5D1MB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (p199a)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
110
Chain Sequence
NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGGVQCAVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D2
total genus 26
structure length 110
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1mB01
3LQIA 1WEQA 2ECWA 4N3WA 3ASLA 2L75A 3ZTGA 2AN6A 3KV5A 5H1TA 4CA1A 1WEEA 3EB5A 5KH9A 3KV6A 2JMDA 3ZVZB 2ECGA 2YQLA 1E4UA 3N9OA 2FSAA 2BAYA 3O37A 5TBNA 2YREA 4LJNA 2C2LA 2K17A 2KWOA 2VJEA 3ZVYA 3O34A 1FP0A 5FERA 4N4FA 4L7XA 4AYCB 2CKLB 1X4UA 2QICA 2ECVA 2JRJA 5JG6A 2M85A 2E6RA 2M3HA 4I7BA 4X3GA 3GV4A 2KGGA 1HYJA 2F6JA 2XEUA 5B8DA 4YC9A 1Z6UA 5B79A 4FJCA 2KU3A 4NN2A 3SOWA 1WESA 1WIMA 2VP7A 4S3OC 3ZPV1 4LADB 3C6WA 4YBTA 4YATA 2EGPA 2YURA 2F6NA 4I7CA 5H1UA 3N9QA 2G45A 4I7DA 3SOUA 2KWJA 2DX8A 2VPDA 2Y1MA 4GNFA 2LQ6A 2KREA 4R8PK 1T1HA 3FL2A 5LKTA 4PTBA 4R7EA 4BHWA 1V87A 4WZ2A 2ZETC 2LRIC 3L1ZB 4IC3A 1WEMA 1FBVA 2VPGA 2CKLA 2QIZA 1WEOA 4WZ3B 5AIUA 3GL6A 3DPLR 1WILA 3ZNIA 4V3KC 2CT2A 1U6GB 2PUYA 2VPEA 4FO9A 2L0BA 1WE9A 5I3LA 5AITA 2L5UA 4GB0A 5TRBA 4LK9A 4UP0A 2MNYA 3U5NA 2LGLA 2E6SA 2JMIA 2M1RA 1X4IA 4FIPA 3KQIA 5G0FA 4IC2A 5D1LB 4MVTA 5LKXA 1MM2A 2YUCA 3N9LA 3HTKC 2KIZA 1JOCA 2LXPC 2K1JA 2L43A 4XI1A 2YT5A 3O70A 4ZUXU 2ECNA 2LGVA 4L58A 3PUQA 2F42A 5KH7A 1XWHA 4ZQLA 1WEWA 2HDPA 5B75A 2LGKA 3HCTA 4P5OB 1WEVA 4MSXA 2ECTA 3N9NA 1VD4A 1Z60A 5FEYA 2G6QA 5TDWA 3U5PA 4PPEA 4GNGA 5G05B 2MA6A 3L11A 4YBSA 2KR4A 2C2VS 3T6RA 5TABA 2H0DB 4YBMA 2M6MA 4AYCA 2IDAA 5H9MA 5TDRA 3N9MA 1DVPA 4LKAA 3EB6A 3IHPA 3I2DA 2YW8A 2LDRA 4WZ0A 4YAXA 1IYMA 1WENA 4FK5A 3SHBA 3LQJA 2ECIA 3O36A 4CCGX 2YYRA 4QF3A 1HYIA 2RSDA 5B78A 5C11A 2G43A 2FUIA 4B86C 2YQMA 5H1VA 2HYED 2YHNA 2JMJA 4AVXA 3MHHA 3RTRB 1WEUA 1WFKA 5LKZA 1BORA 4YADA 1LDKC 2Y1NA 3HCUA 2ECJA 2LGGA 3C5KA 2VJFB 2MNZA 3SOXA 2CSYA 2YSMA 1WEPA 1LDJB 2YHOA 2YSJA 3L1XA 2VPBA 3PURA 4Q6FA 2D8SA 5DINA 2EA6A 4WA6A 4BBQA 2FUUA 2MIQA 4F52B 3N9PA 2KFTA 4UI9B 2QJ0A 3O33A 4O64A 2K4DA 3DQVR 4GNEA 4GNDA 1ZBDB 5D1MB 2K16A 2EODA 4YABA 1JM7B 4AUQB 5DKAA 2MA5A 3KNVA 2MUMA 2LN0A 2PNXA 4QF2A 4W4UA 1VYXA 2LV9A 4C9ZA 2MT5A 3HCSA 2KYUA 5B76A 3NG2A 3MHSA 2LXHC 2OXQC 5FB0A 2KWNA 2KGIA 5KH3A 1X4JA 5G04B 4A0CD 5EYAF 4TKPB 3U5OA 1JM7A 3M99A 3ZPVE 2YU4A 2Y43A 4UP5A 2H0DA 3ZYQA 2VNFA 2CSZA 2UZGA 4B7YC 3T7LA 1VFYA 4A4BA 3O7AA 1G25A 4ZDTA 3VK6A 3LRQA 5LKUA 4A49A 1F62A 1RMDA 1MM3A 2VJEB 3U5MA 1K2FA 4AP4A 3O35A 5B77A 2KWKA 3M62A 2MD8C 2XB1A 1N87A 5LCWB 5D1KB 3M63A 2MD7B 5FB1A 4R2YA 2L80A 5J3XA 4LLBA 2VJFA 2I50A 3RPGC 3RPGB 2KE1A 4S3OB 5C13A 4A4CA 2RI7A 3V43A 1Z2QA 2NAAA 4V3LC 3QZVA 3LQHA 1CHCA 3PHDA 1WGMA
chains in the Genus database with same CATH superfamily
2B0OE 3LQIA 1WEQA 2ECWA 4OGCA 4N3WA 3ASLA 4Z0RA 3LVQE 2L75A 3ZTGA 2AN6A 3KV5A 5H1TA 4CA1A 3MDBC 1WEEA 3EB5A 5KH9A 3KV6A 2JMDA 3ZVZB 2ECGA 5SVIB 2YQLA 1E4UA 3N9OA 2FSAA 3O47A 2BAYA 3O37A 5TBNA 2YREA 4LJNA 2C2LA 2K17A 2KWOA 2VJEA 3ZVYA 3O34A 1FP0A 5FERA 4N4FA 4L7XA 4AYCB 2CKLB 1X4UA 2QICA 2ECVA 2JRJA 5JG6A 2M85A 2E6RA 2M3HA 4I7BA 4X3GA 3GV4A 2KGGA 1HYJA 2F6JA 2XEUA 5B8DA 4YC9A 4QQ4A 1Z6UA 5B79A 4FJCA 2KU3A 4NN2A 3SOWA 1WESA 1WIMA 2RR4A 2VP7A 2EXUA 2L7PA 4S3OC 4LADB 3ZPV1 3C6WA 4YBTA 4YATA 2EGPA 2YURA 2F6NA 4I7CA 5H1UA 2DSMA 3N9QA 2G45A 4I7DA 3SOUA 2KWJA 2DX8A 3FM8C 2VPDA 2Y1MA 4GNFA 2LQ6A 2KREA 4R8PK 5SVXA 1T1HA 3FL2A 5LKTA 4H9DA 2DJAA 4PTBA 4R7EA 3Q1DA 4BHWA 1V87A 4WZ2A 2YVRA 2LRIC 2ZETC 3L1ZB 4IC3A 1WEMA 2FFWA 1FBVA 2VPGA 5K3QA 2CKLA 2QIZA 1WEOA 3DWDA 4WZ3B 5AIUA 3GL6A 3DPLR 1WILA 3ZNIA 4V3KC 2CT2A 1U6GB 3M7KA 2PUYA 2CRRA 2VPEA 4FO9A 2L0BA 1WE9A 5I3LA 5AITA 2L5UA 4GB0A 5TRBA 4LK9A 4UP0A 3LDYA 2MNYA 3E2DA 3U5NA 2EGMA 2LGLA 2E6SA 2JMIA 2M1RA 1X4IA 2XOZA 4FIPA 3KQIA 5G0FA 4IC2A 5D1LB 4MVTA 5LKXA 1MM2A 2YUCA 3N9LA 3FJUB 3HTKC 2KIZA 1JOCA 2M13A 2LXPC 2K1JA 2L43A 4XI1A 2YT5A 3O70A 4ZUXU 2ECNA 2LGVA 5SVYA 4L58A 3PUQA 2F42A 5KH7A 1XWHA 4ZQLA 1WEWA 2HDPA 2LAUA 4Z0OA 5B75A 2LGKA 3HCTA 4P5OB 1WEVA 4MSXA 3T9KA 2ECTA 3N9NA 1VD4A 1Z60A 5FEYA 2G6QA 5TDWA 3U5PA 4PPEA 4GNGA 3LJUX 5G05B 2MA6A 3L11A 4YBSA 2KR4A 2C2VS 3T6RA 5TABA 2H0DB 4YBMA 2M6MA 4F1PA 4AYCA 3FEHA 2IDAA 5H9MA 5TDRA 3N9MA 1DVPA 2JM3A 4LKAA 3EB6A 3IHPA 3I2DA 2YW8A 2LDRA 4WZ0A 4YAXA 1IYMA 1WENA 4FK5A 3SHBA 3LQJA 2ECIA 3O36A 4CCGX 2YYRA 4QF3A 1HYIA 2RSDA 5B78A 5C11A 2G43A 2FUIA 4B86C 2YQMA 5H1VA 2HYED 2YHNA 2JMJA 4AVXA 3MHHA 3RTRB 1WEUA 1WFKA 5LKZA 1BORA 1MBMA 4YADA 1LDKC 2Y1NA 3HCUA 2ECJA 2LGGA 3C5KA 2MKEA 2VJFB 4OGEA 2XOCA 3PLWA 2XOYA 2MNZA 3SOXA 2CSYA 2YSMA 1WEPA 1LDJB 2YHOA 2YSJA 3L1XA 2VPBA 3PURA 4Q6FA 2D8SA 5DINA 2EA6A 4WA6A 4BBQA 3KDEC 2FUUA 2MIQA 1DCQA 2OWAA 4F52B 2CONA 3N9PA 2KFTA 4UI9B 2QJ0A 2FD4A 3O33A 2CSVA 2K4DA 3LVRE 3DQVR 4O64A 4GNEA 4GNDA 1ZBDB 5D1MB 2JUNA 2K16A 2EODA 4YABA 1JM7B 4AUQB 2IQJA 5DKAA 2MA5A 3KNVA 2MUMA 2LN0A 2PNXA 2P57A 4QF2A 4W4UA 1VYXA 2E61A 2KKYA 2LV9A 4C9ZA 3FANA 2MT5A 3HCSA 2KYUA 2D8UA 5B76A 3NG2A 3MHSA 2LXHC 2OXQC 5FB0A 2KWNA 2KGIA 5KH3A 1X4JA 5G04B 4A0CD 5EYAF 4TKPB 2CRWA 3DDTA 3U5OA 1JM7A 3M99A 3ZPVE 2YU4A 2Y43A 4UP5A 2H0DA 3ZYQA 2VNFA 2CSZA 2UZGA 3H7HA 4B7YC 3T7LA 1VFYA 4A4BA 3O7AA 1G25A 3JUEA 4ZDTA 3VK6A 3LRQA 2XP0A 5LKUA 4A49A 1F62A 1RMDA 1MM3A 2VJEB 3U5MA 1K2FA 4AP4A 3O35A 5B77A 2KWKA 3M62A 2MD8C 2XB1A 1N87A 5LCWB 2KKXA 5D1KB 3M63A 2MD7B 5FB1A 4R2YA 3SUBA 4O62A 2L80A 5J3XA 3FAOA 4LLBA 2VJFA 2I50A 3RPGC 5SVIA 3RPGB 2KE1A 4S3OB 5C13A 4A4CA 2RI7A 3V43A 1Z2QA 2NAAA 4V3LC 3QZVA 3LQHA 1CHCA 3PHDA 1WGMA
chains in the Genus database with same CATH topology
3LQIA 1WEQA 2ECWA 4N3WA 3ASLA 2L75A 3ZTGA 2AN6A 3KV5A 5H1TA 4CA1A 1WEEA 3EB5A 5KH9A 3KV6A 2JMDA 3ZVZB 2ECGA 2YQLA 1E4UA 3N9OA 2FSAA 2BAYA 3O37A 5TBNA 2YREA 4LJNA 2C2LA 2K17A 2KWOA 2VJEA 3ZVYA 3O34A 1FP0A 5FERA 4N4FA 4L7XA 4AYCB 2CKLB 1X4UA 2QICA 2ECVA 2JRJA 5JG6A 2M85A 2E6RA 2M3HA 4I7BA 4X3GA 3GV4A 2KGGA 1HYJA 2F6JA 2XEUA 5B8DA 4YC9A 1Z6UA 5B79A 4FJCA 2KU3A 4NN2A 3SOWA 1WESA 1WIMA 2VP7A 4S3OC 3ZPV1 4LADB 3C6WA 4YBTA 4YATA 2EGPA 2YURA 2F6NA 4I7CA 5H1UA 3N9QA 2G45A 4I7DA 3SOUA 2KWJA 2DX8A 2VPDA 2Y1MA 4GNFA 2LQ6A 2KREA 4R8PK 1T1HA 3FL2A 5LKTA 4PTBA 4R7EA 4BHWA 1V87A 4WZ2A 2ZETC 2LRIC 3L1ZB 4IC3A 1WEMA 1FBVA 2VPGA 2CKLA 2QIZA 1WEOA 4WZ3B 5AIUA 3GL6A 3DPLR 1WILA 3ZNIA 4V3KC 2CT2A 1U6GB 2PUYA 2VPEA 4FO9A 2L0BA 1WE9A 5I3LA 5AITA 2L5UA 4GB0A 5TRBA 4LK9A 4UP0A 2MNYA 3U5NA 2LGLA 2E6SA 2JMIA 2M1RA 1X4IA 4FIPA 3KQIA 5G0FA 4IC2A 5D1LB 4MVTA 5LKXA 1MM2A 2YUCA 3N9LA 3HTKC 2KIZA 1JOCA 2LXPC 2K1JA 2L43A 4XI1A 2YT5A 3O70A 4ZUXU 2ECNA 2LGVA 4L58A 3PUQA 2F42A 5KH7A 1XWHA 4ZQLA 1WEWA 2HDPA 5B75A 2LGKA 3HCTA 4P5OB 1WEVA 4MSXA 2ECTA 3N9NA 1VD4A 1Z60A 5FEYA 2G6QA 5TDWA 3U5PA 4PPEA 4GNGA 5G05B 2MA6A 3L11A 4YBSA 2KR4A 2C2VS 3T6RA 5TABA 2H0DB 4YBMA 2M6MA 4AYCA 2IDAA 5H9MA 5TDRA 3N9MA 1DVPA 4LKAA 3EB6A 3IHPA 3I2DA 2YW8A 2LDRA 4WZ0A 4YAXA 1IYMA 1WENA 4FK5A 3SHBA 3LQJA 2ECIA 3O36A 4CCGX 2YYRA 4QF3A 1HYIA 2RSDA 5B78A 5C11A 2G43A 2FUIA 4B86C 2YQMA 5H1VA 2HYED 2YHNA 2JMJA 4AVXA 3MHHA 3RTRB 1WEUA 1WFKA 5LKZA 1BORA 4YADA 1LDKC 2Y1NA 3HCUA 2ECJA 2LGGA 3C5KA 2VJFB 2MNZA 3SOXA 2CSYA 2YSMA 1WEPA 1LDJB 2YHOA 2YSJA 3L1XA 2VPBA 3PURA 4Q6FA 2D8SA 5DINA 2EA6A 4WA6A 4BBQA 2FUUA 2MIQA 4F52B 3N9PA 2KFTA 4UI9B 2QJ0A 3O33A 4O64A 2K4DA 3DQVR 4GNEA 4GNDA 1ZBDB 5D1MB 2K16A 2EODA 4YABA 1JM7B 4AUQB 5DKAA 2MA5A 3KNVA 2MUMA 2LN0A 2PNXA 4QF2A 4W4UA 1VYXA 2LV9A 4C9ZA 2MT5A 3HCSA 2KYUA 5B76A 3NG2A 3MHSA 2LXHC 2OXQC 5FB0A 2KWNA 2KGIA 5KH3A 1X4JA 5G04B 4A0CD 5EYAF 4TKPB 3U5OA 1JM7A 3M99A 3ZPVE 2YU4A 2Y43A 4UP5A 2H0DA 3ZYQA 2VNFA 2CSZA 2UZGA 4B7YC 3T7LA 1VFYA 4A4BA 3O7AA 1G25A 4ZDTA 3VK6A 3LRQA 5LKUA 4A49A 1F62A 1RMDA 1MM3A 2VJEB 3U5MA 1K2FA 4AP4A 3O35A 5B77A 2KWKA 3M62A 2MD8C 2XB1A 1N87A 5LCWB 5D1KB 3M63A 2MD7B 5FB1A 4R2YA 2L80A 5J3XA 4LLBA 2VJFA 2I50A 3RPGC 3RPGB 2KE1A 4S3OB 5C13A 4A4CA 2RI7A 3V43A 1Z2QA 2NAAA 4V3LC 3QZVA 3LQHA 1CHCA 3PHDA 1WGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQI A;  1WEQ A;  2ECW A;  4N3W A;  3ASL A;  2L75 A;  3ZTG A;  2AN6 A;  3KV5 A;  5H1T A;  4CA1 A;  1WEE A;  3EB5 A;  5KH9 A;  3KV6 A;  2JMD A;  3ZVZ B;  2ECG A;  2YQL A;  1E4U A;  3N9O A;  2FSA A;  2BAY A;  3O37 A;  5TBN A;  2YRE A;  4LJN A;  2C2L A;  2K17 A;  2KWO A;  2VJE A;  3ZVY A;  3O34 A;  1FP0 A;  5FER A;  4N4F A;  4L7X A;  4AYC B;  2CKL B;  1X4U A;  2QIC A;  2ECV A;  2JRJ A;  5JG6 A;  2M85 A;  2E6R A;  2M3H A;  4I7B A;  4X3G A;  3GV4 A;  2KGG A;  1HYJ A;  2F6J A;  2XEU A;  5B8D A;  4YC9 A;  1Z6U A;  5B79 A;  4FJC A;  2KU3 A;  4NN2 A;  3SOW A;  1WES A;  1WIM A;  2VP7 A;  4S3O C;  3ZPV 1;  4LAD B;  3C6W A;  4YBT A;  4YAT A;  2EGP A;  2YUR A;  2F6N A;  4I7C A;  5H1U A;  3N9Q A;  2G45 A;  4I7D A;  3SOU A;  2KWJ A;  2DX8 A;  2VPD A;  2Y1M A;  4GNF A;  2LQ6 A;  2KRE A;  4R8P K;  1T1H A;  3FL2 A;  5LKT A;  4PTB A;  4R7E A;  4BHW A;  1V87 A;  4WZ2 A;  2ZET C;  2LRI C;  3L1Z B;  4IC3 A;  1WEM A;  1FBV A;  2VPG A;  2CKL A;  2QIZ A;  1WEO A;  4WZ3 B;  5AIU A;  3GL6 A;  3DPL R;  1WIL A;  3ZNI A;  4V3K C;  2CT2 A;  1U6G B;  2PUY A;  2VPE A;  4FO9 A;  2L0B A;  1WE9 A;  5I3L A;  5AIT A;  2L5U A;  4GB0 A;  5TRB A;  4LK9 A;  4UP0 A;  2MNY A;  3U5N A;  2LGL A;  2E6S A;  2JMI A;  2M1R A;  1X4I A;  4FIP A;  3KQI A;  5G0F A;  4IC2 A;  5D1L B;  4MVT A;  5LKX A;  1MM2 A;  2YUC A;  3N9L A;  3HTK C;  2KIZ A;  1JOC A;  2LXP C;  2K1J A;  2L43 A;  4XI1 A;  2YT5 A;  3O70 A;  4ZUX U;  2ECN A;  2LGV A;  4L58 A;  3PUQ A;  2F42 A;  5KH7 A;  1XWH A;  4ZQL A;  1WEW A;  2HDP A;  5B75 A;  2LGK A;  3HCT A;  4P5O B;  1WEV A;  4MSX A;  2ECT A;  3N9N A;  1VD4 A;  1Z60 A;  5FEY A;  2G6Q A;  5TDW A;  3U5P A;  4PPE A;  4GNG A;  5G05 B;  2MA6 A;  3L11 A;  4YBS A;  2KR4 A;  2C2V S;  3T6R A;  5TAB A;  2H0D B;  4YBM A;  2M6M A;  4AYC A;  2IDA A;  5H9M A;  5TDR A;  3N9M A;  1DVP A;  4LKA A;  3EB6 A;  3IHP A;  3I2D A;  2YW8 A;  2LDR A;  4WZ0 A;  4YAX A;  1IYM A;  1WEN A;  4FK5 A;  3SHB A;  3LQJ A;  2ECI A;  3O36 A;  4CCG X;  2YYR A;  4QF3 A;  1HYI A;  2RSD A;  5B78 A;  5C11 A;  2G43 A;  2FUI A;  4B86 C;  2YQM A;  5H1V A;  2HYE D;  2YHN A;  2JMJ A;  4AVX A;  3MHH A;  3RTR B;  1WEU A;  1WFK A;  5LKZ A;  1BOR A;  4YAD A;  1LDK C;  2Y1N A;  3HCU A;  2ECJ A;  2LGG A;  3C5K A;  2VJF B;  2MNZ A;  3SOX A;  2CSY A;  2YSM A;  1WEP A;  1LDJ B;  2YHO A;  2YSJ A;  3L1X A;  2VPB A;  3PUR A;  4Q6F A;  2D8S A;  5DIN A;  2EA6 A;  4WA6 A;  4BBQ A;  2FUU A;  2MIQ A;  4F52 B;  3N9P A;  2KFT A;  4UI9 B;  2QJ0 A;  3O33 A;  4O64 A;  2K4D A;  3DQV R;  4GNE A;  4GND A;  1ZBD B;  5D1M B;  2K16 A;  2EOD A;  4YAB A;  1JM7 B;  4AUQ B;  5DKA A;  2MA5 A;  3KNV A;  2MUM A;  2LN0 A;  2PNX A;  4QF2 A;  4W4U A;  1VYX A;  2LV9 A;  4C9Z A;  2MT5 A;  3HCS A;  2KYU A;  5B76 A;  3NG2 A;  3MHS A;  2LXH C;  2OXQ C;  5FB0 A;  2KWN A;  2KGI A;  5KH3 A;  1X4J A;  5G04 B;  4A0C D;  5EYA F;  4TKP B;  3U5O A;  1JM7 A;  3M99 A;  3ZPV E;  2YU4 A;  2Y43 A;  4UP5 A;  2H0D A;  3ZYQ A;  2VNF A;  2CSZ A;  2UZG A;  4B7Y C;  3T7L A;  1VFY A;  4A4B A;  3O7A A;  1G25 A;  4ZDT A;  3VK6 A;  3LRQ A;  5LKU A;  4A49 A;  1F62 A;  1RMD A;  1MM3 A;  2VJE B;  3U5M A;  1K2F A;  4AP4 A;  3O35 A;  5B77 A;  2KWK A;  3M62 A;  2MD8 C;  2XB1 A;  1N87 A;  5LCW B;  5D1K B;  3M63 A;  2MD7 B;  5FB1 A;  4R2Y A;  2L80 A;  5J3X A;  4LLB A;  2VJF A;  2I50 A;  3RPG C;  3RPG B;  2KE1 A;  4S3O B;  5C13 A;  4A4C A;  2RI7 A;  3V43 A;  1Z2Q A;  2NAA A;  4V3L C;  3QZV A;  3LQH A;  1CHC A;  3PHD A;  1WGM A; 
#chains in the Genus database with same CATH topology
 2B0O E;  3LQI A;  1WEQ A;  2ECW A;  4OGC A;  4N3W A;  3ASL A;  4Z0R A;  3LVQ E;  2L75 A;  3ZTG A;  2AN6 A;  3KV5 A;  5H1T A;  4CA1 A;  3MDB C;  1WEE A;  3EB5 A;  5KH9 A;  3KV6 A;  2JMD A;  3ZVZ B;  2ECG A;  5SVI B;  2YQL A;  1E4U A;  3N9O A;  2FSA A;  3O47 A;  2BAY A;  3O37 A;  5TBN A;  2YRE A;  4LJN A;  2C2L A;  2K17 A;  2KWO A;  2VJE A;  3ZVY A;  3O34 A;  1FP0 A;  5FER A;  4N4F A;  4L7X A;  4AYC B;  2CKL B;  1X4U A;  2QIC A;  2ECV A;  2JRJ A;  5JG6 A;  2M85 A;  2E6R A;  2M3H A;  4I7B A;  4X3G A;  3GV4 A;  2KGG A;  1HYJ A;  2F6J A;  2XEU A;  5B8D A;  4YC9 A;  4QQ4 A;  1Z6U A;  5B79 A;  4FJC A;  2KU3 A;  4NN2 A;  3SOW A;  1WES A;  1WIM A;  2RR4 A;  2VP7 A;  2EXU A;  2L7P A;  4S3O C;  4LAD B;  3ZPV 1;  3C6W A;  4YBT A;  4YAT A;  2EGP A;  2YUR A;  2F6N A;  4I7C A;  5H1U A;  2DSM A;  3N9Q A;  2G45 A;  4I7D A;  3SOU A;  2KWJ A;  2DX8 A;  3FM8 C;  2VPD A;  2Y1M A;  4GNF A;  2LQ6 A;  2KRE A;  4R8P K;  5SVX A;  1T1H A;  3FL2 A;  5LKT A;  4H9D A;  2DJA A;  4PTB A;  4R7E A;  3Q1D A;  4BHW A;  1V87 A;  4WZ2 A;  2YVR A;  2LRI C;  2ZET C;  3L1Z B;  4IC3 A;  1WEM A;  2FFW A;  1FBV A;  2VPG A;  5K3Q A;  2CKL A;  2QIZ A;  1WEO A;  3DWD A;  4WZ3 B;  5AIU A;  3GL6 A;  3DPL R;  1WIL A;  3ZNI A;  4V3K C;  2CT2 A;  1U6G B;  3M7K A;  2PUY A;  2CRR A;  2VPE A;  4FO9 A;  2L0B A;  1WE9 A;  5I3L A;  5AIT A;  2L5U A;  4GB0 A;  5TRB A;  4LK9 A;  4UP0 A;  3LDY A;  2MNY A;  3E2D A;  3U5N A;  2EGM A;  2LGL A;  2E6S A;  2JMI A;  2M1R A;  1X4I A;  2XOZ A;  4FIP A;  3KQI A;  5G0F A;  4IC2 A;  5D1L B;  4MVT A;  5LKX A;  1MM2 A;  2YUC A;  3N9L A;  3FJU B;  3HTK C;  2KIZ A;  1JOC A;  2M13 A;  2LXP C;  2K1J A;  2L43 A;  4XI1 A;  2YT5 A;  3O70 A;  4ZUX U;  2ECN A;  2LGV A;  5SVY A;  4L58 A;  3PUQ A;  2F42 A;  5KH7 A;  1XWH A;  4ZQL A;  1WEW A;  2HDP A;  2LAU A;  4Z0O A;  5B75 A;  2LGK A;  3HCT A;  4P5O B;  1WEV A;  4MSX A;  3T9K A;  2ECT A;  3N9N A;  1VD4 A;  1Z60 A;  5FEY A;  2G6Q A;  5TDW A;  3U5P A;  4PPE A;  4GNG A;  3LJU X;  5G05 B;  2MA6 A;  3L11 A;  4YBS A;  2KR4 A;  2C2V S;  3T6R A;  5TAB A;  2H0D B;  4YBM A;  2M6M A;  4F1P A;  4AYC A;  3FEH A;  2IDA A;  5H9M A;  5TDR A;  3N9M A;  1DVP A;  2JM3 A;  4LKA A;  3EB6 A;  3IHP A;  3I2D A;  2YW8 A;  2LDR A;  4WZ0 A;  4YAX A;  1IYM A;  1WEN A;  4FK5 A;  3SHB A;  3LQJ A;  2ECI A;  3O36 A;  4CCG X;  2YYR A;  4QF3 A;  1HYI A;  2RSD A;  5B78 A;  5C11 A;  2G43 A;  2FUI A;  4B86 C;  2YQM A;  5H1V A;  2HYE D;  2YHN A;  2JMJ A;  4AVX A;  3MHH A;  3RTR B;  1WEU A;  1WFK A;  5LKZ A;  1BOR A;  1MBM A;  4YAD A;  1LDK C;  2Y1N A;  3HCU A;  2ECJ A;  2LGG A;  3C5K A;  2MKE A;  2VJF B;  4OGE A;  2XOC A;  3PLW A;  2XOY A;  2MNZ A;  3SOX A;  2CSY A;  2YSM A;  1WEP A;  1LDJ B;  2YHO A;  2YSJ A;  3L1X A;  2VPB A;  3PUR A;  4Q6F A;  2D8S A;  5DIN A;  2EA6 A;  4WA6 A;  4BBQ A;  3KDE C;  2FUU A;  2MIQ A;  1DCQ A;  2OWA A;  4F52 B;  2CON A;  3N9P A;  2KFT A;  4UI9 B;  2QJ0 A;  2FD4 A;  3O33 A;  2CSV A;  2K4D A;  3LVR E;  3DQV R;  4O64 A;  4GNE A;  4GND A;  1ZBD B;  5D1M B;  2JUN A;  2K16 A;  2EOD A;  4YAB A;  1JM7 B;  4AUQ B;  2IQJ A;  5DKA A;  2MA5 A;  3KNV A;  2MUM A;  2LN0 A;  2PNX A;  2P57 A;  4QF2 A;  4W4U A;  1VYX A;  2E61 A;  2KKY A;  2LV9 A;  4C9Z A;  3FAN A;  2MT5 A;  3HCS A;  2KYU A;  2D8U A;  5B76 A;  3NG2 A;  3MHS A;  2LXH C;  2OXQ C;  5FB0 A;  2KWN A;  2KGI A;  5KH3 A;  1X4J A;  5G04 B;  4A0C D;  5EYA F;  4TKP B;  2CRW A;  3DDT A;  3U5O A;  1JM7 A;  3M99 A;  3ZPV E;  2YU4 A;  2Y43 A;  4UP5 A;  2H0D A;  3ZYQ A;  2VNF A;  2CSZ A;  2UZG A;  3H7H A;  4B7Y C;  3T7L A;  1VFY A;  4A4B A;  3O7A A;  1G25 A;  3JUE A;  4ZDT A;  3VK6 A;  3LRQ A;  2XP0 A;  5LKU A;  4A49 A;  1F62 A;  1RMD A;  1MM3 A;  2VJE B;  3U5M A;  1K2F A;  4AP4 A;  3O35 A;  5B77 A;  2KWK A;  3M62 A;  2MD8 C;  2XB1 A;  1N87 A;  5LCW B;  2KKX A;  5D1K B;  3M63 A;  2MD7 B;  5FB1 A;  4R2Y A;  3SUB A;  4O62 A;  2L80 A;  5J3X A;  3FAO A;  4LLB A;  2VJF A;  2I50 A;  3RPG C;  5SVI A;  3RPG B;  2KE1 A;  4S3O B;  5C13 A;  4A4C A;  2RI7 A;  3V43 A;  1Z2Q A;  2NAA A;  4V3L C;  3QZV A;  3LQH A;  1CHC A;  3PHD A;  1WGM A; 
#chains in the Genus database with same CATH homology
 3LQI A;  1WEQ A;  2ECW A;  4N3W A;  3ASL A;  2L75 A;  3ZTG A;  2AN6 A;  3KV5 A;  5H1T A;  4CA1 A;  1WEE A;  3EB5 A;  5KH9 A;  3KV6 A;  2JMD A;  3ZVZ B;  2ECG A;  2YQL A;  1E4U A;  3N9O A;  2FSA A;  2BAY A;  3O37 A;  5TBN A;  2YRE A;  4LJN A;  2C2L A;  2K17 A;  2KWO A;  2VJE A;  3ZVY A;  3O34 A;  1FP0 A;  5FER A;  4N4F A;  4L7X A;  4AYC B;  2CKL B;  1X4U A;  2QIC A;  2ECV A;  2JRJ A;  5JG6 A;  2M85 A;  2E6R A;  2M3H A;  4I7B A;  4X3G A;  3GV4 A;  2KGG A;  1HYJ A;  2F6J A;  2XEU A;  5B8D A;  4YC9 A;  1Z6U A;  5B79 A;  4FJC A;  2KU3 A;  4NN2 A;  3SOW A;  1WES A;  1WIM A;  2VP7 A;  4S3O C;  3ZPV 1;  4LAD B;  3C6W A;  4YBT A;  4YAT A;  2EGP A;  2YUR A;  2F6N A;  4I7C A;  5H1U A;  3N9Q A;  2G45 A;  4I7D A;  3SOU A;  2KWJ A;  2DX8 A;  2VPD A;  2Y1M A;  4GNF A;  2LQ6 A;  2KRE A;  4R8P K;  1T1H A;  3FL2 A;  5LKT A;  4PTB A;  4R7E A;  4BHW A;  1V87 A;  4WZ2 A;  2ZET C;  2LRI C;  3L1Z B;  4IC3 A;  1WEM A;  1FBV A;  2VPG A;  2CKL A;  2QIZ A;  1WEO A;  4WZ3 B;  5AIU A;  3GL6 A;  3DPL R;  1WIL A;  3ZNI A;  4V3K C;  2CT2 A;  1U6G B;  2PUY A;  2VPE A;  4FO9 A;  2L0B A;  1WE9 A;  5I3L A;  5AIT A;  2L5U A;  4GB0 A;  5TRB A;  4LK9 A;  4UP0 A;  2MNY A;  3U5N A;  2LGL A;  2E6S A;  2JMI A;  2M1R A;  1X4I A;  4FIP A;  3KQI A;  5G0F A;  4IC2 A;  5D1L B;  4MVT A;  5LKX A;  1MM2 A;  2YUC A;  3N9L A;  3HTK C;  2KIZ A;  1JOC A;  2LXP C;  2K1J A;  2L43 A;  4XI1 A;  2YT5 A;  3O70 A;  4ZUX U;  2ECN A;  2LGV A;  4L58 A;  3PUQ A;  2F42 A;  5KH7 A;  1XWH A;  4ZQL A;  1WEW A;  2HDP A;  5B75 A;  2LGK A;  3HCT A;  4P5O B;  1WEV A;  4MSX A;  2ECT A;  3N9N A;  1VD4 A;  1Z60 A;  5FEY A;  2G6Q A;  5TDW A;  3U5P A;  4PPE A;  4GNG A;  5G05 B;  2MA6 A;  3L11 A;  4YBS A;  2KR4 A;  2C2V S;  3T6R A;  5TAB A;  2H0D B;  4YBM A;  2M6M A;  4AYC A;  2IDA A;  5H9M A;  5TDR A;  3N9M A;  1DVP A;  4LKA A;  3EB6 A;  3IHP A;  3I2D A;  2YW8 A;  2LDR A;  4WZ0 A;  4YAX A;  1IYM A;  1WEN A;  4FK5 A;  3SHB A;  3LQJ A;  2ECI A;  3O36 A;  4CCG X;  2YYR A;  4QF3 A;  1HYI A;  2RSD A;  5B78 A;  5C11 A;  2G43 A;  2FUI A;  4B86 C;  2YQM A;  5H1V A;  2HYE D;  2YHN A;  2JMJ A;  4AVX A;  3MHH A;  3RTR B;  1WEU A;  1WFK A;  5LKZ A;  1BOR A;  4YAD A;  1LDK C;  2Y1N A;  3HCU A;  2ECJ A;  2LGG A;  3C5K A;  2VJF B;  2MNZ A;  3SOX A;  2CSY A;  2YSM A;  1WEP A;  1LDJ B;  2YHO A;  2YSJ A;  3L1X A;  2VPB A;  3PUR A;  4Q6F A;  2D8S A;  5DIN A;  2EA6 A;  4WA6 A;  4BBQ A;  2FUU A;  2MIQ A;  4F52 B;  3N9P A;  2KFT A;  4UI9 B;  2QJ0 A;  3O33 A;  4O64 A;  2K4D A;  3DQV R;  4GNE A;  4GND A;  1ZBD B;  5D1M B;  2K16 A;  2EOD A;  4YAB A;  1JM7 B;  4AUQ B;  5DKA A;  2MA5 A;  3KNV A;  2MUM A;  2LN0 A;  2PNX A;  4QF2 A;  4W4U A;  1VYX A;  2LV9 A;  4C9Z A;  2MT5 A;  3HCS A;  2KYU A;  5B76 A;  3NG2 A;  3MHS A;  2LXH C;  2OXQ C;  5FB0 A;  2KWN A;  2KGI A;  5KH3 A;  1X4J A;  5G04 B;  4A0C D;  5EYA F;  4TKP B;  3U5O A;  1JM7 A;  3M99 A;  3ZPV E;  2YU4 A;  2Y43 A;  4UP5 A;  2H0D A;  3ZYQ A;  2VNF A;  2CSZ A;  2UZG A;  4B7Y C;  3T7L A;  1VFY A;  4A4B A;  3O7A A;  1G25 A;  4ZDT A;  3VK6 A;  3LRQ A;  5LKU A;  4A49 A;  1F62 A;  1RMD A;  1MM3 A;  2VJE B;  3U5M A;  1K2F A;  4AP4 A;  3O35 A;  5B77 A;  2KWK A;  3M62 A;  2MD8 C;  2XB1 A;  1N87 A;  5LCW B;  5D1K B;  3M63 A;  2MD7 B;  5FB1 A;  4R2Y A;  2L80 A;  5J3X A;  4LLB A;  2VJF A;  2I50 A;  3RPG C;  3RPG B;  2KE1 A;  4S3O B;  5C13 A;  4A4C A;  2RI7 A;  3V43 A;  1Z2Q A;  2NAA A;  4V3L C;  3QZV A;  3LQH A;  1CHC A;  3PHD A;  1WGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...