA 2YQMA 2VP7A 1F62A 2Y1MA 1WEVA 5TABA 4NN2A 4BBQA 5KH3A 4C9ZA 5LCWB 5G04B 2Y1NA 3ZNIA 2K4DA 2F42A 5B76A 2L75A 5TRBA 2G45A 3PHDA 2MT5A 3QZVA 4F52B 2KWOA 5TDWA 2ECJA 2CSZA 3L11A 2YHNA 2JMIA 4QF2A 2DX8A 4PTBA 4UP5A 2L43A 4IC3A 4FO9A 2D8SA 5J3XA 3MHHA 2XB1A 1X4JA 3C5KA 2M3HA 4AVXA 4R8PK 2LGGA 2MUMA 4L58A 4N4FA 4L7XA 5H1VA 2RSDA 1LDKC 3ZYQA 2FSAA 1E4UA 1WFKA 2LQ6A 4ZDTA 2VJEB 2JMJA 4I7DA 1Z6UA 2LDRA 3ZPVE 1X4UA 5LKTA 4AYCB 3O33A 2VNFA 2YURA 4GNFA 2LGLA 1FP0A 4A4CA 5H9MA 5I3LA 2ECNA 4UP0A 3ZPV1 3C6WA 4WZ0A 2G43A 2MIQA 5B75A 4R7EA 2LGKA 2CKLB 3RPGC 3O7AA 3M63A 4YABA 3LQJA 5AIUA 3U5NA 2RI7A 4MVTA 3U5OA 3ASLA 3HCTA 2YREA 2YUCA 4W4UA 4UI9B 2YSMA 3NG2A 1WILA 5KH9A 2ECGA 2FUIA 2KIZA 5FB1A 2PUYA 1WENA 1FBVA 4GB0A 3L1ZB 2CT2A 4WZ2A 3GV4A 4GNDA 4LADB 4ZQLA 2ZETC 4V3LC 1WEOA 1JM7A 4BHWA 3SHBA 3DQVR 3LQIA 4MSXA 4X3GA 4QF3A 4S3OC 1Z2QA 5AITA 2OXQC 1WESA 2LGVA 1JOCA 2QIZA 4LLBA 2HDPA 2G6QA 1G25A 1WEEA 4ZUXU 4LK9A 5KH7A 5G05B 4YBMA 2EGPA 4LKAA 2LXPC 2YQLA 1WGMA 4A4BA 2K16A 2MA5A 3M99A 2L80A 5DINA 2MD7B 2KGGA 1MM2A 1HYIA 4GNGA 1MM3A 3T6RA 2BAYA 2C2VS 3N9MA 3GL6A 1K2FA 3I2DA 2CSYA 4IC2A 5C13A 4YC9A 4YBSA 2KREA 2VJFA 5G0FA 2L0BA 2H0DA 4LJNA 2KU3A 5LKUA 3N9PA 2ECWA 4R2YA 3N9LA 2M6MA 2MA6A 4WA6A 1BORA 3LQHA 2VJEA 3HCSA 1WEQA 3O34A 1DVPA 5FEYA 2ECTA 2LRIC 4AP4A 4Q6FA 3ZVZB 2PNXA 3RPGB 2YT5A 4CCGX 5LKXA 3HTKC 2E6RA 2E6SA 2QJ0A 5DKAA 3DPLR 4A49A 4YATA 3O70A 2EODA 5D1LB 4XI1A 3KV5A 2I50A 1WEUA 3KV6A 3ZTGA 4YADA 3U5MA 5D1MB 4N3WA 1ZBDB 2VPEA 2C2LA 2K17A 2KWNA 5B8DA 1N87A 3IHPA 3HCUA 2MD8C 3L1XA 1Z60A 2F6JA 2EA6A 4YBTA 5B78A 4V3KC 2VPGA 4TKPB 4FJCA 3V43A 2XEUA 1RMDA 2AN6A 3PURA 1WEPA 3FL2A 2ECVA 4FIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS A;  1XWH A;  3N9O A;  5FER A;  2UZG A;  2LN0 A;  5D1K B;  3LRQ A;  3ZVY A;  4GNE A;  1V87 A;  3M62 A;  3VK6 A;  2VPB A;  3KNV A;  3O36 A;  4I7C A;  3T7L A;  2VPD A;  2Y43 A;  3EB5 A;  3O37 A;  3SOX A;  1HYJ A;  1U6G B;  1LDJ B;  4P5O B;  3SOW A;  2HYE D;  2VJF B;  4B86 C;  5TDR A;  2H0D B;  2YU4 A;  2ECI A;  4O64 A;  5H1U A;  2NAA A;  2K1J A;  2KFT A;  2MNZ A;  4A0C D;  4YAX A;  2KR4 A;  3U5P A;  2JRJ A;  4FK5 A;  4AYC A;  2FUU A;  3N9N A;  2JMD A;  2IDA A;  3KQI A;  3EB6 A;  5EYA F;  1T1H A;  4CA1 A;  5JG6 A;  2LXH C;  1WIM A;  1CHC A;  2YSJ A;  2M1R A;  4B7Y C;  2CKL A;  5C11 A;  3RTR B;  2KYU A;  2KWJ A;  1VFY A;  5TBN A;  1WEW A;  5FB0 A;  1WE9 A;  1VD4 A;  2YW8 A;  5H1T A;  2KE1 A;  4PPE A;  4WZ3 B;  2F6N A;  5B77 A;  2QIC A;  1VYX A;  2KGI A;  2MNY A;  2M85 A;  2YHO A;  1X4I A;  2L5U A;  5LKZ A;  1JM7 B;  3PUQ A;  2YYR A;  3N9Q A;  4S3O B;  4AUQ B;  3SOU A;  1WEM A;  3O35 A;  5B79 A;  4I7B A;  2LV9 A;  1IYM A;  2KWK A;  2YQM A;  2VP7 A;  1F62 A;  2Y1M A;  1WEV A;  5TAB A;  4NN2 A;  4BBQ A;  5KH3 A;  4C9Z A;  5LCW B;  5G04 B;  2Y1N A;  3ZNI A;  2K4D A;  2F42 A;  5B76 A;  2L75 A;  5TRB A;  2G45 A;  3PHD A;  2MT5 A;  3QZV A;  4F52 B;  2KWO A;  5TDW A;  2ECJ A;  2CSZ A;  3L11 A;  2YHN A;  2JMI A;  4QF2 A;  2DX8 A;  4PTB A;  4UP5 A;  2L43 A;  4IC3 A;  4FO9 A;  2D8S A;  5J3X A;  3MHH A;  2XB1 A;  1X4J A;  3C5K A;  2M3H A;  4AVX A;  4R8P K;  2LGG A;  2MUM A;  4L58 A;  4N4F A;  4L7X A;  5H1V A;  2RSD A;  1LDK C;  3ZYQ A;  2FSA A;  1E4U A;  1WFK A;  2LQ6 A;  4ZDT A;  2VJE B;  2JMJ A;  4I7D A;  1Z6U A;  2LDR A;  3ZPV E;  1X4U A;  5LKT A;  4AYC B;  3O33 A;  2VNF A;  2YUR A;  4GNF A;  2LGL A;  1FP0 A;  4A4C A;  5H9M A;  5I3L A;  2ECN A;  4UP0 A;  3ZPV 1;  3C6W A;  4WZ0 A;  2G43 A;  2MIQ A;  5B75 A;  4R7E A;  2LGK A;  2CKL B;  3RPG C;  3O7A A;  3M63 A;  4YAB A;  3LQJ A;  5AIU A;  3U5N A;  2RI7 A;  4MVT A;  3U5O A;  3ASL A;  3HCT A;  2YRE A;  2YUC A;  4W4U A;  4UI9 B;  2YSM A;  3NG2 A;  1WIL A;  5KH9 A;  2ECG A;  2FUI A;  2KIZ A;  5FB1 A;  2PUY A;  1WEN A;  1FBV A;  4GB0 A;  3L1Z B;  2CT2 A;  4WZ2 A;  3GV4 A;  4GND A;  4LAD B;  4ZQL A;  2ZET C;  4V3L C;  1WEO A;  1JM7 A;  4BHW A;  3SHB A;  3DQV R;  3LQI A;  4MSX A;  4X3G A;  4QF3 A;  4S3O C;  1Z2Q A;  5AIT A;  2OXQ C;  1WES A;  2LGV A;  1JOC A;  2QIZ A;  4LLB A;  2HDP A;  2G6Q A;  1G25 A;  1WEE A;  4ZUX U;  4LK9 A;  5KH7 A;  5G05 B;  4YBM A;  2EGP A;  4LKA A;  2LXP C;  2YQL A;  1WGM A;  4A4B A;  2K16 A;  2MA5 A;  3M99 A;  2L80 A;  5DIN A;  2MD7 B;  2KGG A;  1MM2 A;  1HYI A;  4GNG A;  1MM3 A;  3T6R A;  2BAY A;  2C2V S;  3N9M A;  3GL6 A;  1K2F A;  3I2D A;  2CSY A;  4IC2 A;  5C13 A;  4YC9 A;  4YBS A;  2KRE A;  2VJF A;  5G0F A;  2L0B A;  2H0D A;  4LJN A;  2KU3 A;  5LKU A;  3N9P A;  2ECW A;  4R2Y A;  3N9L A;  2M6M A;  2MA6 A;  4WA6 A;  1BOR A;  3LQH A;  2VJE A;  3HCS A;  1WEQ A;  3O34 A;  1DVP A;  5FEY A;  2ECT A;  2LRI C;  4AP4 A;  4Q6F A;  3ZVZ B;  2PNX A;  3RPG B;  2YT5 A;  4CCG X;  5LKX A;  3HTK C;  2E6R A;  2E6S A;  2QJ0 A;  5DKA A;  3DPL R;  4A49 A;  4YAT A;  3O70 A;  2EOD A;  5D1L B;  4XI1 A;  3KV5 A;  2I50 A;  1WEU A;  3KV6 A;  3ZTG A;  4YAD A;  3U5M A;  5D1M B;  4N3W A;  1ZBD B;  2VPE A;  2C2L A;  2K17 A;  2KWN A;  5B8D A;  1N87 A;  3IHP A;  3HCU A;  2MD8 C;  3L1X A;  1Z60 A;  2F6J A;  2EA6 A;  4YBT A;  5B78 A;  4V3K C;  2VPG A;  4TKP B;  4FJC A;  3V43 A;  2XEU A;  1RMD A;  2AN6 A;  3PUR A;  1WEP A;  3FL2 A;  2ECV A;  4FIP A; 
#chains in the Genus database with same CATH topology
 3MHS A;  1XWH A;  3N9O A;  5FER A;  2UZG A;  2LN0 A;  5D1K B;  3LRQ A;  2XOZ A;  4GNE A;  3ZVY A;  1V87 A;  4Z0O A;  3M62 A;  3VK6 A;  2VPB A;  2JM3 A;  3KNV A;  3O36 A;  5SVY A;  4I7C A;  4F1P A;  3T7L A;  2VPD A;  2Y43 A;  3EB5 A;  3O37 A;  2OWA A;  3SOX A;  1HYJ A;  1U6G B;  1LDJ B;  4P5O B;  3SOW A;  2HYE D;  2VJF B;  4B86 C;  5TDR A;  2EXU A;  2H0D B;  3PLW A;  2YU4 A;  2ECI A;  4O64 A;  5H1U A;  2NAA A;  2K1J A;  2KFT A;  2MNZ A;  4A0C D;  4YAX A;  2KR4 A;  3U5P A;  2JRJ A;  3JUE A;  4FK5 A;  4AYC A;  2FUU A;  3N9N A;  2JMD A;  2DSM A;  2IDA A;  2XOC A;  3KQI A;  3EB6 A;  5EYA F;  1T1H A;  4CA1 A;  5JG6 A;  2LXH C;  1WIM A;  1CHC A;  2YSJ A;  2M1R A;  4B7Y C;  2CKL A;  5C11 A;  3RTR B;  2KYU A;  2KWJ A;  1VFY A;  5TBN A;  1WEW A;  5FB0 A;  1WE9 A;  3MDB C;  1VD4 A;  2CSV A;  2YW8 A;  5H1T A;  2KE1 A;  4PPE A;  4WZ3 B;  2F6N A;  5SVI A;  5B77 A;  2QIC A;  1MBM A;  1VYX A;  2KGI A;  2MNY A;  2M85 A;  2YHO A;  1X4I A;  2L5U A;  5LKZ A;  1JM7 B;  3PUQ A;  3LVR E;  2YYR A;  2JUN A;  3N9Q A;  4S3O B;  4AUQ B;  2LAU A;  2CON A;  3SOU A;  1WEM A;  3O35 A;  2L7P A;  5B79 A;  4I7B A;  2LV9 A;  1IYM A;  2KWK A;  2YQM A;  2VP7 A;  1F62 A;  2Y1M A;  1WEV A;  5TAB A;  4NN2 A;  4BBQ A;  5KH3 A;  4C9Z A;  5LCW B;  5G04 B;  2Y1N A;  3ZNI A;  2K4D A;  2F42 A;  5B76 A;  2KKY A;  2L75 A;  2YVR A;  5TRB A;  2G45 A;  2E61 A;  3PHD A;  2MT5 A;  3QZV A;  4F52 B;  2KWO A;  5TDW A;  2ECJ A;  2CSZ A;  3L11 A;  3T9K A;  2YHN A;  3DDT A;  2JMI A;  4QF2 A;  2DX8 A;  4PTB A;  3E2D A;  4UP5 A;  2L43 A;  4IC3 A;  4FO9 A;  2D8S A;  5J3X A;  3MHH A;  2XB1 A;  1X4J A;  3C5K A;  2D8U A;  2M3H A;  4AVX A;  2FD4 A;  4R8P K;  2LGG A;  2MUM A;  4L58 A;  4N4F A;  4L7X A;  5H1V A;  2RSD A;  1LDK C;  3ZYQ A;  2FSA A;  1E4U A;  1WFK A;  2LQ6 A;  4ZDT A;  2VJE B;  2JMJ A;  4I7D A;  1Z6U A;  2LDR A;  3ZPV E;  1X4U A;  5LKT A;  4AYC B;  3O33 A;  3M7K A;  2VNF A;  2YUR A;  4GNF A;  2LGL A;  1FP0 A;  4A4C A;  5H9M A;  5I3L A;  2ECN A;  4UP0 A;  3ZPV 1;  3C6W A;  4WZ0 A;  2G43 A;  2MIQ A;  5B75 A;  4R7E A;  4QQ4 A;  1DCQ A;  2LGK A;  2CKL B;  2B0O E;  3RPG C;  3O7A A;  3M63 A;  4YAB A;  3LQJ A;  5AIU A;  3U5N A;  2RI7 A;  4MVT A;  3U5O A;  2M13 A;  3ASL A;  3HCT A;  2YRE A;  2YUC A;  4W4U A;  4UI9 B;  2YSM A;  3NG2 A;  1WIL A;  5KH9 A;  2ECG A;  5SVI B;  2FUI A;  2KIZ A;  5FB1 A;  2PUY A;  1WEN A;  1FBV A;  4GB0 A;  2EGM A;  2FFW A;  3L1Z B;  5K3Q A;  2CT2 A;  4WZ2 A;  3GV4 A;  4GND A;  4LAD B;  4ZQL A;  2ZET C;  4V3L C;  1WEO A;  1JM7 A;  4BHW A;  3SHB A;  3DQV R;  3LQI A;  4MSX A;  4X3G A;  4QF3 A;  4S3O C;  1Z2Q A;  5AIT A;  2OXQ C;  1WES A;  5SVX A;  2LGV A;  1JOC A;  2CRW A;  2QIZ A;  4LLB A;  2HDP A;  3FJU B;  2G6Q A;  3FAN A;  1G25 A;  1WEE A;  4ZUX U;  4LK9 A;  5KH7 A;  3KDE C;  5G05 B;  4YBM A;  2EGP A;  4LKA A;  2LXP C;  2YQL A;  1WGM A;  4A4B A;  2K16 A;  2MA5 A;  3M99 A;  2L80 A;  5DIN A;  2MD7 B;  2KGG A;  1MM2 A;  1HYI A;  4GNG A;  4OGC A;  1MM3 A;  3T6R A;  2BAY A;  2C2V S;  2DJA A;  3N9M A;  3GL6 A;  1K2F A;  3I2D A;  2CSY A;  4IC2 A;  5C13 A;  4YC9 A;  4YBS A;  2KRE A;  2VJF A;  5G0F A;  2L0B A;  2H0D A;  4LJN A;  3FM8 C;  2KU3 A;  5LKU A;  3N9P A;  2ECW A;  4R2Y A;  3N9L A;  2MKE A;  2M6M A;  2MA6 A;  4WA6 A;  1BOR A;  3LQH A;  2VJE A;  3HCS A;  3LVQ E;  1WEQ A;  3LJU X;  3O34 A;  1DVP A;  5FEY A;  3FEH A;  2ECT A;  2LRI C;  4AP4 A;  4Q6F A;  3ZVZ B;  3Q1D A;  2PNX A;  3RPG B;  2YT5 A;  3O47 A;  4CCG X;  5LKX A;  3HTK C;  2E6R A;  3FAO A;  2E6S A;  2QJ0 A;  5DKA A;  3DPL R;  4A49 A;  4O62 A;  4YAT A;  3O70 A;  2EOD A;  5D1L B;  2IQJ A;  4XI1 A;  3KV5 A;  2I50 A;  4OGE A;  1WEU A;  3KV6 A;  3ZTG A;  4YAD A;  3U5M A;  2XP0 A;  5D1M B;  4N3W A;  1ZBD B;  2VPE A;  2C2L A;  2K17 A;  2KWN A;  5B8D A;  1N87 A;  3IHP A;  2CRR A;  3HCU A;  2MD8 C;  3L1X A;  3SUB A;  2P57 A;  1Z60 A;  2F6J A;  2EA6 A;  4YBT A;  3H7H A;  3DWD A;  5B78 A;  4V3K C;  2VPG A;  4TKP B;  4FJC A;  3LDY A;  3V43 A;  2XEU A;  1RMD A;  2AN6 A;  2KKX A;  3PUR A;  1WEP A;  3FL2 A;  4H9D A;  4Z0R A;  2ECV A;  2RR4 A;  2XOY A;  4FIP A; 
#chains in the Genus database with same CATH homology
 3MHS A;  1XWH A;  3N9O A;  5FER A;  2UZG A;  2LN0 A;  5D1K B;  3LRQ A;  3ZVY A;  4GNE A;  1V87 A;  3M62 A;  3VK6 A;  2VPB A;  3KNV A;  3O36 A;  4I7C A;  3T7L A;  2VPD A;  2Y43 A;  3EB5 A;  3O37 A;  3SOX A;  1HYJ A;  1U6G B;  1LDJ B;  4P5O B;  3SOW A;  2HYE D;  2VJF B;  4B86 C;  5TDR A;  2H0D B;  2YU4 A;  2ECI A;  4O64 A;  5H1U A;  2NAA A;  2K1J A;  2KFT A;  2MNZ A;  4A0C D;  4YAX A;  2KR4 A;  3U5P A;  2JRJ A;  4FK5 A;  4AYC A;  2FUU A;  3N9N A;  2JMD A;  2IDA A;  3KQI A;  3EB6 A;  5EYA F;  1T1H A;  4CA1 A;  5JG6 A;  2LXH C;  1WIM A;  1CHC A;  2YSJ A;  2M1R A;  4B7Y C;  2CKL A;  5C11 A;  3RTR B;  2KYU A;  2KWJ A;  1VFY A;  5TBN A;  1WEW A;  5FB0 A;  1WE9 A;  1VD4 A;  2YW8 A;  5H1T A;  2KE1 A;  4PPE A;  4WZ3 B;  2F6N A;  5B77 A;  2QIC A;  1VYX A;  2KGI A;  2MNY A;  2M85 A;  2YHO A;  1X4I A;  2L5U A;  5LKZ A;  1JM7 B;  3PUQ A;  2YYR A;  3N9Q A;  4S3O B;  4AUQ B;  3SOU A;  1WEM A;  3O35 A;  5B79 A;  4I7B A;  2LV9 A;  1IYM A;  2KWK A;  2YQM A;  2VP7 A;  1F62 A;  2Y1M A;  1WEV A;  5TAB A;  4NN2 A;  4BBQ A;  5KH3 A;  4C9Z A;  5LCW B;  5G04 B;  2Y1N A;  3ZNI A;  2K4D A;  2F42 A;  5B76 A;  2L75 A;  5TRB A;  2G45 A;  3PHD A;  2MT5 A;  3QZV A;  4F52 B;  2KWO A;  5TDW A;  2ECJ A;  2CSZ A;  3L11 A;  2YHN A;  2JMI A;  4QF2 A;  2DX8 A;  4PTB A;  4UP5 A;  2L43 A;  4IC3 A;  4FO9 A;  2D8S A;  5J3X A;  3MHH A;  2XB1 A;  1X4J A;  3C5K A;  2M3H A;  4AVX A;  4R8P K;  2LGG A;  2MUM A;  4L58 A;  4N4F A;  4L7X A;  5H1V A;  2RSD A;  1LDK C;  3ZYQ A;  2FSA A;  1E4U A;  1WFK A;  2LQ6 A;  4ZDT A;  2VJE B;  2JMJ A;  4I7D A;  1Z6U A;  2LDR A;  3ZPV E;  1X4U A;  5LKT A;  4AYC B;  3O33 A;  2VNF A;  2YUR A;  4GNF A;  2LGL A;  1FP0 A;  4A4C A;  5H9M A;  5I3L A;  2ECN A;  4UP0 A;  3ZPV 1;  3C6W A;  4WZ0 A;  2G43 A;  2MIQ A;  5B75 A;  4R7E A;  2LGK A;  2CKL B;  3RPG C;  3O7A A;  3M63 A;  4YAB A;  3LQJ A;  5AIU A;  3U5N A;  2RI7 A;  4MVT A;  3U5O A;  3ASL A;  3HCT A;  2YRE A;  2YUC A;  4W4U A;  4UI9 B;  2YSM A;  3NG2 A;  1WIL A;  5KH9 A;  2ECG A;  2FUI A;  2KIZ A;  5FB1 A;  2PUY A;  1WEN A;  1FBV A;  4GB0 A;  3L1Z B;  2CT2 A;  4WZ2 A;  3GV4 A;  4GND A;  4LAD B;  4ZQL A;  2ZET C;  4V3L C;  1WEO A;  1JM7 A;  4BHW A;  3SHB A;  3DQV R;  3LQI A;  4MSX A;  4X3G A;  4QF3 A;  4S3O C;  1Z2Q A;  5AIT A;  2OXQ C;  1WES A;  2LGV A;  1JOC A;  2QIZ A;  4LLB A;  2HDP A;  2G6Q A;  1G25 A;  1WEE A;  4ZUX U;  4LK9 A;  5KH7 A;  5G05 B;  4YBM A;  2EGP A;  4LKA A;  2LXP C;  2YQL A;  1WGM A;  4A4B A;  2K16 A;  2MA5 A;  3M99 A;  2L80 A;  5DIN A;  2MD7 B;  2KGG A;  1MM2 A;  1HYI A;  4GNG A;  1MM3 A;  3T6R A;  2BAY A;  2C2V S;  3N9M A;  3GL6 A;  1K2F A;  3I2D A;  2CSY A;  4IC2 A;  5C13 A;  4YC9 A;  4YBS A;  2KRE A;  2VJF A;  5G0F A;  2L0B A;  2H0D A;  4LJN A;  2KU3 A;  5LKU A;  3N9P A;  2ECW A;  4R2Y A;  3N9L A;  2M6M A;  2MA6 A;  4WA6 A;  1BOR A;  3LQH A;  2VJE A;  3HCS A;  1WEQ A;  3O34 A;  1DVP A;  5FEY A;  2ECT A;  2LRI C;  4AP4 A;  4Q6F A;  3ZVZ B;  2PNX A;  3RPG B;  2YT5 A;  4CCG X;  5LKX A;  3HTK C;  2E6R A;  2E6S A;  2QJ0 A;  5DKA A;  3DPL R;  4A49 A;  4YAT A;  3O70 A;  2EOD A;  5D1L B;  4XI1 A;  3KV5 A;  2I50 A;  1WEU A;  3KV6 A;  3ZTG A;  4YAD A;  3U5M A;  5D1M B;  4N3W A;  1ZBD B;  2VPE A;  2C2L A;  2K17 A;  2KWN A;  5B8D A;  1N87 A;  3IHP A;  3HCU A;  2MD8 C;  3L1X A;  1Z60 A;  2F6J A;  2EA6 A;  4YBT A;  5B78 A;  4V3K C;  2VPG A;  4TKP B;  4FJC A;  3V43 A;  2XEU A;  1RMD A;  2AN6 A;  3PUR A;  1WEP A;  3FL2 A;  2ECV A;  4FIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...