5D1MB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (p199a)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
110
Chain Sequence
NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGGVQCAVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 26
structure length 110
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1mB01
3SOWA 1K2FA 4I7CA 2KIZA 2CKLA 2LV9A 1RMDA 2KE1A 4R2YA 4LADB 3KQIA 2FUIA 2IDAA 2KFTA 4A4BA 5DINA 3U5PA 2CSZA 2YU4A 4UP5A 2YHOA 5H1UA 1WEEA 2Y1NA 2FSAA 2YW8A 2EA6A 4Q6FA 4AYCB 3PHDA 2C2VS 3M62A 2K4DA 5G0FA 2MNZA 5LKZA 4GNGA 3N9LA 2Y43A 3O37A 4YC9A 1Z60A 2C2LA 4A49A 3KV5A 2G45A 1CHCA 2HDPA 4GNFA 2KREA 3DQVR 1WEVA 5C13A 4PPEA 2VPBA 2PUYA 2JMDA 5G04B 1VD4A 2DX8A 5KH7A 2RSDA 4WZ2A 4BBQA 3ZPVE 3VK6A 2VNFA 4O64A 2ZETC 4GNDA 3V43A 4YBTA 3SOXA 4YABA 4L7XA 2JMJA 3O34A 3HCTA 1Z6UA 2M1RA 5TDWA 2UZGA 5EYAF 1WEUA 1JM7B 3ZTGA 2G43A 4MSXA 3N9NA 4P5OB 5TBNA 2M3HA 4NN2A 3PUQA 4FK5A 3DPLR 2LGGA 2YQLA 5D1LB 2VP7A 2CKLB 1T1HA 1WILA 4ZUXU 2YT5A 2YURA 4V3KC 3ZVZB 1HYIA 3SOUA 2F6NA 1XWHA 3N9QA 1WEPA 3EB5A 3O70A 4LJNA 2KWJA 3ASLA 2MIQA 1WENA 3L1ZB 3PURA 2D8SA 5JG6A 2G6QA 2RI7A 3NG2A 5TDRA 4ZQLA 5H9MA 2ECVA 5FB1A 1X4IA 5J3XA 3KV6A 3N9MA 2K16A 2YYRA 1G25A 2MD8C 2QICA 2FUUA 3RTRB 5LCWB 1IYMA 2KU3A 2ECGA 3C6WA 2JMIA 4UI9B 1F62A 4BHWA 4I7DA 3N9OA 1FP0A 2L75A 3QZVA 4FJCA 1V87A 1ZBDB 1WEWA 2ECNA 2K1JA 4LLBA 3LQHA 2L80A 5LKXA 1HYJA 2KWKA 2QJ0A 4YBSA 2KWOA 1WEQA 5C11A 3MHHA 2CT2A 2KGGA 3RPGC 2E6RA 4N4FA 4YADA 5FEYA 1WFKA 2VJEA 4R7EA 4N3WA 3U5OA 3GL6A 2I50A 5D1KB 2ECJA 2NAAA 5B78A 5TRBA 4XI1A 2CSYA 3C5KA 2MT5A 2XEUA 2VJFA 3O36A 1WESA 2E6SA 2YQMA 2VPDA 1N87A 4LK9A 3LQJA 1JOCA 1E4UA 4YATA 3ZVYA 4WZ0A 4PTBA 2YSMA 4A4CA 5B79A 5B8DA 4W4UA 2YUCA 2KYUA 2MD7B 2KR4A 2YHNA 2LQ6A 2YREA 3O33A 5DKAA 3N9PA 4I7BA 5AIUA 2LXPC 2L43A 4AP4A 5H1TA 4QF2A 4S3OB 2BAYA 5B75A 2F42A 1WGMA 3EB6A 1U6GB 3LRQA 4R8PK 4MVTA 2Y1MA 4X3GA 3O35A 2LRIC 5TABA 2XB1A 3HCSA 2YSJA 2MNYA 2MA5A 2MA6A 4A0CD 1Z2QA 5KH9A 2LGKA 2VPEA 5I3LA 2VPGA 3FL2A 1LDKC 4FO9A 1LDJB 1WE9A 3U5NA 2LDRA 3M63A 4GB0A 2QIZA 4IC3A 2ECIA 2LGLA 5H1VA 1MM3A 2L0BA 3KNVA 1WIMA 3ZYQA 3ZPV1 4AUQB 4FIPA 2LGVA 4AYCA 4LKAA 3O7AA 3T7LA 5KH3A 3MHSA 2ECWA 4WA6A 2EGPA 5G05B 4V3LC 3L1XA 5AITA 5FB0A 1FBVA 2VJEB 4IC2A 2PNXA 1WEOA 2F6JA 3SHBA 2L5UA 3HCUA 3I2DA 4B7YC 3GV4A 1WEMA 5LKTA 2EODA 5FERA 1VFYA 1DVPA 5LKUA 2LN0A 4CA1A 1VYXA 3U5MA 3RPGB 2HYED 3M99A 2M85A 2VJFB 1X4UA 4WZ3B 4C9ZA 3L11A 2KWNA 4CCGX 2H0DB 4B86C 2JRJA 3T6RA 4TKPB 2KGIA 1X4JA 4YBMA 2H0DA 2M6MA 3ZNIA 4GNEA 4QF3A 4L58A 2LXHC 4ZDTA 3LQIA 4AVXA 2OXQC 1BORA 1JM7A 5D1MB 1MM2A 2MUMA 2AN6A 5B77A 4YAXA 3HTKC 4F52B 2K17A 2ECTA 5B76A 4UP0A 4S3OC 3IHPA
chains in the Genus database with same CATH superfamily
3SOWA 2EXUA 1K2FA 4I7CA 2KIZA 2CKLA 2LV9A 1RMDA 2KE1A 3SUBA 4R2YA 4LADB 3KQIA 2FUIA 3DDTA 2IDAA 2KFTA 4A4BA 5DINA 3U5PA 2CSZA 2YU4A 4UP5A 2YHOA 5H1UA 1WEEA 3FEHA 3O47A 2XOCA 2Y1NA 2FSAA 2YW8A 2EGMA 2EA6A 4Q6FA 2RR4A 5SVXA 1MBMA 3E2DA 4AYCB 3PHDA 2C2VS 3M62A 2K4DA 3LJUX 5G0FA 2MNZA 4Z0OA 5LKZA 4GNGA 3N9LA 2Y43A 3O37A 4YC9A 1Z60A 2C2LA 4A49A 2CSVA 3LVRE 3KV5A 2G45A 1CHCA 2HDPA 4GNFA 2KREA 3DQVR 1WEVA 5C13A 3JUEA 4PPEA 2VPBA 2PUYA 2JMDA 5G04B 1VD4A 2DX8A 5KH7A 2RSDA 4WZ2A 1DCQA 4BBQA 3ZPVE 3VK6A 2VNFA 4O64A 2ZETC 2CRWA 2KKXA 4GNDA 3V43A 4YBTA 3SOXA 2DSMA 4YABA 4L7XA 2JMJA 3Q1DA 3O34A 3HCTA 1Z6UA 2M1RA 5TDWA 2UZGA 5EYAF 1WEUA 1JM7B 3ZTGA 2G43A 4MSXA 3N9NA 4P5OB 2D8UA 5TBNA 2M3HA 3FJUB 4NN2A 3T9KA 3PUQA 4FK5A 3DPLR 2LGGA 2YQLA 5D1LB 2VP7A 2CKLB 1T1HA 1WILA 4ZUXU 2YT5A 2YURA 4V3KC 3ZVZB 1HYIA 3SOUA 2F6NA 1XWHA 3N9QA 1WEPA 3EB5A 3O70A 4LJNA 2KWJA 3ASLA 2MIQA 1WENA 3L1ZB 3PURA 2D8SA 5JG6A 2G6QA 2RI7A 3NG2A 5TDRA 4ZQLA 5H9MA 4QQ4A 2ECVA 5FB1A 1X4IA 2M13A 5J3XA 3KV6A 3N9MA 2K16A 4H9DA 2YYRA 1G25A 2MD8C 2QICA 2FUUA 3RTRB 2FD4A 5LCWB 1IYMA 2KU3A 2ECGA 3C6WA 2JMIA 4UI9B 1F62A 4BHWA 3FM8C 4I7DA 3N9OA 1FP0A 2LAUA 2L75A 3QZVA 4FJCA 1V87A 1ZBDB 1WEWA 2ECNA 2K1JA 4LLBA 3LQHA 3MDBC 2L80A 5LKXA 1HYJA 3M7KA 2KWKA 2QJ0A 3FAOA 4YBSA 2KWOA 1WEQA 5C11A 3MHHA 2CT2A 2KGGA 2P57A 3RPGC 2E6RA 4N4FA 4YADA 5FEYA 1WFKA 2VJEA 2CRRA 4R7EA 5SVIA 4N3WA 3U5OA 3GL6A 2I50A 5D1KB 2KKYA 2YVRA 2ECJA 2NAAA 5B78A 5TRBA 4XI1A 2CSYA 3C5KA 2MT5A 2XEUA 2VJFA 3LVQE 3O36A 1WESA 2E6SA 2YQMA 2VPDA 1N87A 4LK9A 3LQJA 5SVYA 1JOCA 1E4UA 2L7PA 4YATA 3ZVYA 4WZ0A 4PTBA 2YSMA 4A4CA 5B79A 5B8DA 4W4UA 2YUCA 2KYUA 2MD7B 2KR4A 2YHNA 2MKEA 2LQ6A 2YREA 4OGEA 3O33A 5DKAA 3N9PA 4F1PA 4I7BA 3H7HA 5AIUA 2LXPC 2L43A 2DJAA 4AP4A 5H1TA 4QF2A 4S3OB 2BAYA 5B75A 2F42A 2OWAA 2E61A 1WGMA 3EB6A 1U6GB 3LRQA 4R8PK 4MVTA 2Y1MA 4X3GA 3O35A 2LRIC 5TABA 2XB1A 3HCSA 2YSJA 2MNYA 2JM3A 2MA5A 2MA6A 4A0CD 1Z2QA 5KH9A 2LGKA 2VPEA 5I3LA 2VPGA 3FL2A 1LDKC 4FO9A 1LDJB 1WE9A 3U5NA 2LDRA 3KDEC 3M63A 4GB0A 4Z0RA 2QIZA 4IC3A 2JUNA 2ECIA 2LGLA 5H1VA 1MM3A 2L0BA 3KNVA 1WIMA 3ZYQA 3ZPV1 4AUQB 4FIPA 2B0OE 2LGVA 4AYCA 4LKAA 3O7AA 2XOYA 3T7LA 5KH3A 3MHSA 2ECWA 3DWDA 4WA6A 2EGPA 5G05B 4V3LC 3L1XA 5AITA 5FB0A 1FBVA 2VJEB 4IC2A 2PNXA 1WEOA 2F6JA 2XP0A 5SVIB 3SHBA 2L5UA 3HCUA 3I2DA 3PLWA 4B7YC 3GV4A 1WEMA 5LKTA 2EODA 5FERA 1VFYA 1DVPA 2FFWA 5LKUA 2XOZA 2LN0A 4CA1A 1VYXA 3U5MA 3RPGB 2HYED 3M99A 2M85A 2VJFB 1X4UA 4WZ3B 4C9ZA 2IQJA 3L11A 2KWNA 4CCGX 2H0DB 4B86C 2JRJA 3T6RA 4TKPB 2KGIA 1X4JA 4YBMA 2H0DA 2M6MA 3ZNIA 4GNEA 4QF3A 4L58A 2LXHC 4ZDTA 3LQIA 5K3QA 4AVXA 2OXQC 1BORA 3LDYA 1JM7A 5D1MB 4OGCA 1MM2A 2MUMA 2AN6A 2CONA 5B77A 4YAXA 3HTKC 3FANA 4F52B 2K17A 2ECTA 5B76A 4UP0A 4S3OC 4O62A 3IHPA
chains in the Genus database with same CATH topology
3SOWA 1K2FA 4I7CA 2KIZA 2CKLA 2LV9A 1RMDA 2KE1A 4R2YA 4LADB 3KQIA 2FUIA 2IDAA 2KFTA 4A4BA 5DINA 3U5PA 2CSZA 2YU4A 4UP5A 2YHOA 5H1UA 1WEEA 2Y1NA 2FSAA 2YW8A 2EA6A 4Q6FA 4AYCB 3PHDA 2C2VS 3M62A 2K4DA 5G0FA 2MNZA 5LKZA 4GNGA 3N9LA 2Y43A 3O37A 4YC9A 1Z60A 2C2LA 4A49A 3KV5A 2G45A 1CHCA 2HDPA 4GNFA 2KREA 3DQVR 1WEVA 5C13A 4PPEA 2VPBA 2PUYA 2JMDA 5G04B 1VD4A 2DX8A 5KH7A 2RSDA 4WZ2A 4BBQA 3ZPVE 3VK6A 2VNFA 4O64A 2ZETC 4GNDA 3V43A 4YBTA 3SOXA 4YABA 4L7XA 2JMJA 3O34A 3HCTA 1Z6UA 2M1RA 5TDWA 2UZGA 5EYAF 1WEUA 1JM7B 3ZTGA 2G43A 4MSXA 3N9NA 4P5OB 5TBNA 2M3HA 4NN2A 3PUQA 4FK5A 3DPLR 2LGGA 2YQLA 5D1LB 2VP7A 2CKLB 1T1HA 1WILA 4ZUXU 2YT5A 2YURA 4V3KC 3ZVZB 1HYIA 3SOUA 2F6NA 1XWHA 3N9QA 1WEPA 3EB5A 3O70A 4LJNA 2KWJA 3ASLA 2MIQA 1WENA 3L1ZB 3PURA 2D8SA 5JG6A 2G6QA 2RI7A 3NG2A 5TDRA 4ZQLA 5H9MA 2ECVA 5FB1A 1X4IA 5J3XA 3KV6A 3N9MA 2K16A 2YYRA 1G25A 2MD8C 2QICA 2FUUA 3RTRB 5LCWB 1IYMA 2KU3A 2ECGA 3C6WA 2JMIA 4UI9B 1F62A 4BHWA 4I7DA 3N9OA 1FP0A 2L75A 3QZVA 4FJCA 1V87A 1ZBDB 1WEWA 2ECNA 2K1JA 4LLBA 3LQHA 2L80A 5LKXA 1HYJA 2KWKA 2QJ0A 4YBSA 2KWOA 1WEQA 5C11A 3MHHA 2CT2A 2KGGA 3RPGC 2E6RA 4N4FA 4YADA 5FEYA 1WFKA 2VJEA 4R7EA 4N3WA 3U5OA 3GL6A 2I50A 5D1KB 2ECJA 2NAAA 5B78A 5TRBA 4XI1A 2CSYA 3C5KA 2MT5A 2XEUA 2VJFA 3O36A 1WESA 2E6SA 2YQMA 2VPDA 1N87A 4LK9A 3LQJA 1JOCA 1E4UA 4YATA 3ZVYA 4WZ0A 4PTBA 2YSMA 4A4CA 5B79A 5B8DA 4W4UA 2YUCA 2KYUA 2MD7B 2KR4A 2YHNA 2LQ6A 2YREA 3O33A 5DKAA 3N9PA 4I7BA 5AIUA 2LXPC 2L43A 4AP4A 5H1TA 4QF2A 4S3OB 2BAYA 5B75A 2F42A 1WGMA 3EB6A 1U6GB 3LRQA 4R8PK 4MVTA 2Y1MA 4X3GA 3O35A 2LRIC 5TABA 2XB1A 3HCSA 2YSJA 2MNYA 2MA5A 2MA6A 4A0CD 1Z2QA 5KH9A 2LGKA 2VPEA 5I3LA 2VPGA 3FL2A 1LDKC 4FO9A 1LDJB 1WE9A 3U5NA 2LDRA 3M63A 4GB0A 2QIZA 4IC3A 2ECIA 2LGLA 5H1VA 1MM3A 2L0BA 3KNVA 1WIMA 3ZYQA 3ZPV1 4AUQB 4FIPA 2LGVA 4AYCA 4LKAA 3O7AA 3T7LA 5KH3A 3MHSA 2ECWA 4WA6A 2EGPA 5G05B 4V3LC 3L1XA 5AITA 5FB0A 1FBVA 2VJEB 4IC2A 2PNXA 1WEOA 2F6JA 3SHBA 2L5UA 3HCUA 3I2DA 4B7YC 3GV4A 1WEMA 5LKTA 2EODA 5FERA 1VFYA 1DVPA 5LKUA 2LN0A 4CA1A 1VYXA 3U5MA 3RPGB 2HYED 3M99A 2M85A 2VJFB 1X4UA 4WZ3B 4C9ZA 3L11A 2KWNA 4CCGX 2H0DB 4B86C 2JRJA 3T6RA 4TKPB 2KGIA 1X4JA 4YBMA 2H0DA 2M6MA 3ZNIA 4GNEA 4QF3A 4L58A 2LXHC 4ZDTA 3LQIA 4AVXA 2OXQC 1BORA 1JM7A 5D1MB 1MM2A 2MUMA 2AN6A 5B77A 4YAXA 3HTKC 4F52B 2K17A 2ECTA 5B76A 4UP0A 4S3OC 3IHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOW A;  1K2F A;  4I7C A;  2KIZ A;  2CKL A;  2LV9 A;  1RMD A;  2KE1 A;  4R2Y A;  4LAD B;  3KQI A;  2FUI A;  2IDA A;  2KFT A;  4A4B A;  5DIN A;  3U5P A;  2CSZ A;  2YU4 A;  4UP5 A;  2YHO A;  5H1U A;  1WEE A;  2Y1N A;  2FSA A;  2YW8 A;  2EA6 A;  4Q6F A;  4AYC B;  3PHD A;  2C2V S;  3M62 A;  2K4D A;  5G0F A;  2MNZ A;  5LKZ A;  4GNG A;  3N9L A;  2Y43 A;  3O37 A;  4YC9 A;  1Z60 A;  2C2L A;  4A49 A;  3KV5 A;  2G45 A;  1CHC A;  2HDP A;  4GNF A;  2KRE A;  3DQV R;  1WEV A;  5C13 A;  4PPE A;  2VPB A;  2PUY A;  2JMD A;  5G04 B;  1VD4 A;  2DX8 A;  5KH7 A;  2RSD A;  4WZ2 A;  4BBQ A;  3ZPV E;  3VK6 A;  2VNF A;  4O64 A;  2ZET C;  4GND A;  3V43 A;  4YBT A;  3SOX A;  4YAB A;  4L7X A;  2JMJ A;  3O34 A;  3HCT A;  1Z6U A;  2M1R A;  5TDW A;  2UZG A;  5EYA F;  1WEU A;  1JM7 B;  3ZTG A;  2G43 A;  4MSX A;  3N9N A;  4P5O B;  5TBN A;  2M3H A;  4NN2 A;  3PUQ A;  4FK5 A;  3DPL R;  2LGG A;  2YQL A;  5D1L B;  2VP7 A;  2CKL B;  1T1H A;  1WIL A;  4ZUX U;  2YT5 A;  2YUR A;  4V3K C;  3ZVZ B;  1HYI A;  3SOU A;  2F6N A;  1XWH A;  3N9Q A;  1WEP A;  3EB5 A;  3O70 A;  4LJN A;  2KWJ A;  3ASL A;  2MIQ A;  1WEN A;  3L1Z B;  3PUR A;  2D8S A;  5JG6 A;  2G6Q A;  2RI7 A;  3NG2 A;  5TDR A;  4ZQL A;  5H9M A;  2ECV A;  5FB1 A;  1X4I A;  5J3X A;  3KV6 A;  3N9M A;  2K16 A;  2YYR A;  1G25 A;  2MD8 C;  2QIC A;  2FUU A;  3RTR B;  5LCW B;  1IYM A;  2KU3 A;  2ECG A;  3C6W A;  2JMI A;  4UI9 B;  1F62 A;  4BHW A;  4I7D A;  3N9O A;  1FP0 A;  2L75 A;  3QZV A;  4FJC A;  1V87 A;  1ZBD B;  1WEW A;  2ECN A;  2K1J A;  4LLB A;  3LQH A;  2L80 A;  5LKX A;  1HYJ A;  2KWK A;  2QJ0 A;  4YBS A;  2KWO A;  1WEQ A;  5C11 A;  3MHH A;  2CT2 A;  2KGG A;  3RPG C;  2E6R A;  4N4F A;  4YAD A;  5FEY A;  1WFK A;  2VJE A;  4R7E A;  4N3W A;  3U5O A;  3GL6 A;  2I50 A;  5D1K B;  2ECJ A;  2NAA A;  5B78 A;  5TRB A;  4XI1 A;  2CSY A;  3C5K A;  2MT5 A;  2XEU A;  2VJF A;  3O36 A;  1WES A;  2E6S A;  2YQM A;  2VPD A;  1N87 A;  4LK9 A;  3LQJ A;  1JOC A;  1E4U A;  4YAT A;  3ZVY A;  4WZ0 A;  4PTB A;  2YSM A;  4A4C A;  5B79 A;  5B8D A;  4W4U A;  2YUC A;  2KYU A;  2MD7 B;  2KR4 A;  2YHN A;  2LQ6 A;  2YRE A;  3O33 A;  5DKA A;  3N9P A;  4I7B A;  5AIU A;  2LXP C;  2L43 A;  4AP4 A;  5H1T A;  4QF2 A;  4S3O B;  2BAY A;  5B75 A;  2F42 A;  1WGM A;  3EB6 A;  1U6G B;  3LRQ A;  4R8P K;  4MVT A;  2Y1M A;  4X3G A;  3O35 A;  2LRI C;  5TAB A;  2XB1 A;  3HCS A;  2YSJ A;  2MNY A;  2MA5 A;  2MA6 A;  4A0C D;  1Z2Q A;  5KH9 A;  2LGK A;  2VPE A;  5I3L A;  2VPG A;  3FL2 A;  1LDK C;  4FO9 A;  1LDJ B;  1WE9 A;  3U5N A;  2LDR A;  3M63 A;  4GB0 A;  2QIZ A;  4IC3 A;  2ECI A;  2LGL A;  5H1V A;  1MM3 A;  2L0B A;  3KNV A;  1WIM A;  3ZYQ A;  3ZPV 1;  4AUQ B;  4FIP A;  2LGV A;  4AYC A;  4LKA A;  3O7A A;  3T7L A;  5KH3 A;  3MHS A;  2ECW A;  4WA6 A;  2EGP A;  5G05 B;  4V3L C;  3L1X A;  5AIT A;  5FB0 A;  1FBV A;  2VJE B;  4IC2 A;  2PNX A;  1WEO A;  2F6J A;  3SHB A;  2L5U A;  3HCU A;  3I2D A;  4B7Y C;  3GV4 A;  1WEM A;  5LKT A;  2EOD A;  5FER A;  1VFY A;  1DVP A;  5LKU A;  2LN0 A;  4CA1 A;  1VYX A;  3U5M A;  3RPG B;  2HYE D;  3M99 A;  2M85 A;  2VJF B;  1X4U A;  4WZ3 B;  4C9Z A;  3L11 A;  2KWN A;  4CCG X;  2H0D B;  4B86 C;  2JRJ A;  3T6R A;  4TKP B;  2KGI A;  1X4J A;  4YBM A;  2H0D A;  2M6M A;  3ZNI A;  4GNE A;  4QF3 A;  4L58 A;  2LXH C;  4ZDT A;  3LQI A;  4AVX A;  2OXQ C;  1BOR A;  1JM7 A;  5D1M B;  1MM2 A;  2MUM A;  2AN6 A;  5B77 A;  4YAX A;  3HTK C;  4F52 B;  2K17 A;  2ECT A;  5B76 A;  4UP0 A;  4S3O C;  3IHP A; 
#chains in the Genus database with same CATH topology
 3SOW A;  2EXU A;  1K2F A;  4I7C A;  2KIZ A;  2CKL A;  2LV9 A;  1RMD A;  2KE1 A;  3SUB A;  4R2Y A;  4LAD B;  3KQI A;  2FUI A;  3DDT A;  2IDA A;  2KFT A;  4A4B A;  5DIN A;  3U5P A;  2CSZ A;  2YU4 A;  4UP5 A;  2YHO A;  5H1U A;  1WEE A;  3FEH A;  3O47 A;  2XOC A;  2Y1N A;  2FSA A;  2YW8 A;  2EGM A;  2EA6 A;  4Q6F A;  2RR4 A;  5SVX A;  1MBM A;  3E2D A;  4AYC B;  3PHD A;  2C2V S;  3M62 A;  2K4D A;  3LJU X;  5G0F A;  2MNZ A;  4Z0O A;  5LKZ A;  4GNG A;  3N9L A;  2Y43 A;  3O37 A;  4YC9 A;  1Z60 A;  2C2L A;  4A49 A;  2CSV A;  3LVR E;  3KV5 A;  2G45 A;  1CHC A;  2HDP A;  4GNF A;  2KRE A;  3DQV R;  1WEV A;  5C13 A;  3JUE A;  4PPE A;  2VPB A;  2PUY A;  2JMD A;  5G04 B;  1VD4 A;  2DX8 A;  5KH7 A;  2RSD A;  4WZ2 A;  1DCQ A;  4BBQ A;  3ZPV E;  3VK6 A;  2VNF A;  4O64 A;  2ZET C;  2CRW A;  2KKX A;  4GND A;  3V43 A;  4YBT A;  3SOX A;  2DSM A;  4YAB A;  4L7X A;  2JMJ A;  3Q1D A;  3O34 A;  3HCT A;  1Z6U A;  2M1R A;  5TDW A;  2UZG A;  5EYA F;  1WEU A;  1JM7 B;  3ZTG A;  2G43 A;  4MSX A;  3N9N A;  4P5O B;  2D8U A;  5TBN A;  2M3H A;  3FJU B;  4NN2 A;  3T9K A;  3PUQ A;  4FK5 A;  3DPL R;  2LGG A;  2YQL A;  5D1L B;  2VP7 A;  2CKL B;  1T1H A;  1WIL A;  4ZUX U;  2YT5 A;  2YUR A;  4V3K C;  3ZVZ B;  1HYI A;  3SOU A;  2F6N A;  1XWH A;  3N9Q A;  1WEP A;  3EB5 A;  3O70 A;  4LJN A;  2KWJ A;  3ASL A;  2MIQ A;  1WEN A;  3L1Z B;  3PUR A;  2D8S A;  5JG6 A;  2G6Q A;  2RI7 A;  3NG2 A;  5TDR A;  4ZQL A;  5H9M A;  4QQ4 A;  2ECV A;  5FB1 A;  1X4I A;  2M13 A;  5J3X A;  3KV6 A;  3N9M A;  2K16 A;  4H9D A;  2YYR A;  1G25 A;  2MD8 C;  2QIC A;  2FUU A;  3RTR B;  2FD4 A;  5LCW B;  1IYM A;  2KU3 A;  2ECG A;  3C6W A;  2JMI A;  4UI9 B;  1F62 A;  4BHW A;  3FM8 C;  4I7D A;  3N9O A;  1FP0 A;  2LAU A;  2L75 A;  3QZV A;  4FJC A;  1V87 A;  1ZBD B;  1WEW A;  2ECN A;  2K1J A;  4LLB A;  3LQH A;  3MDB C;  2L80 A;  5LKX A;  1HYJ A;  3M7K A;  2KWK A;  2QJ0 A;  3FAO A;  4YBS A;  2KWO A;  1WEQ A;  5C11 A;  3MHH A;  2CT2 A;  2KGG A;  2P57 A;  3RPG C;  2E6R A;  4N4F A;  4YAD A;  5FEY A;  1WFK A;  2VJE A;  2CRR A;  4R7E A;  5SVI A;  4N3W A;  3U5O A;  3GL6 A;  2I50 A;  5D1K B;  2KKY A;  2YVR A;  2ECJ A;  2NAA A;  5B78 A;  5TRB A;  4XI1 A;  2CSY A;  3C5K A;  2MT5 A;  2XEU A;  2VJF A;  3LVQ E;  3O36 A;  1WES A;  2E6S A;  2YQM A;  2VPD A;  1N87 A;  4LK9 A;  3LQJ A;  5SVY A;  1JOC A;  1E4U A;  2L7P A;  4YAT A;  3ZVY A;  4WZ0 A;  4PTB A;  2YSM A;  4A4C A;  5B79 A;  5B8D A;  4W4U A;  2YUC A;  2KYU A;  2MD7 B;  2KR4 A;  2YHN A;  2MKE A;  2LQ6 A;  2YRE A;  4OGE A;  3O33 A;  5DKA A;  3N9P A;  4F1P A;  4I7B A;  3H7H A;  5AIU A;  2LXP C;  2L43 A;  2DJA A;  4AP4 A;  5H1T A;  4QF2 A;  4S3O B;  2BAY A;  5B75 A;  2F42 A;  2OWA A;  2E61 A;  1WGM A;  3EB6 A;  1U6G B;  3LRQ A;  4R8P K;  4MVT A;  2Y1M A;  4X3G A;  3O35 A;  2LRI C;  5TAB A;  2XB1 A;  3HCS A;  2YSJ A;  2MNY A;  2JM3 A;  2MA5 A;  2MA6 A;  4A0C D;  1Z2Q A;  5KH9 A;  2LGK A;  2VPE A;  5I3L A;  2VPG A;  3FL2 A;  1LDK C;  4FO9 A;  1LDJ B;  1WE9 A;  3U5N A;  2LDR A;  3KDE C;  3M63 A;  4GB0 A;  4Z0R A;  2QIZ A;  4IC3 A;  2JUN A;  2ECI A;  2LGL A;  5H1V A;  1MM3 A;  2L0B A;  3KNV A;  1WIM A;  3ZYQ A;  3ZPV 1;  4AUQ B;  4FIP A;  2B0O E;  2LGV A;  4AYC A;  4LKA A;  3O7A A;  2XOY A;  3T7L A;  5KH3 A;  3MHS A;  2ECW A;  3DWD A;  4WA6 A;  2EGP A;  5G05 B;  4V3L C;  3L1X A;  5AIT A;  5FB0 A;  1FBV A;  2VJE B;  4IC2 A;  2PNX A;  1WEO A;  2F6J A;  2XP0 A;  5SVI B;  3SHB A;  2L5U A;  3HCU A;  3I2D A;  3PLW A;  4B7Y C;  3GV4 A;  1WEM A;  5LKT A;  2EOD A;  5FER A;  1VFY A;  1DVP A;  2FFW A;  5LKU A;  2XOZ A;  2LN0 A;  4CA1 A;  1VYX A;  3U5M A;  3RPG B;  2HYE D;  3M99 A;  2M85 A;  2VJF B;  1X4U A;  4WZ3 B;  4C9Z A;  2IQJ A;  3L11 A;  2KWN A;  4CCG X;  2H0D B;  4B86 C;  2JRJ A;  3T6R A;  4TKP B;  2KGI A;  1X4J A;  4YBM A;  2H0D A;  2M6M A;  3ZNI A;  4GNE A;  4QF3 A;  4L58 A;  2LXH C;  4ZDT A;  3LQI A;  5K3Q A;  4AVX A;  2OXQ C;  1BOR A;  3LDY A;  1JM7 A;  5D1M B;  4OGC A;  1MM2 A;  2MUM A;  2AN6 A;  2CON A;  5B77 A;  4YAX A;  3HTK C;  3FAN A;  4F52 B;  2K17 A;  2ECT A;  5B76 A;  4UP0 A;  4S3O C;  4O62 A;  3IHP A; 
#chains in the Genus database with same CATH homology
 3SOW A;  1K2F A;  4I7C A;  2KIZ A;  2CKL A;  2LV9 A;  1RMD A;  2KE1 A;  4R2Y A;  4LAD B;  3KQI A;  2FUI A;  2IDA A;  2KFT A;  4A4B A;  5DIN A;  3U5P A;  2CSZ A;  2YU4 A;  4UP5 A;  2YHO A;  5H1U A;  1WEE A;  2Y1N A;  2FSA A;  2YW8 A;  2EA6 A;  4Q6F A;  4AYC B;  3PHD A;  2C2V S;  3M62 A;  2K4D A;  5G0F A;  2MNZ A;  5LKZ A;  4GNG A;  3N9L A;  2Y43 A;  3O37 A;  4YC9 A;  1Z60 A;  2C2L A;  4A49 A;  3KV5 A;  2G45 A;  1CHC A;  2HDP A;  4GNF A;  2KRE A;  3DQV R;  1WEV A;  5C13 A;  4PPE A;  2VPB A;  2PUY A;  2JMD A;  5G04 B;  1VD4 A;  2DX8 A;  5KH7 A;  2RSD A;  4WZ2 A;  4BBQ A;  3ZPV E;  3VK6 A;  2VNF A;  4O64 A;  2ZET C;  4GND A;  3V43 A;  4YBT A;  3SOX A;  4YAB A;  4L7X A;  2JMJ A;  3O34 A;  3HCT A;  1Z6U A;  2M1R A;  5TDW A;  2UZG A;  5EYA F;  1WEU A;  1JM7 B;  3ZTG A;  2G43 A;  4MSX A;  3N9N A;  4P5O B;  5TBN A;  2M3H A;  4NN2 A;  3PUQ A;  4FK5 A;  3DPL R;  2LGG A;  2YQL A;  5D1L B;  2VP7 A;  2CKL B;  1T1H A;  1WIL A;  4ZUX U;  2YT5 A;  2YUR A;  4V3K C;  3ZVZ B;  1HYI A;  3SOU A;  2F6N A;  1XWH A;  3N9Q A;  1WEP A;  3EB5 A;  3O70 A;  4LJN A;  2KWJ A;  3ASL A;  2MIQ A;  1WEN A;  3L1Z B;  3PUR A;  2D8S A;  5JG6 A;  2G6Q A;  2RI7 A;  3NG2 A;  5TDR A;  4ZQL A;  5H9M A;  2ECV A;  5FB1 A;  1X4I A;  5J3X A;  3KV6 A;  3N9M A;  2K16 A;  2YYR A;  1G25 A;  2MD8 C;  2QIC A;  2FUU A;  3RTR B;  5LCW B;  1IYM A;  2KU3 A;  2ECG A;  3C6W A;  2JMI A;  4UI9 B;  1F62 A;  4BHW A;  4I7D A;  3N9O A;  1FP0 A;  2L75 A;  3QZV A;  4FJC A;  1V87 A;  1ZBD B;  1WEW A;  2ECN A;  2K1J A;  4LLB A;  3LQH A;  2L80 A;  5LKX A;  1HYJ A;  2KWK A;  2QJ0 A;  4YBS A;  2KWO A;  1WEQ A;  5C11 A;  3MHH A;  2CT2 A;  2KGG A;  3RPG C;  2E6R A;  4N4F A;  4YAD A;  5FEY A;  1WFK A;  2VJE A;  4R7E A;  4N3W A;  3U5O A;  3GL6 A;  2I50 A;  5D1K B;  2ECJ A;  2NAA A;  5B78 A;  5TRB A;  4XI1 A;  2CSY A;  3C5K A;  2MT5 A;  2XEU A;  2VJF A;  3O36 A;  1WES A;  2E6S A;  2YQM A;  2VPD A;  1N87 A;  4LK9 A;  3LQJ A;  1JOC A;  1E4U A;  4YAT A;  3ZVY A;  4WZ0 A;  4PTB A;  2YSM A;  4A4C A;  5B79 A;  5B8D A;  4W4U A;  2YUC A;  2KYU A;  2MD7 B;  2KR4 A;  2YHN A;  2LQ6 A;  2YRE A;  3O33 A;  5DKA A;  3N9P A;  4I7B A;  5AIU A;  2LXP C;  2L43 A;  4AP4 A;  5H1T A;  4QF2 A;  4S3O B;  2BAY A;  5B75 A;  2F42 A;  1WGM A;  3EB6 A;  1U6G B;  3LRQ A;  4R8P K;  4MVT A;  2Y1M A;  4X3G A;  3O35 A;  2LRI C;  5TAB A;  2XB1 A;  3HCS A;  2YSJ A;  2MNY A;  2MA5 A;  2MA6 A;  4A0C D;  1Z2Q A;  5KH9 A;  2LGK A;  2VPE A;  5I3L A;  2VPG A;  3FL2 A;  1LDK C;  4FO9 A;  1LDJ B;  1WE9 A;  3U5N A;  2LDR A;  3M63 A;  4GB0 A;  2QIZ A;  4IC3 A;  2ECI A;  2LGL A;  5H1V A;  1MM3 A;  2L0B A;  3KNV A;  1WIM A;  3ZYQ A;  3ZPV 1;  4AUQ B;  4FIP A;  2LGV A;  4AYC A;  4LKA A;  3O7A A;  3T7L A;  5KH3 A;  3MHS A;  2ECW A;  4WA6 A;  2EGP A;  5G05 B;  4V3L C;  3L1X A;  5AIT A;  5FB0 A;  1FBV A;  2VJE B;  4IC2 A;  2PNX A;  1WEO A;  2F6J A;  3SHB A;  2L5U A;  3HCU A;  3I2D A;  4B7Y C;  3GV4 A;  1WEM A;  5LKT A;  2EOD A;  5FER A;  1VFY A;  1DVP A;  5LKU A;  2LN0 A;  4CA1 A;  1VYX A;  3U5M A;  3RPG B;  2HYE D;  3M99 A;  2M85 A;  2VJF B;  1X4U A;  4WZ3 B;  4C9Z A;  3L11 A;  2KWN A;  4CCG X;  2H0D B;  4B86 C;  2JRJ A;  3T6R A;  4TKP B;  2KGI A;  1X4J A;  4YBM A;  2H0D A;  2M6M A;  3ZNI A;  4GNE A;  4QF3 A;  4L58 A;  2LXH C;  4ZDT A;  3LQI A;  4AVX A;  2OXQ C;  1BOR A;  1JM7 A;  5D1M B;  1MM2 A;  2MUM A;  2AN6 A;  5B77 A;  4YAX A;  3HTK C;  4F52 B;  2K17 A;  2ECT A;  5B76 A;  4UP0 A;  4S3O C;  3IHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...