5D1MB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (p199a)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
110
Chain Sequence
NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGGVQCAVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 110
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1mB01
5C13A 1XWHA 5DINA 3LRQA 4N4FA 5TBNA 2ECTA 3I2DA 1LDKC 1JM7A 2YQLA 4LADB 2L80A 5B79A 4YC9A 2KREA 4I7BA 5FEYA 2F6JA 3DPLR 5KH7A 2YU4A 3O37A 1DVPA 2L0BA 2AN6A 2YREA 3ZPVE 2YSMA 3N9NA 2BAYA 2CKLB 4GNFA 1WILA 1VYXA 3HCSA 4S3OB 4F52B 2QICA 3O36A 2Y1MA 3PUQA 1G25A 4A0CD 5LKZA 2MD8C 4LKAA 2KWJA 3NG2A 3ZVZB 4ZQLA 2FSAA 2DX8A 4GNGA 2MD7B 4S3OC 2K17A 3U5MA 4IC2A 2CSYA 3LQIA 2VP7A 2FUUA 3SOWA 2VPBA 2K1JA 4GB0A 3RPGB 4R7EA 1WENA 2YURA 4LLBA 4B86C 1RMDA 1WESA 3L11A 2ECVA 1WE9A 3N9MA 1T1HA 5C11A 2LQ6A 3SHBA 3DQVR 1VD4A 3O7AA 2YUCA 4WZ3B 2EODA 3RPGC 2RI7A 2LDRA 3U5NA 5TDRA 1IYMA 2G45A 2QJ0A 2KU3A 3V43A 3L1XA 4YBMA 2LGKA 3O34A 3KNVA 1Z60A 2YYRA 2M85A 1JM7B 4P5OB 2LGVA 3O35A 2QIZA 4N3WA 3KV5A 3HTKC 4YBSA 3M63A 1X4IA 2I50A 2KE1A 5I3LA 3GL6A 2Y1NA 5KH3A 3VK6A 2MUMA 4CCGX 2M6MA 4YAXA 1FBVA 5B77A 1X4JA 4A4CA 4FO9A 2FUIA 2LGLA 2YT5A 2NAAA 2VJFA 4NN2A 4LK9A 1WEOA 2KIZA 3ZPV1 4IC3A 2MT5A 1WGMA 2L75A 2H0DA 1E4UA 5TABA 5J3XA 1U6GB 2JMJA 2YQMA 3LQJA 3O33A 2MNZA 2MA5A 3KQIA 3N9QA 1WFKA 3QZVA 5D1LB 1MM2A 4R8PK 3ZTGA 4GNDA 1F62A 4UP5A 3SOXA 3MHSA 4FIPA 5JG6A 2YHNA 5B8DA 5KH9A 1HYIA 2LXPC 2KGGA 2KR4A 2VNFA 2KFTA 5FB0A 4ZUXU 1WEVA 4GNEA 4UI9B 5G04B 5H1UA 3HCUA 3C5KA 4ZDTA 4BBQA 2IDAA 2ECWA 4R2YA 3M62A 2HDPA 2VPDA 3T7LA 5H1VA 2G43A 4AYCA 5G0FA 2LN0A 5FERA 1WIMA 4A4BA 4YBTA 2K16A 4AVXA 1WEQA 4PTBA 2M3HA 2CT2A 1FP0A 3IHPA 3M99A 4MSXA 3PHDA 4A49A 1N87A 4FK5A 2YSJA 1WEUA 2PNXA 1JOCA 1ZBDB 2EGPA 2EA6A 4QF3A 3L1ZB 2VJFB 4B7YC 2ECNA 2OXQC 5TDWA 2XB1A 2VJEA 4PPEA 2H0DB 4LJNA 2HYED 3LQHA 2E6SA 5AITA 2F6NA 2K4DA 2Y43A 2YW8A 3KV6A 3ZVYA 1WEEA 4WZ2A 3EB5A 2VPEA 5DKAA 2KGIA 2LRIC 1Z6UA 3RTRB 1WEWA 2KWKA 3ZNIA 2JMDA 4YADA 2KYUA 2RSDA 4XI1A 2G6QA 3U5PA 1HYJA 2LXHC 1K2FA 2UZGA 1CHCA 5LKUA 3O70A 4TKPB 4YATA 2L43A 2C2LA 1V87A 2L5UA 1VFYA 2F42A 1BORA 2MIQA 4AYCB 5D1KB 4O64A 5H9MA 1WEMA 5FB1A 2MA6A 4WA6A 1X4UA 2VPGA 4QF2A 5AIUA 1LDJB 1WEPA 4V3LC 3GV4A 4I7CA 3N9OA 4UP0A 3N9PA 2CKLA 2PUYA 5B78A 4L7XA 4WZ0A 2ECJA 2CSZA 4X3GA 2LV9A 4AP4A 4W4UA 2VJEB 5H1TA 5LCWB 2C2VS 4I7DA 2ZETC 2KWNA 4L58A 3PURA 2ECIA 2E6RA 3U5OA 4CA1A 5TRBA 2D8SA 3SOUA 1MM3A 5B76A 2LGGA 2MNYA 3T6RA 2XEUA 3ZYQA 5EYAF 5D1MB 5LKTA 5LKXA 4BHWA 4AUQB 3MHHA 3EB6A 2YHOA 3C6WA 4FJCA 1Z2QA 4V3KC 4YABA 3N9LA 2ECGA 3HCTA 2KWOA 4MVTA 3FL2A 4C9ZA 2M1RA 5G05B 2JRJA 2JMIA 4Q6FA 5B75A 3ASLA
chains in the Genus database with same CATH superfamily
5C13A 1XWHA 5DINA 3LRQA 4N4FA 4OGCA 5TBNA 2ECTA 3I2DA 1LDKC 1JM7A 2FFWA 2YQLA 4LADB 2L80A 5B79A 4YC9A 2KREA 4I7BA 5FEYA 2F6JA 3DPLR 5KH7A 2YU4A 3O37A 1DVPA 2XOCA 2L0BA 2AN6A 3LJUX 2YREA 2EXUA 2M13A 3ZPVE 2YSMA 3N9NA 2BAYA 2CKLB 4GNFA 1WILA 2P57A 1VYXA 2OWAA 3HCSA 4S3OB 4F52B 4O62A 2QICA 3O36A 2Y1MA 3PUQA 1G25A 4A0CD 5LKZA 2MD8C 4LKAA 2KWJA 3NG2A 3FEHA 3ZVZB 4ZQLA 2FSAA 2DX8A 4GNGA 3H7HA 2MD7B 4S3OC 2K17A 1MBMA 3U5MA 4IC2A 2CSYA 3LQIA 2VP7A 2FUUA 3SOWA 2VPBA 2K1JA 4GB0A 3RPGB 4R7EA 1WENA 2YURA 4LLBA 4B86C 3DDTA 1RMDA 1WESA 3L11A 2ECVA 2KKXA 1WE9A 3N9MA 4Z0OA 1T1HA 5C11A 2LQ6A 2KKYA 3SHBA 3DQVR 1VD4A 3O7AA 2YUCA 4WZ3B 2EODA 3RPGC 2RI7A 2CSVA 2LDRA 3U5NA 3SUBA 5TDRA 1IYMA 2G45A 2QJ0A 5SVIA 2KU3A 3V43A 3L1XA 4YBMA 2LGKA 3O34A 3KNVA 1Z60A 2YYRA 2M85A 3LDYA 1JM7B 4P5OB 2E61A 2LGVA 3O35A 2L7PA 2QIZA 4N3WA 2MKEA 3KV5A 3HTKC 4YBSA 3M63A 1X4IA 2I50A 2KE1A 3E2DA 3FJUB 5I3LA 3GL6A 2Y1NA 5KH3A 3VK6A 2MUMA 4CCGX 2M6MA 4YAXA 1FBVA 5B77A 1X4JA 2D8UA 4A4CA 4FO9A 2FUIA 2LGLA 2YT5A 2NAAA 2VJFA 4NN2A 2EGMA 4LK9A 3LVRE 1WEOA 2KIZA 3ZPV1 4IC3A 2FD4A 2MT5A 1WGMA 2L75A 2H0DA 1E4UA 5TABA 5J3XA 1U6GB 2JMJA 2YQMA 3LQJA 3O33A 2MNZA 2MA5A 3KQIA 3N9QA 1WFKA 3QZVA 2RR4A 5D1LB 1MM2A 4R8PK 3ZTGA 4GNDA 1F62A 3FANA 2JUNA 4UP5A 3SOXA 3MHSA 3KDEC 4FIPA 5JG6A 2YHNA 5B8DA 5KH9A 1HYIA 2LXPC 3JUEA 2KGGA 2KR4A 2VNFA 4H9DA 2KFTA 5FB0A 4ZUXU 1WEVA 4GNEA 4UI9B 5G04B 5H1UA 3HCUA 3C5KA 3FM8C 5SVIB 2CRRA 4ZDTA 4BBQA 1DCQA 2IDAA 2ECWA 4R2YA 3M62A 2HDPA 2VPDA 3T7LA 5H1VA 2G43A 4AYCA 5G0FA 2LN0A 5FERA 1WIMA 4A4BA 4YBTA 2K16A 4AVXA 1WEQA 4PTBA 2M3HA 2CT2A 1FP0A 3IHPA 3M99A 3T9KA 4MSXA 3PHDA 4A49A 1N87A 4FK5A 2DJAA 2YSJA 1WEUA 4F1PA 2PNXA 2XOZA 4OGEA 1JOCA 1ZBDB 2EGPA 2EA6A 4QF3A 3L1ZB 2VJFB 4B7YC 2ECNA 2OXQC 3DWDA 5TDWA 2XB1A 2VJEA 4PPEA 2H0DB 4LJNA 2HYED 3LQHA 2E6SA 5AITA 2F6NA 2K4DA 2Y43A 2YW8A 3O47A 3KV6A 3ZVYA 1WEEA 4WZ2A 3EB5A 2VPEA 5DKAA 2KGIA 2LRIC 1Z6UA 3RTRB 2YVRA 1WEWA 2KWKA 2LAUA 3ZNIA 2JMDA 3MDBC 4YADA 2KYUA 3Q1DA 2RSDA 4XI1A 2G6QA 3U5PA 1HYJA 2LXHC 1K2FA 2UZGA 1CHCA 5LKUA 3O70A 4TKPB 4YATA 2L43A 2DSMA 2C2LA 1V87A 2L5UA 1VFYA 2F42A 1BORA 2CONA 2MIQA 4AYCB 5D1KB 4O64A 5H9MA 1WEMA 5FB1A 2MA6A 4WA6A 2XOYA 1X4UA 4Z0RA 2VPGA 4QF2A 5AIUA 1LDJB 1WEPA 4V3LC 3GV4A 4I7CA 3N9OA 3FAOA 4UP0A 3N9PA 2CRWA 2CKLA 2PUYA 5B78A 4L7XA 4WZ0A 2ECJA 2CSZA 2IQJA 4X3GA 2LV9A 4AP4A 4W4UA 2VJEB 5H1TA 3M7KA 4QQ4A 5LCWB 2C2VS 5SVXA 4I7DA 2ZETC 2KWNA 3PLWA 4L58A 3PURA 2ECIA 2E6RA 3U5OA 4CA1A 5TRBA 2D8SA 3SOUA 1MM3A 5B76A 2LGGA 2MNYA 3T6RA 2XEUA 3ZYQA 5EYAF 5D1MB 5LKTA 3LVQE 2XP0A 5LKXA 4BHWA 5K3QA 4AUQB 3MHHA 3EB6A 2YHOA 3C6WA 4FJCA 1Z2QA 4V3KC 4YABA 3N9LA 2ECGA 3HCTA 2KWOA 4MVTA 2JM3A 3FL2A 4C9ZA 2M1RA 2B0OE 5SVYA 5G05B 2JRJA 2JMIA 4Q6FA 5B75A 3ASLA
chains in the Genus database with same CATH topology
5C13A 1XWHA 5DINA 3LRQA 4N4FA 5TBNA 2ECTA 3I2DA 1LDKC 1JM7A 2YQLA 4LADB 2L80A 5B79A 4YC9A 2KREA 4I7BA 5FEYA 2F6JA 3DPLR 5KH7A 2YU4A 3O37A 1DVPA 2L0BA 2AN6A 2YREA 3ZPVE 2YSMA 3N9NA 2BAYA 2CKLB 4GNFA 1WILA 1VYXA 3HCSA 4S3OB 4F52B 2QICA 3O36A 2Y1MA 3PUQA 1G25A 4A0CD 5LKZA 2MD8C 4LKAA 2KWJA 3NG2A 3ZVZB 4ZQLA 2FSAA 2DX8A 4GNGA 2MD7B 4S3OC 2K17A 3U5MA 4IC2A 2CSYA 3LQIA 2VP7A 2FUUA 3SOWA 2VPBA 2K1JA 4GB0A 3RPGB 4R7EA 1WENA 2YURA 4LLBA 4B86C 1RMDA 1WESA 3L11A 2ECVA 1WE9A 3N9MA 1T1HA 5C11A 2LQ6A 3SHBA 3DQVR 1VD4A 3O7AA 2YUCA 4WZ3B 2EODA 3RPGC 2RI7A 2LDRA 3U5NA 5TDRA 1IYMA 2G45A 2QJ0A 2KU3A 3V43A 3L1XA 4YBMA 2LGKA 3O34A 3KNVA 1Z60A 2YYRA 2M85A 1JM7B 4P5OB 2LGVA 3O35A 2QIZA 4N3WA 3KV5A 3HTKC 4YBSA 3M63A 1X4IA 2I50A 2KE1A 5I3LA 3GL6A 2Y1NA 5KH3A 3VK6A 2MUMA 4CCGX 2M6MA 4YAXA 1FBVA 5B77A 1X4JA 4A4CA 4FO9A 2FUIA 2LGLA 2YT5A 2NAAA 2VJFA 4NN2A 4LK9A 1WEOA 2KIZA 3ZPV1 4IC3A 2MT5A 1WGMA 2L75A 2H0DA 1E4UA 5TABA 5J3XA 1U6GB 2JMJA 2YQMA 3LQJA 3O33A 2MNZA 2MA5A 3KQIA 3N9QA 1WFKA 3QZVA 5D1LB 1MM2A 4R8PK 3ZTGA 4GNDA 1F62A 4UP5A 3SOXA 3MHSA 4FIPA 5JG6A 2YHNA 5B8DA 5KH9A 1HYIA 2LXPC 2KGGA 2KR4A 2VNFA 2KFTA 5FB0A 4ZUXU 1WEVA 4GNEA 4UI9B 5G04B 5H1UA 3HCUA 3C5KA 4ZDTA 4BBQA 2IDAA 2ECWA 4R2YA 3M62A 2HDPA 2VPDA 3T7LA 5H1VA 2G43A 4AYCA 5G0FA 2LN0A 5FERA 1WIMA 4A4BA 4YBTA 2K16A 4AVXA 1WEQA 4PTBA 2M3HA 2CT2A 1FP0A 3IHPA 3M99A 4MSXA 3PHDA 4A49A 1N87A 4FK5A 2YSJA 1WEUA 2PNXA 1JOCA 1ZBDB 2EGPA 2EA6A 4QF3A 3L1ZB 2VJFB 4B7YC 2ECNA 2OXQC 5TDWA 2XB1A 2VJEA 4PPEA 2H0DB 4LJNA 2HYED 3LQHA 2E6SA 5AITA 2F6NA 2K4DA 2Y43A 2YW8A 3KV6A 3ZVYA 1WEEA 4WZ2A 3EB5A 2VPEA 5DKAA 2KGIA 2LRIC 1Z6UA 3RTRB 1WEWA 2KWKA 3ZNIA 2JMDA 4YADA 2KYUA 2RSDA 4XI1A 2G6QA 3U5PA 1HYJA 2LXHC 1K2FA 2UZGA 1CHCA 5LKUA 3O70A 4TKPB 4YATA 2L43A 2C2LA 1V87A 2L5UA 1VFYA 2F42A 1BORA 2MIQA 4AYCB 5D1KB 4O64A 5H9MA 1WEMA 5FB1A 2MA6A 4WA6A 1X4UA 2VPGA 4QF2A 5AIUA 1LDJB 1WEPA 4V3LC 3GV4A 4I7CA 3N9OA 4UP0A 3N9PA 2CKLA 2PUYA 5B78A 4L7XA 4WZ0A 2ECJA 2CSZA 4X3GA 2LV9A 4AP4A 4W4UA 2VJEB 5H1TA 5LCWB 2C2VS 4I7DA 2ZETC 2KWNA 4L58A 3PURA 2ECIA 2E6RA 3U5OA 4CA1A 5TRBA 2D8SA 3SOUA 1MM3A 5B76A 2LGGA 2MNYA 3T6RA 2XEUA 3ZYQA 5EYAF 5D1MB 5LKTA 5LKXA 4BHWA 4AUQB 3MHHA 3EB6A 2YHOA 3C6WA 4FJCA 1Z2QA 4V3KC 4YABA 3N9LA 2ECGA 3HCTA 2KWOA 4MVTA 3FL2A 4C9ZA 2M1RA 5G05B 2JRJA 2JMIA 4Q6FA 5B75A 3ASLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C13 A;  1XWH A;  5DIN A;  3LRQ A;  4N4F A;  5TBN A;  2ECT A;  3I2D A;  1LDK C;  1JM7 A;  2YQL A;  4LAD B;  2L80 A;  5B79 A;  4YC9 A;  2KRE A;  4I7B A;  5FEY A;  2F6J A;  3DPL R;  5KH7 A;  2YU4 A;  3O37 A;  1DVP A;  2L0B A;  2AN6 A;  2YRE A;  3ZPV E;  2YSM A;  3N9N A;  2BAY A;  2CKL B;  4GNF A;  1WIL A;  1VYX A;  3HCS A;  4S3O B;  4F52 B;  2QIC A;  3O36 A;  2Y1M A;  3PUQ A;  1G25 A;  4A0C D;  5LKZ A;  2MD8 C;  4LKA A;  2KWJ A;  3NG2 A;  3ZVZ B;  4ZQL A;  2FSA A;  2DX8 A;  4GNG A;  2MD7 B;  4S3O C;  2K17 A;  3U5M A;  4IC2 A;  2CSY A;  3LQI A;  2VP7 A;  2FUU A;  3SOW A;  2VPB A;  2K1J A;  4GB0 A;  3RPG B;  4R7E A;  1WEN A;  2YUR A;  4LLB A;  4B86 C;  1RMD A;  1WES A;  3L11 A;  2ECV A;  1WE9 A;  3N9M A;  1T1H A;  5C11 A;  2LQ6 A;  3SHB A;  3DQV R;  1VD4 A;  3O7A A;  2YUC A;  4WZ3 B;  2EOD A;  3RPG C;  2RI7 A;  2LDR A;  3U5N A;  5TDR A;  1IYM A;  2G45 A;  2QJ0 A;  2KU3 A;  3V43 A;  3L1X A;  4YBM A;  2LGK A;  3O34 A;  3KNV A;  1Z60 A;  2YYR A;  2M85 A;  1JM7 B;  4P5O B;  2LGV A;  3O35 A;  2QIZ A;  4N3W A;  3KV5 A;  3HTK C;  4YBS A;  3M63 A;  1X4I A;  2I50 A;  2KE1 A;  5I3L A;  3GL6 A;  2Y1N A;  5KH3 A;  3VK6 A;  2MUM A;  4CCG X;  2M6M A;  4YAX A;  1FBV A;  5B77 A;  1X4J A;  4A4C A;  4FO9 A;  2FUI A;  2LGL A;  2YT5 A;  2NAA A;  2VJF A;  4NN2 A;  4LK9 A;  1WEO A;  2KIZ A;  3ZPV 1;  4IC3 A;  2MT5 A;  1WGM A;  2L75 A;  2H0D A;  1E4U A;  5TAB A;  5J3X A;  1U6G B;  2JMJ A;  2YQM A;  3LQJ A;  3O33 A;  2MNZ A;  2MA5 A;  3KQI A;  3N9Q A;  1WFK A;  3QZV A;  5D1L B;  1MM2 A;  4R8P K;  3ZTG A;  4GND A;  1F62 A;  4UP5 A;  3SOX A;  3MHS A;  4FIP A;  5JG6 A;  2YHN A;  5B8D A;  5KH9 A;  1HYI A;  2LXP C;  2KGG A;  2KR4 A;  2VNF A;  2KFT A;  5FB0 A;  4ZUX U;  1WEV A;  4GNE A;  4UI9 B;  5G04 B;  5H1U A;  3HCU A;  3C5K A;  4ZDT A;  4BBQ A;  2IDA A;  2ECW A;  4R2Y A;  3M62 A;  2HDP A;  2VPD A;  3T7L A;  5H1V A;  2G43 A;  4AYC A;  5G0F A;  2LN0 A;  5FER A;  1WIM A;  4A4B A;  4YBT A;  2K16 A;  4AVX A;  1WEQ A;  4PTB A;  2M3H A;  2CT2 A;  1FP0 A;  3IHP A;  3M99 A;  4MSX A;  3PHD A;  4A49 A;  1N87 A;  4FK5 A;  2YSJ A;  1WEU A;  2PNX A;  1JOC A;  1ZBD B;  2EGP A;  2EA6 A;  4QF3 A;  3L1Z B;  2VJF B;  4B7Y C;  2ECN A;  2OXQ C;  5TDW A;  2XB1 A;  2VJE A;  4PPE A;  2H0D B;  4LJN A;  2HYE D;  3LQH A;  2E6S A;  5AIT A;  2F6N A;  2K4D A;  2Y43 A;  2YW8 A;  3KV6 A;  3ZVY A;  1WEE A;  4WZ2 A;  3EB5 A;  2VPE A;  5DKA A;  2KGI A;  2LRI C;  1Z6U A;  3RTR B;  1WEW A;  2KWK A;  3ZNI A;  2JMD A;  4YAD A;  2KYU A;  2RSD A;  4XI1 A;  2G6Q A;  3U5P A;  1HYJ A;  2LXH C;  1K2F A;  2UZG A;  1CHC A;  5LKU A;  3O70 A;  4TKP B;  4YAT A;  2L43 A;  2C2L A;  1V87 A;  2L5U A;  1VFY A;  2F42 A;  1BOR A;  2MIQ A;  4AYC B;  5D1K B;  4O64 A;  5H9M A;  1WEM A;  5FB1 A;  2MA6 A;  4WA6 A;  1X4U A;  2VPG A;  4QF2 A;  5AIU A;  1LDJ B;  1WEP A;  4V3L C;  3GV4 A;  4I7C A;  3N9O A;  4UP0 A;  3N9P A;  2CKL A;  2PUY A;  5B78 A;  4L7X A;  4WZ0 A;  2ECJ A;  2CSZ A;  4X3G A;  2LV9 A;  4AP4 A;  4W4U A;  2VJE B;  5H1T A;  5LCW B;  2C2V S;  4I7D A;  2ZET C;  2KWN A;  4L58 A;  3PUR A;  2ECI A;  2E6R A;  3U5O A;  4CA1 A;  5TRB A;  2D8S A;  3SOU A;  1MM3 A;  5B76 A;  2LGG A;  2MNY A;  3T6R A;  2XEU A;  3ZYQ A;  5EYA F;  5D1M B;  5LKT A;  5LKX A;  4BHW A;  4AUQ B;  3MHH A;  3EB6 A;  2YHO A;  3C6W A;  4FJC A;  1Z2Q A;  4V3K C;  4YAB A;  3N9L A;  2ECG A;  3HCT A;  2KWO A;  4MVT A;  3FL2 A;  4C9Z A;  2M1R A;  5G05 B;  2JRJ A;  2JMI A;  4Q6F A;  5B75 A;  3ASL A; 
#chains in the Genus database with same CATH topology
 5C13 A;  1XWH A;  5DIN A;  3LRQ A;  4N4F A;  4OGC A;  5TBN A;  2ECT A;  3I2D A;  1LDK C;  1JM7 A;  2FFW A;  2YQL A;  4LAD B;  2L80 A;  5B79 A;  4YC9 A;  2KRE A;  4I7B A;  5FEY A;  2F6J A;  3DPL R;  5KH7 A;  2YU4 A;  3O37 A;  1DVP A;  2XOC A;  2L0B A;  2AN6 A;  3LJU X;  2YRE A;  2EXU A;  2M13 A;  3ZPV E;  2YSM A;  3N9N A;  2BAY A;  2CKL B;  4GNF A;  1WIL A;  2P57 A;  1VYX A;  2OWA A;  3HCS A;  4S3O B;  4F52 B;  4O62 A;  2QIC A;  3O36 A;  2Y1M A;  3PUQ A;  1G25 A;  4A0C D;  5LKZ A;  2MD8 C;  4LKA A;  2KWJ A;  3NG2 A;  3FEH A;  3ZVZ B;  4ZQL A;  2FSA A;  2DX8 A;  4GNG A;  3H7H A;  2MD7 B;  4S3O C;  2K17 A;  1MBM A;  3U5M A;  4IC2 A;  2CSY A;  3LQI A;  2VP7 A;  2FUU A;  3SOW A;  2VPB A;  2K1J A;  4GB0 A;  3RPG B;  4R7E A;  1WEN A;  2YUR A;  4LLB A;  4B86 C;  3DDT A;  1RMD A;  1WES A;  3L11 A;  2ECV A;  2KKX A;  1WE9 A;  3N9M A;  4Z0O A;  1T1H A;  5C11 A;  2LQ6 A;  2KKY A;  3SHB A;  3DQV R;  1VD4 A;  3O7A A;  2YUC A;  4WZ3 B;  2EOD A;  3RPG C;  2RI7 A;  2CSV A;  2LDR A;  3U5N A;  3SUB A;  5TDR A;  1IYM A;  2G45 A;  2QJ0 A;  5SVI A;  2KU3 A;  3V43 A;  3L1X A;  4YBM A;  2LGK A;  3O34 A;  3KNV A;  1Z60 A;  2YYR A;  2M85 A;  3LDY A;  1JM7 B;  4P5O B;  2E61 A;  2LGV A;  3O35 A;  2L7P A;  2QIZ A;  4N3W A;  2MKE A;  3KV5 A;  3HTK C;  4YBS A;  3M63 A;  1X4I A;  2I50 A;  2KE1 A;  3E2D A;  3FJU B;  5I3L A;  3GL6 A;  2Y1N A;  5KH3 A;  3VK6 A;  2MUM A;  4CCG X;  2M6M A;  4YAX A;  1FBV A;  5B77 A;  1X4J A;  2D8U A;  4A4C A;  4FO9 A;  2FUI A;  2LGL A;  2YT5 A;  2NAA A;  2VJF A;  4NN2 A;  2EGM A;  4LK9 A;  3LVR E;  1WEO A;  2KIZ A;  3ZPV 1;  4IC3 A;  2FD4 A;  2MT5 A;  1WGM A;  2L75 A;  2H0D A;  1E4U A;  5TAB A;  5J3X A;  1U6G B;  2JMJ A;  2YQM A;  3LQJ A;  3O33 A;  2MNZ A;  2MA5 A;  3KQI A;  3N9Q A;  1WFK A;  3QZV A;  2RR4 A;  5D1L B;  1MM2 A;  4R8P K;  3ZTG A;  4GND A;  1F62 A;  3FAN A;  2JUN A;  4UP5 A;  3SOX A;  3MHS A;  3KDE C;  4FIP A;  5JG6 A;  2YHN A;  5B8D A;  5KH9 A;  1HYI A;  2LXP C;  3JUE A;  2KGG A;  2KR4 A;  2VNF A;  4H9D A;  2KFT A;  5FB0 A;  4ZUX U;  1WEV A;  4GNE A;  4UI9 B;  5G04 B;  5H1U A;  3HCU A;  3C5K A;  3FM8 C;  5SVI B;  2CRR A;  4ZDT A;  4BBQ A;  1DCQ A;  2IDA A;  2ECW A;  4R2Y A;  3M62 A;  2HDP A;  2VPD A;  3T7L A;  5H1V A;  2G43 A;  4AYC A;  5G0F A;  2LN0 A;  5FER A;  1WIM A;  4A4B A;  4YBT A;  2K16 A;  4AVX A;  1WEQ A;  4PTB A;  2M3H A;  2CT2 A;  1FP0 A;  3IHP A;  3M99 A;  3T9K A;  4MSX A;  3PHD A;  4A49 A;  1N87 A;  4FK5 A;  2DJA A;  2YSJ A;  1WEU A;  4F1P A;  2PNX A;  2XOZ A;  4OGE A;  1JOC A;  1ZBD B;  2EGP A;  2EA6 A;  4QF3 A;  3L1Z B;  2VJF B;  4B7Y C;  2ECN A;  2OXQ C;  3DWD A;  5TDW A;  2XB1 A;  2VJE A;  4PPE A;  2H0D B;  4LJN A;  2HYE D;  3LQH A;  2E6S A;  5AIT A;  2F6N A;  2K4D A;  2Y43 A;  2YW8 A;  3O47 A;  3KV6 A;  3ZVY A;  1WEE A;  4WZ2 A;  3EB5 A;  2VPE A;  5DKA A;  2KGI A;  2LRI C;  1Z6U A;  3RTR B;  2YVR A;  1WEW A;  2KWK A;  2LAU A;  3ZNI A;  2JMD A;  3MDB C;  4YAD A;  2KYU A;  3Q1D A;  2RSD A;  4XI1 A;  2G6Q A;  3U5P A;  1HYJ A;  2LXH C;  1K2F A;  2UZG A;  1CHC A;  5LKU A;  3O70 A;  4TKP B;  4YAT A;  2L43 A;  2DSM A;  2C2L A;  1V87 A;  2L5U A;  1VFY A;  2F42 A;  1BOR A;  2CON A;  2MIQ A;  4AYC B;  5D1K B;  4O64 A;  5H9M A;  1WEM A;  5FB1 A;  2MA6 A;  4WA6 A;  2XOY A;  1X4U A;  4Z0R A;  2VPG A;  4QF2 A;  5AIU A;  1LDJ B;  1WEP A;  4V3L C;  3GV4 A;  4I7C A;  3N9O A;  3FAO A;  4UP0 A;  3N9P A;  2CRW A;  2CKL A;  2PUY A;  5B78 A;  4L7X A;  4WZ0 A;  2ECJ A;  2CSZ A;  2IQJ A;  4X3G A;  2LV9 A;  4AP4 A;  4W4U A;  2VJE B;  5H1T A;  3M7K A;  4QQ4 A;  5LCW B;  2C2V S;  5SVX A;  4I7D A;  2ZET C;  2KWN A;  3PLW A;  4L58 A;  3PUR A;  2ECI A;  2E6R A;  3U5O A;  4CA1 A;  5TRB A;  2D8S A;  3SOU A;  1MM3 A;  5B76 A;  2LGG A;  2MNY A;  3T6R A;  2XEU A;  3ZYQ A;  5EYA F;  5D1M B;  5LKT A;  3LVQ E;  2XP0 A;  5LKX A;  4BHW A;  5K3Q A;  4AUQ B;  3MHH A;  3EB6 A;  2YHO A;  3C6W A;  4FJC A;  1Z2Q A;  4V3K C;  4YAB A;  3N9L A;  2ECG A;  3HCT A;  2KWO A;  4MVT A;  2JM3 A;  3FL2 A;  4C9Z A;  2M1R A;  2B0O E;  5SVY A;  5G05 B;  2JRJ A;  2JMI A;  4Q6F A;  5B75 A;  3ASL A; 
#chains in the Genus database with same CATH homology
 5C13 A;  1XWH A;  5DIN A;  3LRQ A;  4N4F A;  5TBN A;  2ECT A;  3I2D A;  1LDK C;  1JM7 A;  2YQL A;  4LAD B;  2L80 A;  5B79 A;  4YC9 A;  2KRE A;  4I7B A;  5FEY A;  2F6J A;  3DPL R;  5KH7 A;  2YU4 A;  3O37 A;  1DVP A;  2L0B A;  2AN6 A;  2YRE A;  3ZPV E;  2YSM A;  3N9N A;  2BAY A;  2CKL B;  4GNF A;  1WIL A;  1VYX A;  3HCS A;  4S3O B;  4F52 B;  2QIC A;  3O36 A;  2Y1M A;  3PUQ A;  1G25 A;  4A0C D;  5LKZ A;  2MD8 C;  4LKA A;  2KWJ A;  3NG2 A;  3ZVZ B;  4ZQL A;  2FSA A;  2DX8 A;  4GNG A;  2MD7 B;  4S3O C;  2K17 A;  3U5M A;  4IC2 A;  2CSY A;  3LQI A;  2VP7 A;  2FUU A;  3SOW A;  2VPB A;  2K1J A;  4GB0 A;  3RPG B;  4R7E A;  1WEN A;  2YUR A;  4LLB A;  4B86 C;  1RMD A;  1WES A;  3L11 A;  2ECV A;  1WE9 A;  3N9M A;  1T1H A;  5C11 A;  2LQ6 A;  3SHB A;  3DQV R;  1VD4 A;  3O7A A;  2YUC A;  4WZ3 B;  2EOD A;  3RPG C;  2RI7 A;  2LDR A;  3U5N A;  5TDR A;  1IYM A;  2G45 A;  2QJ0 A;  2KU3 A;  3V43 A;  3L1X A;  4YBM A;  2LGK A;  3O34 A;  3KNV A;  1Z60 A;  2YYR A;  2M85 A;  1JM7 B;  4P5O B;  2LGV A;  3O35 A;  2QIZ A;  4N3W A;  3KV5 A;  3HTK C;  4YBS A;  3M63 A;  1X4I A;  2I50 A;  2KE1 A;  5I3L A;  3GL6 A;  2Y1N A;  5KH3 A;  3VK6 A;  2MUM A;  4CCG X;  2M6M A;  4YAX A;  1FBV A;  5B77 A;  1X4J A;  4A4C A;  4FO9 A;  2FUI A;  2LGL A;  2YT5 A;  2NAA A;  2VJF A;  4NN2 A;  4LK9 A;  1WEO A;  2KIZ A;  3ZPV 1;  4IC3 A;  2MT5 A;  1WGM A;  2L75 A;  2H0D A;  1E4U A;  5TAB A;  5J3X A;  1U6G B;  2JMJ A;  2YQM A;  3LQJ A;  3O33 A;  2MNZ A;  2MA5 A;  3KQI A;  3N9Q A;  1WFK A;  3QZV A;  5D1L B;  1MM2 A;  4R8P K;  3ZTG A;  4GND A;  1F62 A;  4UP5 A;  3SOX A;  3MHS A;  4FIP A;  5JG6 A;  2YHN A;  5B8D A;  5KH9 A;  1HYI A;  2LXP C;  2KGG A;  2KR4 A;  2VNF A;  2KFT A;  5FB0 A;  4ZUX U;  1WEV A;  4GNE A;  4UI9 B;  5G04 B;  5H1U A;  3HCU A;  3C5K A;  4ZDT A;  4BBQ A;  2IDA A;  2ECW A;  4R2Y A;  3M62 A;  2HDP A;  2VPD A;  3T7L A;  5H1V A;  2G43 A;  4AYC A;  5G0F A;  2LN0 A;  5FER A;  1WIM A;  4A4B A;  4YBT A;  2K16 A;  4AVX A;  1WEQ A;  4PTB A;  2M3H A;  2CT2 A;  1FP0 A;  3IHP A;  3M99 A;  4MSX A;  3PHD A;  4A49 A;  1N87 A;  4FK5 A;  2YSJ A;  1WEU A;  2PNX A;  1JOC A;  1ZBD B;  2EGP A;  2EA6 A;  4QF3 A;  3L1Z B;  2VJF B;  4B7Y C;  2ECN A;  2OXQ C;  5TDW A;  2XB1 A;  2VJE A;  4PPE A;  2H0D B;  4LJN A;  2HYE D;  3LQH A;  2E6S A;  5AIT A;  2F6N A;  2K4D A;  2Y43 A;  2YW8 A;  3KV6 A;  3ZVY A;  1WEE A;  4WZ2 A;  3EB5 A;  2VPE A;  5DKA A;  2KGI A;  2LRI C;  1Z6U A;  3RTR B;  1WEW A;  2KWK A;  3ZNI A;  2JMD A;  4YAD A;  2KYU A;  2RSD A;  4XI1 A;  2G6Q A;  3U5P A;  1HYJ A;  2LXH C;  1K2F A;  2UZG A;  1CHC A;  5LKU A;  3O70 A;  4TKP B;  4YAT A;  2L43 A;  2C2L A;  1V87 A;  2L5U A;  1VFY A;  2F42 A;  1BOR A;  2MIQ A;  4AYC B;  5D1K B;  4O64 A;  5H9M A;  1WEM A;  5FB1 A;  2MA6 A;  4WA6 A;  1X4U A;  2VPG A;  4QF2 A;  5AIU A;  1LDJ B;  1WEP A;  4V3L C;  3GV4 A;  4I7C A;  3N9O A;  4UP0 A;  3N9P A;  2CKL A;  2PUY A;  5B78 A;  4L7X A;  4WZ0 A;  2ECJ A;  2CSZ A;  4X3G A;  2LV9 A;  4AP4 A;  4W4U A;  2VJE B;  5H1T A;  5LCW B;  2C2V S;  4I7D A;  2ZET C;  2KWN A;  4L58 A;  3PUR A;  2ECI A;  2E6R A;  3U5O A;  4CA1 A;  5TRB A;  2D8S A;  3SOU A;  1MM3 A;  5B76 A;  2LGG A;  2MNY A;  3T6R A;  2XEU A;  3ZYQ A;  5EYA F;  5D1M B;  5LKT A;  5LKX A;  4BHW A;  4AUQ B;  3MHH A;  3EB6 A;  2YHO A;  3C6W A;  4FJC A;  1Z2Q A;  4V3K C;  4YAB A;  3N9L A;  2ECG A;  3HCT A;  2KWO A;  4MVT A;  3FL2 A;  4C9Z A;  2M1R A;  5G05 B;  2JRJ A;  2JMI A;  4Q6F A;  5B75 A;  3ASL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...