5D1MB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (p199a)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
110
Chain Sequence
NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGGVQCAVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D2
total genus 26
structure length 110
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1mB01
3NG2A 2G6QA 5EYAF 5TDWA 1HYIA 4L58A 2DX8A 2Y1MA 4IC2A 4WA6A 5D1KB 2RI7A 1LDJB 1X4UA 2M6MA 3L11A 2KGGA 5G0FA 1WEVA 1WEWA 5FB1A 3KV6A 2KU3A 2VPEA 5KH7A 2LGKA 4TKPB 4LKAA 3ZVZB 2XEUA 2ECWA 3L1ZB 2VJEA 3L1XA 5JG6A 3SOWA 1JM7B 2UZGA 2XB1A 1WEMA 4A4BA 2KR4A 4A49A 5D1MB 4UP0A 4LJNA 2NAAA 4ZDTA 2CKLA 5DKAA 1JOCA 2YQLA 1WEQA 2KWKA 1WFKA 4YC9A 2VP7A 4V3LC 4YATA 2JRJA 2YREA 4FIPA 1ZBDB 2CSYA 4CA1A 2YU4A 2K4DA 4I7BA 2G43A 2ZETC 4AP4A 2YSJA 2F42A 2VPGA 2LGVA 4AYCA 2YYRA 1MM3A 3GL6A 4A0CD 3N9LA 3O37A 1WEUA 5B76A 1X4IA 5TRBA 4GNEA 2Y43A 4YBSA 2H0DB 2EA6A 4MVTA 4MSXA 2RSDA 4YAXA 5AIUA 2KYUA 1X4JA 3T7LA 3ZVYA 5TDRA 5DINA 2KWOA 2ECJA 4I7DA 2YURA 3N9PA 2LGGA 1U6GB 2YQMA 2YUCA 2M3HA 4GNFA 5J3XA 1LDKC 2KIZA 3SHBA 5TABA 3V43A 5LKXA 3ASLA 4C9ZA 5H9MA 4BBQA 3ZPV1 3ZTGA 3KNVA 3U5MA 4PPEA 2K1JA 3MHHA 5LKZA 2CSZA 3M62A 1WENA 4V3KC 2L5UA 1RMDA 1V87A 2LDRA 1G25A 1JM7A 4ZUXU 2KREA 3LQIA 5FB0A 2MT5A 5I3LA 2Y1NA 5C13A 3RPGB 1WEPA 2ECIA 5H1VA 2I50A 2F6JA 3SOXA 4XI1A 2LN0A 2AN6A 2JMIA 5KH9A 3LRQA 1WESA 4FO9A 4Q6FA 2F6NA 3HCSA 2YW8A 4A4CA 4I7CA 1VD4A 5FERA 4O64A 3PUQA 4FJCA 2CKLB 2YHOA 1FBVA 2HYED 4N4FA 2VPDA 3HCUA 3M99A 3EB6A 2M85A 1F62A 4WZ3B 4QF3A 1WGMA 2VPBA 2MUMA 2JMDA 4QF2A 5LKUA 3O7AA 2VNFA 2ECGA 1Z60A 2FUIA 2PNXA 4P5OB 3PURA 2QIZA 5TBNA 3ZYQA 1WIMA 2C2VS 3ZPVE 3N9NA 4GB0A 1XWHA 4PTBA 2LQ6A 4B7YC 4IC3A 2FUUA 1WE9A 1IYMA 3M63A 1MM2A 2YSMA 3HTKC 2LV9A 2D8SA 3O34A 4CCGX 3U5NA 4WZ2A 1FP0A 2LXHC 5LKTA 3PHDA 5FEYA 4UI9B 4YABA 3LQHA 2L75A 3EB5A 2KWNA 2MA5A 3IHPA 4YADA 4WZ0A 2FSAA 4L7XA 1CHCA 2YHNA 4F52B 4FK5A 4YBTA 4GNGA 4N3WA 3U5PA 3VK6A 4R8PK 2IDAA 2L43A 2L80A 1Z6UA 4S3OC 5G04B 2LRIC 2ECTA 1K2FA 1VYXA 3KQIA 1Z2QA 3I2DA 5KH3A 2QJ0A 3C5KA 2K16A 2KGIA 5B79A 1WEEA 2E6RA 5B77A 2EODA 3KV5A 2BAYA 4LK9A 5AITA 2CT2A 3O35A 3U5OA 2MD8C 1N87A 4ZQLA 3C6WA 3N9MA 3DQVR 2QICA 2HDPA 2E6SA 3ZNIA 1WILA 2MNZA 3LQJA 4X3GA 2EGPA 2VJEB 3DPLR 5B75A 3GV4A 4NN2A 3O36A 2KE1A 2MIQA 2H0DA 2YT5A 5D1LB 4UP5A 2KFTA 5H1TA 3O33A 1HYJA 2MD7B 2JMJA 4LLBA 5B8DA 2MA6A 1T1HA 3RPGC 2VJFB 3N9OA 3N9QA 4AVXA 4R2YA 3T6RA 2PUYA 5B78A 1BORA 3RTRB 4R7EA 4AUQB 3SOUA 3MHSA 2VJFA 2LXPC 4LADB 4BHWA 4GNDA 2ECNA 1WEOA 4YBMA 3HCTA 2L0BA 1DVPA 2C2LA 5LCWB 5C11A 4S3OB 3O70A 5H1UA 1E4UA 1VFYA 3QZVA 2ECVA 2LGLA 2OXQC 2MNYA 2KWJA 2K17A 2M1RA 3FL2A 4B86C 4W4UA 5G05B 4AYCB 2G45A
chains in the Genus database with same CATH superfamily
3NG2A 2FD4A 2G6QA 4OGCA 5EYAF 5TDWA 1HYIA 4L58A 2DX8A 2Y1MA 4IC2A 4WA6A 5D1KB 2RI7A 1LDJB 1X4UA 2M6MA 3L11A 2KGGA 5G0FA 2DSMA 1WEVA 1WEWA 5FB1A 3KV6A 2KU3A 2VPEA 4Z0OA 5KH7A 2LGKA 4TKPB 4LKAA 3ZVZB 2XEUA 2ECWA 3L1ZB 2VJEA 3L1XA 3LVQE 5JG6A 2CONA 3SOWA 1JM7B 2UZGA 2XB1A 1WEMA 4A4BA 3E2DA 2JUNA 3DDTA 2KR4A 4A49A 5D1MB 4UP0A 4LJNA 2KKYA 2NAAA 3LVRE 4ZDTA 2CKLA 5DKAA 1JOCA 2YQLA 3FEHA 1WEQA 2KWKA 1WFKA 4YC9A 2VP7A 4V3LC 4YATA 2JRJA 2YREA 4FIPA 1ZBDB 2CSYA 4CA1A 2YU4A 2K4DA 4I7BA 2G43A 2ZETC 4O62A 4AP4A 2YSJA 3FM8C 2F42A 2VPGA 2LGVA 4AYCA 2JM3A 2YYRA 2XP0A 1MM3A 3GL6A 4A0CD 3N9LA 3O37A 1WEUA 5B76A 1X4IA 5TRBA 3KDEC 4GNEA 2Y43A 2KKXA 3LJUX 4YBSA 2H0DB 2EA6A 4MVTA 4MSXA 2RSDA 4YAXA 5AIUA 2KYUA 1X4JA 2XOYA 3T7LA 2OWAA 3ZVYA 5TDRA 5DINA 2KWOA 2ECJA 4I7DA 2YURA 3N9PA 2LGGA 1U6GB 2YQMA 2YUCA 2M3HA 4GNFA 2RR4A 5J3XA 1LDKC 2KIZA 3SHBA 5TABA 3V43A 5LKXA 3ASLA 4C9ZA 5H9MA 5SVIA 4BBQA 3ZPV1 3ZTGA 3KNVA 3U5MA 4OGEA 4PPEA 2K1JA 3MHHA 5LKZA 2CSZA 3M62A 1WENA 3DWDA 4V3KC 2L5UA 1RMDA 1V87A 2LDRA 1G25A 1JM7A 4ZUXU 2KREA 3LQIA 3T9KA 5FB0A 2MT5A 5I3LA 2Y1NA 5C13A 2B0OE 3JUEA 1WEPA 3RPGB 2ECIA 5H1VA 2I50A 2F6JA 3SOXA 4XI1A 2LN0A 2AN6A 2DJAA 2JMIA 5KH9A 3LRQA 1WESA 4FO9A 4Q6FA 2F6NA 3HCSA 2YW8A 4A4CA 4I7CA 1VD4A 5FERA 4O64A 3H7HA 2YVRA 3PUQA 4FJCA 2CKLB 2YHOA 1FBVA 2HYED 4N4FA 2VPDA 2CSVA 3HCUA 3M99A 3EB6A 2M85A 1F62A 4WZ3B 3SUBA 4QF3A 1WGMA 2VPBA 2EGMA 2MUMA 2JMDA 5SVIB 4QF2A 5LKUA 3O7AA 2VNFA 2ECGA 1Z60A 2FUIA 2PNXA 2XOZA 4P5OB 3PURA 2D8UA 2QIZA 5TBNA 3ZYQA 1WIMA 2C2VS 3ZPVE 4H9DA 3N9NA 4GB0A 1XWHA 2E61A 4PTBA 2LQ6A 4B7YC 4IC3A 2FUUA 1WE9A 1IYMA 3M63A 1MM2A 1DCQA 2YSMA 3HTKC 2LV9A 2D8SA 3O34A 4CCGX 3U5NA 3O47A 4WZ2A 1FP0A 3LDYA 2LXHC 5LKTA 3FJUB 3PHDA 5FEYA 4UI9B 4YABA 1MBMA 3LQHA 2L75A 5K3QA 3EB5A 2KWNA 2MA5A 3IHPA 4YADA 4WZ0A 2FSAA 4L7XA 1CHCA 2YHNA 4F52B 4FK5A 4F1PA 2MKEA 4Z0RA 4YBTA 2M13A 4GNGA 4N3WA 3U5PA 3VK6A 4R8PK 3Q1DA 2IDAA 2L43A 2L80A 2CRWA 1Z6UA 4S3OC 5G04B 2LRIC 2ECTA 1K2FA 1VYXA 3KQIA 3I2DA 1Z2QA 5KH3A 2LAUA 2QJ0A 3C5KA 2K16A 3FANA 2KGIA 5B79A 1WEEA 2L7PA 2E6RA 5B77A 2EODA 3KV5A 2BAYA 4LK9A 5AITA 2CT2A 3O35A 3U5OA 2MD8C 1N87A 4ZQLA 3C6WA 3N9MA 3DQVR 2QICA 2HDPA 2E6SA 5SVYA 3ZNIA 1WILA 2MNZA 3LQJA 4X3GA 2EGPA 2VJEB 3DPLR 5B75A 3GV4A 2P57A 4NN2A 3O36A 2KE1A 2MIQA 2H0DA 2YT5A 5D1LB 3FAOA 4UP5A 2KFTA 5H1TA 4QQ4A 3M7KA 3O33A 1HYJA 2MD7B 2JMJA 2IQJA 4LLBA 5B8DA 2MA6A 1T1HA 3RPGC 2VJFB 5SVXA 2EXUA 3N9OA 3N9QA 4R2YA 4AVXA 3T6RA 2PUYA 5B78A 1BORA 3RTRB 4R7EA 4AUQB 3SOUA 3MHSA 2CRRA 2VJFA 2FFWA 2LXPC 4LADB 4BHWA 4GNDA 2ECNA 1WEOA 3MDBC 4YBMA 3HCTA 2L0BA 1DVPA 2C2LA 5LCWB 5C11A 4S3OB 3O70A 3PLWA 5H1UA 1E4UA 1VFYA 3QZVA 2ECVA 2LGLA 2OXQC 2MNYA 2KWJA 2K17A 2M1RA 3FL2A 4W4UA 2XOCA 4B86C 5G05B 4AYCB 2G45A
chains in the Genus database with same CATH topology
3NG2A 2G6QA 5EYAF 5TDWA 1HYIA 4L58A 2DX8A 2Y1MA 4IC2A 4WA6A 5D1KB 2RI7A 1LDJB 1X4UA 2M6MA 3L11A 2KGGA 5G0FA 1WEVA 1WEWA 5FB1A 3KV6A 2KU3A 2VPEA 5KH7A 2LGKA 4TKPB 4LKAA 3ZVZB 2XEUA 2ECWA 3L1ZB 2VJEA 3L1XA 5JG6A 3SOWA 1JM7B 2UZGA 2XB1A 1WEMA 4A4BA 2KR4A 4A49A 5D1MB 4UP0A 4LJNA 2NAAA 4ZDTA 2CKLA 5DKAA 1JOCA 2YQLA 1WEQA 2KWKA 1WFKA 4YC9A 2VP7A 4V3LC 4YATA 2JRJA 2YREA 4FIPA 1ZBDB 2CSYA 4CA1A 2YU4A 2K4DA 4I7BA 2G43A 2ZETC 4AP4A 2YSJA 2F42A 2VPGA 2LGVA 4AYCA 2YYRA 1MM3A 3GL6A 4A0CD 3N9LA 3O37A 1WEUA 5B76A 1X4IA 5TRBA 4GNEA 2Y43A 4YBSA 2H0DB 2EA6A 4MVTA 4MSXA 2RSDA 4YAXA 5AIUA 2KYUA 1X4JA 3T7LA 3ZVYA 5TDRA 5DINA 2KWOA 2ECJA 4I7DA 2YURA 3N9PA 2LGGA 1U6GB 2YQMA 2YUCA 2M3HA 4GNFA 5J3XA 1LDKC 2KIZA 3SHBA 5TABA 3V43A 5LKXA 3ASLA 4C9ZA 5H9MA 4BBQA 3ZPV1 3ZTGA 3KNVA 3U5MA 4PPEA 2K1JA 3MHHA 5LKZA 2CSZA 3M62A 1WENA 4V3KC 2L5UA 1RMDA 1V87A 2LDRA 1G25A 1JM7A 4ZUXU 2KREA 3LQIA 5FB0A 2MT5A 5I3LA 2Y1NA 5C13A 3RPGB 1WEPA 2ECIA 5H1VA 2I50A 2F6JA 3SOXA 4XI1A 2LN0A 2AN6A 2JMIA 5KH9A 3LRQA 1WESA 4FO9A 4Q6FA 2F6NA 3HCSA 2YW8A 4A4CA 4I7CA 1VD4A 5FERA 4O64A 3PUQA 4FJCA 2CKLB 2YHOA 1FBVA 2HYED 4N4FA 2VPDA 3HCUA 3M99A 3EB6A 2M85A 1F62A 4WZ3B 4QF3A 1WGMA 2VPBA 2MUMA 2JMDA 4QF2A 5LKUA 3O7AA 2VNFA 2ECGA 1Z60A 2FUIA 2PNXA 4P5OB 3PURA 2QIZA 5TBNA 3ZYQA 1WIMA 2C2VS 3ZPVE 3N9NA 4GB0A 1XWHA 4PTBA 2LQ6A 4B7YC 4IC3A 2FUUA 1WE9A 1IYMA 3M63A 1MM2A 2YSMA 3HTKC 2LV9A 2D8SA 3O34A 4CCGX 3U5NA 4WZ2A 1FP0A 2LXHC 5LKTA 3PHDA 5FEYA 4UI9B 4YABA 3LQHA 2L75A 3EB5A 2KWNA 2MA5A 3IHPA 4YADA 4WZ0A 2FSAA 4L7XA 1CHCA 2YHNA 4F52B 4FK5A 4YBTA 4GNGA 4N3WA 3U5PA 3VK6A 4R8PK 2IDAA 2L43A 2L80A 1Z6UA 4S3OC 5G04B 2LRIC 2ECTA 1K2FA 1VYXA 3KQIA 1Z2QA 3I2DA 5KH3A 2QJ0A 3C5KA 2K16A 2KGIA 5B79A 1WEEA 2E6RA 5B77A 2EODA 3KV5A 2BAYA 4LK9A 5AITA 2CT2A 3O35A 3U5OA 2MD8C 1N87A 4ZQLA 3C6WA 3N9MA 3DQVR 2QICA 2HDPA 2E6SA 3ZNIA 1WILA 2MNZA 3LQJA 4X3GA 2EGPA 2VJEB 3DPLR 5B75A 3GV4A 4NN2A 3O36A 2KE1A 2MIQA 2H0DA 2YT5A 5D1LB 4UP5A 2KFTA 5H1TA 3O33A 1HYJA 2MD7B 2JMJA 4LLBA 5B8DA 2MA6A 1T1HA 3RPGC 2VJFB 3N9OA 3N9QA 4AVXA 4R2YA 3T6RA 2PUYA 5B78A 1BORA 3RTRB 4R7EA 4AUQB 3SOUA 3MHSA 2VJFA 2LXPC 4LADB 4BHWA 4GNDA 2ECNA 1WEOA 4YBMA 3HCTA 2L0BA 1DVPA 2C2LA 5LCWB 5C11A 4S3OB 3O70A 5H1UA 1E4UA 1VFYA 3QZVA 2ECVA 2LGLA 2OXQC 2MNYA 2KWJA 2K17A 2M1RA 3FL2A 4B86C 4W4UA 5G05B 4AYCB 2G45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NG2 A;  2G6Q A;  5EYA F;  5TDW A;  1HYI A;  4L58 A;  2DX8 A;  2Y1M A;  4IC2 A;  4WA6 A;  5D1K B;  2RI7 A;  1LDJ B;  1X4U A;  2M6M A;  3L11 A;  2KGG A;  5G0F A;  1WEV A;  1WEW A;  5FB1 A;  3KV6 A;  2KU3 A;  2VPE A;  5KH7 A;  2LGK A;  4TKP B;  4LKA A;  3ZVZ B;  2XEU A;  2ECW A;  3L1Z B;  2VJE A;  3L1X A;  5JG6 A;  3SOW A;  1JM7 B;  2UZG A;  2XB1 A;  1WEM A;  4A4B A;  2KR4 A;  4A49 A;  5D1M B;  4UP0 A;  4LJN A;  2NAA A;  4ZDT A;  2CKL A;  5DKA A;  1JOC A;  2YQL A;  1WEQ A;  2KWK A;  1WFK A;  4YC9 A;  2VP7 A;  4V3L C;  4YAT A;  2JRJ A;  2YRE A;  4FIP A;  1ZBD B;  2CSY A;  4CA1 A;  2YU4 A;  2K4D A;  4I7B A;  2G43 A;  2ZET C;  4AP4 A;  2YSJ A;  2F42 A;  2VPG A;  2LGV A;  4AYC A;  2YYR A;  1MM3 A;  3GL6 A;  4A0C D;  3N9L A;  3O37 A;  1WEU A;  5B76 A;  1X4I A;  5TRB A;  4GNE A;  2Y43 A;  4YBS A;  2H0D B;  2EA6 A;  4MVT A;  4MSX A;  2RSD A;  4YAX A;  5AIU A;  2KYU A;  1X4J A;  3T7L A;  3ZVY A;  5TDR A;  5DIN A;  2KWO A;  2ECJ A;  4I7D A;  2YUR A;  3N9P A;  2LGG A;  1U6G B;  2YQM A;  2YUC A;  2M3H A;  4GNF A;  5J3X A;  1LDK C;  2KIZ A;  3SHB A;  5TAB A;  3V43 A;  5LKX A;  3ASL A;  4C9Z A;  5H9M A;  4BBQ A;  3ZPV 1;  3ZTG A;  3KNV A;  3U5M A;  4PPE A;  2K1J A;  3MHH A;  5LKZ A;  2CSZ A;  3M62 A;  1WEN A;  4V3K C;  2L5U A;  1RMD A;  1V87 A;  2LDR A;  1G25 A;  1JM7 A;  4ZUX U;  2KRE A;  3LQI A;  5FB0 A;  2MT5 A;  5I3L A;  2Y1N A;  5C13 A;  3RPG B;  1WEP A;  2ECI A;  5H1V A;  2I50 A;  2F6J A;  3SOX A;  4XI1 A;  2LN0 A;  2AN6 A;  2JMI A;  5KH9 A;  3LRQ A;  1WES A;  4FO9 A;  4Q6F A;  2F6N A;  3HCS A;  2YW8 A;  4A4C A;  4I7C A;  1VD4 A;  5FER A;  4O64 A;  3PUQ A;  4FJC A;  2CKL B;  2YHO A;  1FBV A;  2HYE D;  4N4F A;  2VPD A;  3HCU A;  3M99 A;  3EB6 A;  2M85 A;  1F62 A;  4WZ3 B;  4QF3 A;  1WGM A;  2VPB A;  2MUM A;  2JMD A;  4QF2 A;  5LKU A;  3O7A A;  2VNF A;  2ECG A;  1Z60 A;  2FUI A;  2PNX A;  4P5O B;  3PUR A;  2QIZ A;  5TBN A;  3ZYQ A;  1WIM A;  2C2V S;  3ZPV E;  3N9N A;  4GB0 A;  1XWH A;  4PTB A;  2LQ6 A;  4B7Y C;  4IC3 A;  2FUU A;  1WE9 A;  1IYM A;  3M63 A;  1MM2 A;  2YSM A;  3HTK C;  2LV9 A;  2D8S A;  3O34 A;  4CCG X;  3U5N A;  4WZ2 A;  1FP0 A;  2LXH C;  5LKT A;  3PHD A;  5FEY A;  4UI9 B;  4YAB A;  3LQH A;  2L75 A;  3EB5 A;  2KWN A;  2MA5 A;  3IHP A;  4YAD A;  4WZ0 A;  2FSA A;  4L7X A;  1CHC A;  2YHN A;  4F52 B;  4FK5 A;  4YBT A;  4GNG A;  4N3W A;  3U5P A;  3VK6 A;  4R8P K;  2IDA A;  2L43 A;  2L80 A;  1Z6U A;  4S3O C;  5G04 B;  2LRI C;  2ECT A;  1K2F A;  1VYX A;  3KQI A;  1Z2Q A;  3I2D A;  5KH3 A;  2QJ0 A;  3C5K A;  2K16 A;  2KGI A;  5B79 A;  1WEE A;  2E6R A;  5B77 A;  2EOD A;  3KV5 A;  2BAY A;  4LK9 A;  5AIT A;  2CT2 A;  3O35 A;  3U5O A;  2MD8 C;  1N87 A;  4ZQL A;  3C6W A;  3N9M A;  3DQV R;  2QIC A;  2HDP A;  2E6S A;  3ZNI A;  1WIL A;  2MNZ A;  3LQJ A;  4X3G A;  2EGP A;  2VJE B;  3DPL R;  5B75 A;  3GV4 A;  4NN2 A;  3O36 A;  2KE1 A;  2MIQ A;  2H0D A;  2YT5 A;  5D1L B;  4UP5 A;  2KFT A;  5H1T A;  3O33 A;  1HYJ A;  2MD7 B;  2JMJ A;  4LLB A;  5B8D A;  2MA6 A;  1T1H A;  3RPG C;  2VJF B;  3N9O A;  3N9Q A;  4AVX A;  4R2Y A;  3T6R A;  2PUY A;  5B78 A;  1BOR A;  3RTR B;  4R7E A;  4AUQ B;  3SOU A;  3MHS A;  2VJF A;  2LXP C;  4LAD B;  4BHW A;  4GND A;  2ECN A;  1WEO A;  4YBM A;  3HCT A;  2L0B A;  1DVP A;  2C2L A;  5LCW B;  5C11 A;  4S3O B;  3O70 A;  5H1U A;  1E4U A;  1VFY A;  3QZV A;  2ECV A;  2LGL A;  2OXQ C;  2MNY A;  2KWJ A;  2K17 A;  2M1R A;  3FL2 A;  4B86 C;  4W4U A;  5G05 B;  4AYC B;  2G45 A; 
#chains in the Genus database with same CATH topology
 3NG2 A;  2FD4 A;  2G6Q A;  4OGC A;  5EYA F;  5TDW A;  1HYI A;  4L58 A;  2DX8 A;  2Y1M A;  4IC2 A;  4WA6 A;  5D1K B;  2RI7 A;  1LDJ B;  1X4U A;  2M6M A;  3L11 A;  2KGG A;  5G0F A;  2DSM A;  1WEV A;  1WEW A;  5FB1 A;  3KV6 A;  2KU3 A;  2VPE A;  4Z0O A;  5KH7 A;  2LGK A;  4TKP B;  4LKA A;  3ZVZ B;  2XEU A;  2ECW A;  3L1Z B;  2VJE A;  3L1X A;  3LVQ E;  5JG6 A;  2CON A;  3SOW A;  1JM7 B;  2UZG A;  2XB1 A;  1WEM A;  4A4B A;  3E2D A;  2JUN A;  3DDT A;  2KR4 A;  4A49 A;  5D1M B;  4UP0 A;  4LJN A;  2KKY A;  2NAA A;  3LVR E;  4ZDT A;  2CKL A;  5DKA A;  1JOC A;  2YQL A;  3FEH A;  1WEQ A;  2KWK A;  1WFK A;  4YC9 A;  2VP7 A;  4V3L C;  4YAT A;  2JRJ A;  2YRE A;  4FIP A;  1ZBD B;  2CSY A;  4CA1 A;  2YU4 A;  2K4D A;  4I7B A;  2G43 A;  2ZET C;  4O62 A;  4AP4 A;  2YSJ A;  3FM8 C;  2F42 A;  2VPG A;  2LGV A;  4AYC A;  2JM3 A;  2YYR A;  2XP0 A;  1MM3 A;  3GL6 A;  4A0C D;  3N9L A;  3O37 A;  1WEU A;  5B76 A;  1X4I A;  5TRB A;  3KDE C;  4GNE A;  2Y43 A;  2KKX A;  3LJU X;  4YBS A;  2H0D B;  2EA6 A;  4MVT A;  4MSX A;  2RSD A;  4YAX A;  5AIU A;  2KYU A;  1X4J A;  2XOY A;  3T7L A;  2OWA A;  3ZVY A;  5TDR A;  5DIN A;  2KWO A;  2ECJ A;  4I7D A;  2YUR A;  3N9P A;  2LGG A;  1U6G B;  2YQM A;  2YUC A;  2M3H A;  4GNF A;  2RR4 A;  5J3X A;  1LDK C;  2KIZ A;  3SHB A;  5TAB A;  3V43 A;  5LKX A;  3ASL A;  4C9Z A;  5H9M A;  5SVI A;  4BBQ A;  3ZPV 1;  3ZTG A;  3KNV A;  3U5M A;  4OGE A;  4PPE A;  2K1J A;  3MHH A;  5LKZ A;  2CSZ A;  3M62 A;  1WEN A;  3DWD A;  4V3K C;  2L5U A;  1RMD A;  1V87 A;  2LDR A;  1G25 A;  1JM7 A;  4ZUX U;  2KRE A;  3LQI A;  3T9K A;  5FB0 A;  2MT5 A;  5I3L A;  2Y1N A;  5C13 A;  2B0O E;  3JUE A;  1WEP A;  3RPG B;  2ECI A;  5H1V A;  2I50 A;  2F6J A;  3SOX A;  4XI1 A;  2LN0 A;  2AN6 A;  2DJA A;  2JMI A;  5KH9 A;  3LRQ A;  1WES A;  4FO9 A;  4Q6F A;  2F6N A;  3HCS A;  2YW8 A;  4A4C A;  4I7C A;  1VD4 A;  5FER A;  4O64 A;  3H7H A;  2YVR A;  3PUQ A;  4FJC A;  2CKL B;  2YHO A;  1FBV A;  2HYE D;  4N4F A;  2VPD A;  2CSV A;  3HCU A;  3M99 A;  3EB6 A;  2M85 A;  1F62 A;  4WZ3 B;  3SUB A;  4QF3 A;  1WGM A;  2VPB A;  2EGM A;  2MUM A;  2JMD A;  5SVI B;  4QF2 A;  5LKU A;  3O7A A;  2VNF A;  2ECG A;  1Z60 A;  2FUI A;  2PNX A;  2XOZ A;  4P5O B;  3PUR A;  2D8U A;  2QIZ A;  5TBN A;  3ZYQ A;  1WIM A;  2C2V S;  3ZPV E;  4H9D A;  3N9N A;  4GB0 A;  1XWH A;  2E61 A;  4PTB A;  2LQ6 A;  4B7Y C;  4IC3 A;  2FUU A;  1WE9 A;  1IYM A;  3M63 A;  1MM2 A;  1DCQ A;  2YSM A;  3HTK C;  2LV9 A;  2D8S A;  3O34 A;  4CCG X;  3U5N A;  3O47 A;  4WZ2 A;  1FP0 A;  3LDY A;  2LXH C;  5LKT A;  3FJU B;  3PHD A;  5FEY A;  4UI9 B;  4YAB A;  1MBM A;  3LQH A;  2L75 A;  5K3Q A;  3EB5 A;  2KWN A;  2MA5 A;  3IHP A;  4YAD A;  4WZ0 A;  2FSA A;  4L7X A;  1CHC A;  2YHN A;  4F52 B;  4FK5 A;  4F1P A;  2MKE A;  4Z0R A;  4YBT A;  2M13 A;  4GNG A;  4N3W A;  3U5P A;  3VK6 A;  4R8P K;  3Q1D A;  2IDA A;  2L43 A;  2L80 A;  2CRW A;  1Z6U A;  4S3O C;  5G04 B;  2LRI C;  2ECT A;  1K2F A;  1VYX A;  3KQI A;  3I2D A;  1Z2Q A;  5KH3 A;  2LAU A;  2QJ0 A;  3C5K A;  2K16 A;  3FAN A;  2KGI A;  5B79 A;  1WEE A;  2L7P A;  2E6R A;  5B77 A;  2EOD A;  3KV5 A;  2BAY A;  4LK9 A;  5AIT A;  2CT2 A;  3O35 A;  3U5O A;  2MD8 C;  1N87 A;  4ZQL A;  3C6W A;  3N9M A;  3DQV R;  2QIC A;  2HDP A;  2E6S A;  5SVY A;  3ZNI A;  1WIL A;  2MNZ A;  3LQJ A;  4X3G A;  2EGP A;  2VJE B;  3DPL R;  5B75 A;  3GV4 A;  2P57 A;  4NN2 A;  3O36 A;  2KE1 A;  2MIQ A;  2H0D A;  2YT5 A;  5D1L B;  3FAO A;  4UP5 A;  2KFT A;  5H1T A;  4QQ4 A;  3M7K A;  3O33 A;  1HYJ A;  2MD7 B;  2JMJ A;  2IQJ A;  4LLB A;  5B8D A;  2MA6 A;  1T1H A;  3RPG C;  2VJF B;  5SVX A;  2EXU A;  3N9O A;  3N9Q A;  4R2Y A;  4AVX A;  3T6R A;  2PUY A;  5B78 A;  1BOR A;  3RTR B;  4R7E A;  4AUQ B;  3SOU A;  3MHS A;  2CRR A;  2VJF A;  2FFW A;  2LXP C;  4LAD B;  4BHW A;  4GND A;  2ECN A;  1WEO A;  3MDB C;  4YBM A;  3HCT A;  2L0B A;  1DVP A;  2C2L A;  5LCW B;  5C11 A;  4S3O B;  3O70 A;  3PLW A;  5H1U A;  1E4U A;  1VFY A;  3QZV A;  2ECV A;  2LGL A;  2OXQ C;  2MNY A;  2KWJ A;  2K17 A;  2M1R A;  3FL2 A;  4W4U A;  2XOC A;  4B86 C;  5G05 B;  4AYC B;  2G45 A; 
#chains in the Genus database with same CATH homology
 3NG2 A;  2G6Q A;  5EYA F;  5TDW A;  1HYI A;  4L58 A;  2DX8 A;  2Y1M A;  4IC2 A;  4WA6 A;  5D1K B;  2RI7 A;  1LDJ B;  1X4U A;  2M6M A;  3L11 A;  2KGG A;  5G0F A;  1WEV A;  1WEW A;  5FB1 A;  3KV6 A;  2KU3 A;  2VPE A;  5KH7 A;  2LGK A;  4TKP B;  4LKA A;  3ZVZ B;  2XEU A;  2ECW A;  3L1Z B;  2VJE A;  3L1X A;  5JG6 A;  3SOW A;  1JM7 B;  2UZG A;  2XB1 A;  1WEM A;  4A4B A;  2KR4 A;  4A49 A;  5D1M B;  4UP0 A;  4LJN A;  2NAA A;  4ZDT A;  2CKL A;  5DKA A;  1JOC A;  2YQL A;  1WEQ A;  2KWK A;  1WFK A;  4YC9 A;  2VP7 A;  4V3L C;  4YAT A;  2JRJ A;  2YRE A;  4FIP A;  1ZBD B;  2CSY A;  4CA1 A;  2YU4 A;  2K4D A;  4I7B A;  2G43 A;  2ZET C;  4AP4 A;  2YSJ A;  2F42 A;  2VPG A;  2LGV A;  4AYC A;  2YYR A;  1MM3 A;  3GL6 A;  4A0C D;  3N9L A;  3O37 A;  1WEU A;  5B76 A;  1X4I A;  5TRB A;  4GNE A;  2Y43 A;  4YBS A;  2H0D B;  2EA6 A;  4MVT A;  4MSX A;  2RSD A;  4YAX A;  5AIU A;  2KYU A;  1X4J A;  3T7L A;  3ZVY A;  5TDR A;  5DIN A;  2KWO A;  2ECJ A;  4I7D A;  2YUR A;  3N9P A;  2LGG A;  1U6G B;  2YQM A;  2YUC A;  2M3H A;  4GNF A;  5J3X A;  1LDK C;  2KIZ A;  3SHB A;  5TAB A;  3V43 A;  5LKX A;  3ASL A;  4C9Z A;  5H9M A;  4BBQ A;  3ZPV 1;  3ZTG A;  3KNV A;  3U5M A;  4PPE A;  2K1J A;  3MHH A;  5LKZ A;  2CSZ A;  3M62 A;  1WEN A;  4V3K C;  2L5U A;  1RMD A;  1V87 A;  2LDR A;  1G25 A;  1JM7 A;  4ZUX U;  2KRE A;  3LQI A;  5FB0 A;  2MT5 A;  5I3L A;  2Y1N A;  5C13 A;  3RPG B;  1WEP A;  2ECI A;  5H1V A;  2I50 A;  2F6J A;  3SOX A;  4XI1 A;  2LN0 A;  2AN6 A;  2JMI A;  5KH9 A;  3LRQ A;  1WES A;  4FO9 A;  4Q6F A;  2F6N A;  3HCS A;  2YW8 A;  4A4C A;  4I7C A;  1VD4 A;  5FER A;  4O64 A;  3PUQ A;  4FJC A;  2CKL B;  2YHO A;  1FBV A;  2HYE D;  4N4F A;  2VPD A;  3HCU A;  3M99 A;  3EB6 A;  2M85 A;  1F62 A;  4WZ3 B;  4QF3 A;  1WGM A;  2VPB A;  2MUM A;  2JMD A;  4QF2 A;  5LKU A;  3O7A A;  2VNF A;  2ECG A;  1Z60 A;  2FUI A;  2PNX A;  4P5O B;  3PUR A;  2QIZ A;  5TBN A;  3ZYQ A;  1WIM A;  2C2V S;  3ZPV E;  3N9N A;  4GB0 A;  1XWH A;  4PTB A;  2LQ6 A;  4B7Y C;  4IC3 A;  2FUU A;  1WE9 A;  1IYM A;  3M63 A;  1MM2 A;  2YSM A;  3HTK C;  2LV9 A;  2D8S A;  3O34 A;  4CCG X;  3U5N A;  4WZ2 A;  1FP0 A;  2LXH C;  5LKT A;  3PHD A;  5FEY A;  4UI9 B;  4YAB A;  3LQH A;  2L75 A;  3EB5 A;  2KWN A;  2MA5 A;  3IHP A;  4YAD A;  4WZ0 A;  2FSA A;  4L7X A;  1CHC A;  2YHN A;  4F52 B;  4FK5 A;  4YBT A;  4GNG A;  4N3W A;  3U5P A;  3VK6 A;  4R8P K;  2IDA A;  2L43 A;  2L80 A;  1Z6U A;  4S3O C;  5G04 B;  2LRI C;  2ECT A;  1K2F A;  1VYX A;  3KQI A;  1Z2Q A;  3I2D A;  5KH3 A;  2QJ0 A;  3C5K A;  2K16 A;  2KGI A;  5B79 A;  1WEE A;  2E6R A;  5B77 A;  2EOD A;  3KV5 A;  2BAY A;  4LK9 A;  5AIT A;  2CT2 A;  3O35 A;  3U5O A;  2MD8 C;  1N87 A;  4ZQL A;  3C6W A;  3N9M A;  3DQV R;  2QIC A;  2HDP A;  2E6S A;  3ZNI A;  1WIL A;  2MNZ A;  3LQJ A;  4X3G A;  2EGP A;  2VJE B;  3DPL R;  5B75 A;  3GV4 A;  4NN2 A;  3O36 A;  2KE1 A;  2MIQ A;  2H0D A;  2YT5 A;  5D1L B;  4UP5 A;  2KFT A;  5H1T A;  3O33 A;  1HYJ A;  2MD7 B;  2JMJ A;  4LLB A;  5B8D A;  2MA6 A;  1T1H A;  3RPG C;  2VJF B;  3N9O A;  3N9Q A;  4AVX A;  4R2Y A;  3T6R A;  2PUY A;  5B78 A;  1BOR A;  3RTR B;  4R7E A;  4AUQ B;  3SOU A;  3MHS A;  2VJF A;  2LXP C;  4LAD B;  4BHW A;  4GND A;  2ECN A;  1WEO A;  4YBM A;  3HCT A;  2L0B A;  1DVP A;  2C2L A;  5LCW B;  5C11 A;  4S3O B;  3O70 A;  5H1U A;  1E4U A;  1VFY A;  3QZV A;  2ECV A;  2LGL A;  2OXQ C;  2MNY A;  2KWJ A;  2K17 A;  2M1R A;  3FL2 A;  4B86 C;  4W4U A;  5G05 B;  4AYC B;  2G45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...