5B75A

Crystal structure of moz double phd finger in complex with histone h3 butyrylation at k14
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
LPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b75A00
4W4UA 2KFTA 3HCSA 1WGMA 1JOCA 2VP7A 3T6RA 4MSXA 1WEWA 3PUQA 4WZ2A 2YU4A 2M6MA 5DINA 1VFYA 2CT2A 2YHOA 3U5MA 5H1UA 3N9QA 5LKUA 4FO9A 1T1HA 5B76A 2QIZA 2VPDA 4IC3A 2L80A 2VPGA 4I7BA 2MA5A 4GNEA 4YATA 1HYIA 3U5PA 3ZTGA 4AVXA 3KV6A 4P5OB 1Z6UA 2UZGA 4XI1A 2D8SA 3SHBA 4ZQLA 3LQHA 2LXHC 1WESA 1WEQA 2RSDA 3NG2A 4GNDA 3N9PA 3FL2A 2AN6A 2ECGA 5TRBA 5TABA 5LCWB 1BORA 3O34A 2F42A 2XEUA 4R2YA 3N9OA 2ECIA 2PUYA 5DKAA 2L43A 1RMDA 4CCGX 4TKPB 2VPBA 4Q6FA 2K4DA 2L0BA 3N9LA 1LDKC 1MM2A 3U5NA 1K2FA 2CKLB 4I7DA 1Z60A 1DVPA 1E4UA 2Y1MA 3V43A 2HDPA 2VPEA 3LRQA 4FJCA 4X3GA 3ASLA 3IHPA 1WEEA 1WEMA 4YBMA 2JMJA 1WEPA 2LV9A 4S3OC 3ZVZB 2M85A 3O37A 2YURA 1WILA 3N9MA 2E6RA 4GNGA 1Z2QA 2KIZA 2OXQC 2YQLA 4QF3A 3L1XA 4UP0A 3M63A 3DPLR 1XWHA 3MHSA 5KH9A 2EODA 2L75A 3QZVA 2KYUA 5FEYA 2MUMA 3L1ZB 2KGIA 2KWOA 2M1RA 5G0FA 3PHDA 4N4FA 2IDAA 4AUQB 1VD4A 2JMDA 2KGGA 2I50A 2LQ6A 4BHWA 2FUUA 2H0DA 5B78A 5I3LA 2L5UA 5B79A 4NN2A 2KR4A 3GL6A 3LQIA 5TDWA 1WEVA 3O35A 2CKLA 1V87A 2LGLA 2QICA 4C9ZA 4WA6A 4PPEA 3T7LA 1IYMA 3O36A 5FERA 5LKTA 3O70A 4YADA 1VYXA 5J3XA 3SOXA 4LADB 4YBTA 2K16A 2MNZA 4R7EA 1CHCA 5B75A 2KREA 2VJEB 2YSJA 2LDRA 2H0DB 5FB1A 4AP4A 1WEOA 1WFKA 2MIQA 2PNXA 4MVTA 4ZUXU 5TDRA 4GNFA 3ZPVE 5EYAF 3M62A 4L58A 2LN0A 3I2DA 5D1KB 5KH7A 1X4UA 2ECTA 3GV4A 2YHNA 5H1VA 4PTBA 2YW8A 1FP0A 4V3KC 1HYJA 5JG6A 4YAXA 5C11A 2G43A 4A49A 2ECVA 2CSZA 4A0CD 4YBSA 5B8DA 2RI7A 3MHHA 2VJFA 4L7XA 1ZBDB 4FIPA 1MM3A 3RPGC 2MD7B 1WIMA 2BAYA 4AYCA 3L11A 3PURA 3VK6A 2EA6A 1G25A 1X4JA 4B7YC 2YT5A 4UI9B 2K17A 2ZETC 2KE1A 5G05B 2YREA 3HCTA 2VJEA 5AIUA 2LRIC 1JM7B 4O64A 3O7AA 2LGKA 2M3HA 2KWNA 2JMIA 2EGPA 2MD8C 4LJNA 3O33A 3C5KA 4FK5A 4WZ3B 3RTRB 2VJFB 2E6SA 2FUIA 5G04B 3KQIA 2MNYA 4AYCB 2Y43A 5H9MA 4A4BA 3N9NA 3ZNIA 3LQJA 2ECWA 4YC9A 2LXPC 4LKAA 1WE9A 3M99A 5D1LB 5D1MB 1FBVA 2Y1NA 1WEUA 2LGVA 3SOWA 3ZPV1 4LK9A 3C6WA 4BBQA 3ZVYA 3HCUA 2F6JA 2XB1A 2YSMA 5FB0A 2ECNA 3ZYQA 4F52B 2HYED 4B86C 2C2VS 4QF2A 2KWKA 2ECJA 1F62A 5H1TA 1N87A 4WZ0A 4LLBA 5C13A 2DX8A 3DQVR 3EB5A 3KV5A 1JM7A 1WENA 4ZDTA 5B77A 1X4IA 4R8PK 5KH3A 2MT5A 5AITA 3SOUA 2LGGA 4S3OB 2FSAA 3HTKC 2YUCA 2QJ0A 4GB0A 2JRJA 1LDJB 2G6QA 2YQMA 3KNVA 5LKZA 2K1JA 4N3WA 3U5OA 5LKXA 2G45A 2KWJA 4V3LC 2C2LA 4YABA 5TBNA 1U6GB 2F6NA 2CSYA 2NAAA 4IC2A 4A4CA 2YYRA 4CA1A 3EB6A 4I7CA 3RPGB 2KU3A 4UP5A 2MA6A 2VNFA
chains in the Genus database with same CATH superfamily
4W4UA 2KFTA 3HCSA 1WGMA 1JOCA 2VP7A 3T6RA 4MSXA 1WEWA 3PUQA 4WZ2A 2YU4A 2M6MA 2YVRA 5DINA 1VFYA 2CT2A 2YHOA 3U5MA 5H1UA 2EGMA 3N9QA 5LKUA 4FO9A 1T1HA 2L7PA 2QIZA 5B76A 2VPDA 4IC3A 2L80A 2DSMA 4Z0OA 3MDBC 2VPGA 2XP0A 4I7BA 2MA5A 4GNEA 4YATA 1HYIA 3U5PA 3ZTGA 4AVXA 2XOCA 3KV6A 4P5OB 1Z6UA 2UZGA 4XI1A 2D8SA 3SHBA 2XOZA 3LQHA 4ZQLA 2LXHC 1DCQA 1WESA 1WEQA 4QQ4A 2RSDA 3NG2A 4GNDA 3N9PA 3FL2A 2AN6A 2ECGA 5TRBA 5TABA 5LCWB 1BORA 3O34A 2F42A 2XEUA 4R2YA 3N9OA 2ECIA 2PUYA 5DKAA 2L43A 1RMDA 2D8UA 4CCGX 4TKPB 2VPBA 4Q6FA 2K4DA 2L0BA 3N9LA 1LDKC 1MM2A 3U5NA 1K2FA 3E2DA 2CKLB 4I7DA 1Z60A 1DVPA 1E4UA 2Y1MA 3V43A 3LJUX 2HDPA 2VPEA 3LRQA 4FJCA 4X3GA 3ASLA 3IHPA 1WEEA 1WEMA 4YBMA 2JMJA 1WEPA 3FM8C 2LV9A 4S3OC 3ZVZB 2M85A 3O37A 2E61A 2YURA 1WILA 5K3QA 3N9MA 2E6RA 4GNGA 1Z2QA 2KIZA 2OXQC 2XOYA 2YQLA 4QF3A 3L1XA 2KKYA 4UP0A 3M63A 3DPLR 1XWHA 3MHSA 5KH9A 2EODA 2L75A 3QZVA 2KYUA 5FEYA 2MUMA 2LAUA 3L1ZB 2OWAA 2KGIA 2KWOA 2M1RA 5G0FA 3PHDA 4N4FA 2IDAA 4AUQB 1VD4A 2JMDA 2KGGA 2I50A 2LQ6A 4BHWA 2FUUA 2H0DA 5B78A 2M13A 5I3LA 2L5UA 5B79A 4NN2A 2IQJA 3LVRE 2KR4A 3GL6A 4H9DA 3LQIA 5TDWA 1WEVA 2FD4A 2FFWA 3O35A 2CKLA 1V87A 2LGLA 2QICA 4C9ZA 3H7HA 2KKXA 4WA6A 4PPEA 3T7LA 3LVQE 1IYMA 3O36A 5FERA 5LKTA 3O70A 4YADA 3JUEA 1VYXA 4Z0RA 5J3XA 3SOXA 4LADB 4YBTA 2CONA 2K16A 2MNZA 4R7EA 1CHCA 5B75A 2KREA 2VJEB 2YSJA 2LDRA 2H0DB 2CRWA 3FANA 5FB1A 4AP4A 1WEOA 1WFKA 4OGCA 2MIQA 2PNXA 4MVTA 4ZUXU 5TDRA 4GNFA 3ZPVE 3Q1DA 5EYAF 3M62A 4L58A 5SVIA 1MBMA 2LN0A 3I2DA 2RR4A 5D1KB 5KH7A 1X4UA 2ECTA 3GV4A 2YHNA 5H1VA 4PTBA 2YW8A 1FP0A 5SVXA 4V3KC 2MKEA 1HYJA 5JG6A 4YAXA 5C11A 2G43A 4A49A 2ECVA 2CSZA 4A0CD 4YBSA 5B8DA 2RI7A 3MHHA 2VJFA 4L7XA 1ZBDB 4FIPA 5SVIB 1MM3A 3RPGC 2MD7B 1WIMA 2BAYA 4AYCA 3L11A 3PURA 3VK6A 2EA6A 1G25A 1X4JA 4B7YC 3KDEC 2YT5A 4UI9B 2K17A 2ZETC 2KE1A 5G05B 2YREA 3HCTA 4O62A 2B0OE 2VJEA 5AIUA 2LRIC 1JM7B 4O64A 3O7AA 2LGKA 2M3HA 2KWNA 2JM3A 2JMIA 2EGPA 2MD8C 2EXUA 4OGEA 4LJNA 3O33A 3M7KA 3C5KA 4FK5A 4WZ3B 3RTRB 2VJFB 2E6SA 3DDTA 2FUIA 5G04B 3KQIA 2MNYA 4AYCB 2Y43A 5H9MA 4A4BA 3N9NA 3ZNIA 3LQJA 2ECWA 2CSVA 4YC9A 2LXPC 4LKAA 1WE9A 3M99A 5D1LB 5D1MB 1FBVA 2Y1NA 1WEUA 2LGVA 3FAOA 3SOWA 3ZPV1 4LK9A 3C6WA 4BBQA 3ZVYA 3HCUA 2F6JA 2XB1A 2YSMA 3DWDA 5FB0A 2ECNA 3ZYQA 3LDYA 4F52B 2HYED 3FEHA 4B86C 2C2VS 4QF2A 2KWKA 2ECJA 1F62A 5H1TA 1N87A 4WZ0A 4LLBA 5C13A 2DX8A 3DQVR 3T9KA 3EB5A 3KV5A 3PLWA 1JM7A 2DJAA 1WENA 4ZDTA 5B77A 1X4IA 4R8PK 5KH3A 4F1PA 2MT5A 5AITA 3SOUA 2LGGA 4S3OB 2FSAA 3HTKC 2YUCA 2QJ0A 4GB0A 2JRJA 1LDJB 2G6QA 2YQMA 3KNVA 5LKZA 2K1JA 4N3WA 3U5OA 2P57A 5LKXA 2G45A 2CRRA 2KWJA 4V3LC 2C2LA 4YABA 3SUBA 5TBNA 1U6GB 2F6NA 2JUNA 2CSYA 2NAAA 4IC2A 4A4CA 2YYRA 4CA1A 5SVYA 3EB6A 3FJUB 4I7CA 3RPGB 2KU3A 4UP5A 2MA6A 2VNFA 3O47A
chains in the Genus database with same CATH topology
4W4UA 2KFTA 3HCSA 1WGMA 1JOCA 2VP7A 3T6RA 4MSXA 1WEWA 3PUQA 4WZ2A 2YU4A 2M6MA 5DINA 1VFYA 2CT2A 2YHOA 3U5MA 5H1UA 3N9QA 5LKUA 4FO9A 1T1HA 5B76A 2QIZA 2VPDA 4IC3A 2L80A 2VPGA 4I7BA 2MA5A 4GNEA 4YATA 1HYIA 3U5PA 3ZTGA 4AVXA 3KV6A 4P5OB 1Z6UA 2UZGA 4XI1A 2D8SA 3SHBA 4ZQLA 3LQHA 2LXHC 1WESA 1WEQA 2RSDA 3NG2A 4GNDA 3N9PA 3FL2A 2AN6A 2ECGA 5TRBA 5TABA 5LCWB 1BORA 3O34A 2F42A 2XEUA 4R2YA 3N9OA 2ECIA 2PUYA 5DKAA 2L43A 1RMDA 4CCGX 4TKPB 2VPBA 4Q6FA 2K4DA 2L0BA 3N9LA 1LDKC 1MM2A 3U5NA 1K2FA 2CKLB 4I7DA 1Z60A 1DVPA 1E4UA 2Y1MA 3V43A 2HDPA 2VPEA 3LRQA 4FJCA 4X3GA 3ASLA 3IHPA 1WEEA 1WEMA 4YBMA 2JMJA 1WEPA 2LV9A 4S3OC 3ZVZB 2M85A 3O37A 2YURA 1WILA 3N9MA 2E6RA 4GNGA 1Z2QA 2KIZA 2OXQC 2YQLA 4QF3A 3L1XA 4UP0A 3M63A 3DPLR 1XWHA 3MHSA 5KH9A 2EODA 2L75A 3QZVA 2KYUA 5FEYA 2MUMA 3L1ZB 2KGIA 2KWOA 2M1RA 5G0FA 3PHDA 4N4FA 2IDAA 4AUQB 1VD4A 2JMDA 2KGGA 2I50A 2LQ6A 4BHWA 2FUUA 2H0DA 5B78A 5I3LA 2L5UA 5B79A 4NN2A 2KR4A 3GL6A 3LQIA 5TDWA 1WEVA 3O35A 2CKLA 1V87A 2LGLA 2QICA 4C9ZA 4WA6A 4PPEA 3T7LA 1IYMA 3O36A 5FERA 5LKTA 3O70A 4YADA 1VYXA 5J3XA 3SOXA 4LADB 4YBTA 2K16A 2MNZA 4R7EA 1CHCA 5B75A 2KREA 2VJEB 2YSJA 2LDRA 2H0DB 5FB1A 4AP4A 1WEOA 1WFKA 2MIQA 2PNXA 4MVTA 4ZUXU 5TDRA 4GNFA 3ZPVE 5EYAF 3M62A 4L58A 2LN0A 3I2DA 5D1KB 5KH7A 1X4UA 2ECTA 3GV4A 2YHNA 5H1VA 4PTBA 2YW8A 1FP0A 4V3KC 1HYJA 5JG6A 4YAXA 5C11A 2G43A 4A49A 2ECVA 2CSZA 4A0CD 4YBSA 5B8DA 2RI7A 3MHHA 2VJFA 4L7XA 1ZBDB 4FIPA 1MM3A 3RPGC 2MD7B 1WIMA 2BAYA 4AYCA 3L11A 3PURA 3VK6A 2EA6A 1G25A 1X4JA 4B7YC 2YT5A 4UI9B 2K17A 2ZETC 2KE1A 5G05B 2YREA 3HCTA 2VJEA 5AIUA 2LRIC 1JM7B 4O64A 3O7AA 2LGKA 2M3HA 2KWNA 2JMIA 2EGPA 2MD8C 4LJNA 3O33A 3C5KA 4FK5A 4WZ3B 3RTRB 2VJFB 2E6SA 2FUIA 5G04B 3KQIA 2MNYA 4AYCB 2Y43A 5H9MA 4A4BA 3N9NA 3ZNIA 3LQJA 2ECWA 4YC9A 2LXPC 4LKAA 1WE9A 3M99A 5D1LB 5D1MB 1FBVA 2Y1NA 1WEUA 2LGVA 3SOWA 3ZPV1 4LK9A 3C6WA 4BBQA 3ZVYA 3HCUA 2F6JA 2XB1A 2YSMA 5FB0A 2ECNA 3ZYQA 4F52B 2HYED 4B86C 2C2VS 4QF2A 2KWKA 2ECJA 1F62A 5H1TA 1N87A 4WZ0A 4LLBA 5C13A 2DX8A 3DQVR 3EB5A 3KV5A 1JM7A 1WENA 4ZDTA 5B77A 1X4IA 4R8PK 5KH3A 2MT5A 5AITA 3SOUA 2LGGA 4S3OB 2FSAA 3HTKC 2YUCA 2QJ0A 4GB0A 2JRJA 1LDJB 2G6QA 2YQMA 3KNVA 5LKZA 2K1JA 4N3WA 3U5OA 5LKXA 2G45A 2KWJA 4V3LC 2C2LA 4YABA 5TBNA 1U6GB 2F6NA 2CSYA 2NAAA 4IC2A 4A4CA 2YYRA 4CA1A 3EB6A 4I7CA 3RPGB 2KU3A 4UP5A 2MA6A 2VNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  2KFT A;  3HCS A;  1WGM A;  1JOC A;  2VP7 A;  3T6R A;  4MSX A;  1WEW A;  3PUQ A;  4WZ2 A;  2YU4 A;  2M6M A;  5DIN A;  1VFY A;  2CT2 A;  2YHO A;  3U5M A;  5H1U A;  3N9Q A;  5LKU A;  4FO9 A;  1T1H A;  5B76 A;  2QIZ A;  2VPD A;  4IC3 A;  2L80 A;  2VPG A;  4I7B A;  2MA5 A;  4GNE A;  4YAT A;  1HYI A;  3U5P A;  3ZTG A;  4AVX A;  3KV6 A;  4P5O B;  1Z6U A;  2UZG A;  4XI1 A;  2D8S A;  3SHB A;  4ZQL A;  3LQH A;  2LXH C;  1WES A;  1WEQ A;  2RSD A;  3NG2 A;  4GND A;  3N9P A;  3FL2 A;  2AN6 A;  2ECG A;  5TRB A;  5TAB A;  5LCW B;  1BOR A;  3O34 A;  2F42 A;  2XEU A;  4R2Y A;  3N9O A;  2ECI A;  2PUY A;  5DKA A;  2L43 A;  1RMD A;  4CCG X;  4TKP B;  2VPB A;  4Q6F A;  2K4D A;  2L0B A;  3N9L A;  1LDK C;  1MM2 A;  3U5N A;  1K2F A;  2CKL B;  4I7D A;  1Z60 A;  1DVP A;  1E4U A;  2Y1M A;  3V43 A;  2HDP A;  2VPE A;  3LRQ A;  4FJC A;  4X3G A;  3ASL A;  3IHP A;  1WEE A;  1WEM A;  4YBM A;  2JMJ A;  1WEP A;  2LV9 A;  4S3O C;  3ZVZ B;  2M85 A;  3O37 A;  2YUR A;  1WIL A;  3N9M A;  2E6R A;  4GNG A;  1Z2Q A;  2KIZ A;  2OXQ C;  2YQL A;  4QF3 A;  3L1X A;  4UP0 A;  3M63 A;  3DPL R;  1XWH A;  3MHS A;  5KH9 A;  2EOD A;  2L75 A;  3QZV A;  2KYU A;  5FEY A;  2MUM A;  3L1Z B;  2KGI A;  2KWO A;  2M1R A;  5G0F A;  3PHD A;  4N4F A;  2IDA A;  4AUQ B;  1VD4 A;  2JMD A;  2KGG A;  2I50 A;  2LQ6 A;  4BHW A;  2FUU A;  2H0D A;  5B78 A;  5I3L A;  2L5U A;  5B79 A;  4NN2 A;  2KR4 A;  3GL6 A;  3LQI A;  5TDW A;  1WEV A;  3O35 A;  2CKL A;  1V87 A;  2LGL A;  2QIC A;  4C9Z A;  4WA6 A;  4PPE A;  3T7L A;  1IYM A;  3O36 A;  5FER A;  5LKT A;  3O70 A;  4YAD A;  1VYX A;  5J3X A;  3SOX A;  4LAD B;  4YBT A;  2K16 A;  2MNZ A;  4R7E A;  1CHC A;  5B75 A;  2KRE A;  2VJE B;  2YSJ A;  2LDR A;  2H0D B;  5FB1 A;  4AP4 A;  1WEO A;  1WFK A;  2MIQ A;  2PNX A;  4MVT A;  4ZUX U;  5TDR A;  4GNF A;  3ZPV E;  5EYA F;  3M62 A;  4L58 A;  2LN0 A;  3I2D A;  5D1K B;  5KH7 A;  1X4U A;  2ECT A;  3GV4 A;  2YHN A;  5H1V A;  4PTB A;  2YW8 A;  1FP0 A;  4V3K C;  1HYJ A;  5JG6 A;  4YAX A;  5C11 A;  2G43 A;  4A49 A;  2ECV A;  2CSZ A;  4A0C D;  4YBS A;  5B8D A;  2RI7 A;  3MHH A;  2VJF A;  4L7X A;  1ZBD B;  4FIP A;  1MM3 A;  3RPG C;  2MD7 B;  1WIM A;  2BAY A;  4AYC A;  3L11 A;  3PUR A;  3VK6 A;  2EA6 A;  1G25 A;  1X4J A;  4B7Y C;  2YT5 A;  4UI9 B;  2K17 A;  2ZET C;  2KE1 A;  5G05 B;  2YRE A;  3HCT A;  2VJE A;  5AIU A;  2LRI C;  1JM7 B;  4O64 A;  3O7A A;  2LGK A;  2M3H A;  2KWN A;  2JMI A;  2EGP A;  2MD8 C;  4LJN A;  3O33 A;  3C5K A;  4FK5 A;  4WZ3 B;  3RTR B;  2VJF B;  2E6S A;  2FUI A;  5G04 B;  3KQI A;  2MNY A;  4AYC B;  2Y43 A;  5H9M A;  4A4B A;  3N9N A;  3ZNI A;  3LQJ A;  2ECW A;  4YC9 A;  2LXP C;  4LKA A;  1WE9 A;  3M99 A;  5D1L B;  5D1M B;  1FBV A;  2Y1N A;  1WEU A;  2LGV A;  3SOW A;  3ZPV 1;  4LK9 A;  3C6W A;  4BBQ A;  3ZVY A;  3HCU A;  2F6J A;  2XB1 A;  2YSM A;  5FB0 A;  2ECN A;  3ZYQ A;  4F52 B;  2HYE D;  4B86 C;  2C2V S;  4QF2 A;  2KWK A;  2ECJ A;  1F62 A;  5H1T A;  1N87 A;  4WZ0 A;  4LLB A;  5C13 A;  2DX8 A;  3DQV R;  3EB5 A;  3KV5 A;  1JM7 A;  1WEN A;  4ZDT A;  5B77 A;  1X4I A;  4R8P K;  5KH3 A;  2MT5 A;  5AIT A;  3SOU A;  2LGG A;  4S3O B;  2FSA A;  3HTK C;  2YUC A;  2QJ0 A;  4GB0 A;  2JRJ A;  1LDJ B;  2G6Q A;  2YQM A;  3KNV A;  5LKZ A;  2K1J A;  4N3W A;  3U5O A;  5LKX A;  2G45 A;  2KWJ A;  4V3L C;  2C2L A;  4YAB A;  5TBN A;  1U6G B;  2F6N A;  2CSY A;  2NAA A;  4IC2 A;  4A4C A;  2YYR A;  4CA1 A;  3EB6 A;  4I7C A;  3RPG B;  2KU3 A;  4UP5 A;  2MA6 A;  2VNF A; 
#chains in the Genus database with same CATH topology
 4W4U A;  2KFT A;  3HCS A;  1WGM A;  1JOC A;  2VP7 A;  3T6R A;  4MSX A;  1WEW A;  3PUQ A;  4WZ2 A;  2YU4 A;  2M6M A;  2YVR A;  5DIN A;  1VFY A;  2CT2 A;  2YHO A;  3U5M A;  5H1U A;  2EGM A;  3N9Q A;  5LKU A;  4FO9 A;  1T1H A;  2L7P A;  2QIZ A;  5B76 A;  2VPD A;  4IC3 A;  2L80 A;  2DSM A;  4Z0O A;  3MDB C;  2VPG A;  2XP0 A;  4I7B A;  2MA5 A;  4GNE A;  4YAT A;  1HYI A;  3U5P A;  3ZTG A;  4AVX A;  2XOC A;  3KV6 A;  4P5O B;  1Z6U A;  2UZG A;  4XI1 A;  2D8S A;  3SHB A;  2XOZ A;  3LQH A;  4ZQL A;  2LXH C;  1DCQ A;  1WES A;  1WEQ A;  4QQ4 A;  2RSD A;  3NG2 A;  4GND A;  3N9P A;  3FL2 A;  2AN6 A;  2ECG A;  5TRB A;  5TAB A;  5LCW B;  1BOR A;  3O34 A;  2F42 A;  2XEU A;  4R2Y A;  3N9O A;  2ECI A;  2PUY A;  5DKA A;  2L43 A;  1RMD A;  2D8U A;  4CCG X;  4TKP B;  2VPB A;  4Q6F A;  2K4D A;  2L0B A;  3N9L A;  1LDK C;  1MM2 A;  3U5N A;  1K2F A;  3E2D A;  2CKL B;  4I7D A;  1Z60 A;  1DVP A;  1E4U A;  2Y1M A;  3V43 A;  3LJU X;  2HDP A;  2VPE A;  3LRQ A;  4FJC A;  4X3G A;  3ASL A;  3IHP A;  1WEE A;  1WEM A;  4YBM A;  2JMJ A;  1WEP A;  3FM8 C;  2LV9 A;  4S3O C;  3ZVZ B;  2M85 A;  3O37 A;  2E61 A;  2YUR A;  1WIL A;  5K3Q A;  3N9M A;  2E6R A;  4GNG A;  1Z2Q A;  2KIZ A;  2OXQ C;  2XOY A;  2YQL A;  4QF3 A;  3L1X A;  2KKY A;  4UP0 A;  3M63 A;  3DPL R;  1XWH A;  3MHS A;  5KH9 A;  2EOD A;  2L75 A;  3QZV A;  2KYU A;  5FEY A;  2MUM A;  2LAU A;  3L1Z B;  2OWA A;  2KGI A;  2KWO A;  2M1R A;  5G0F A;  3PHD A;  4N4F A;  2IDA A;  4AUQ B;  1VD4 A;  2JMD A;  2KGG A;  2I50 A;  2LQ6 A;  4BHW A;  2FUU A;  2H0D A;  5B78 A;  2M13 A;  5I3L A;  2L5U A;  5B79 A;  4NN2 A;  2IQJ A;  3LVR E;  2KR4 A;  3GL6 A;  4H9D A;  3LQI A;  5TDW A;  1WEV A;  2FD4 A;  2FFW A;  3O35 A;  2CKL A;  1V87 A;  2LGL A;  2QIC A;  4C9Z A;  3H7H A;  2KKX A;  4WA6 A;  4PPE A;  3T7L A;  3LVQ E;  1IYM A;  3O36 A;  5FER A;  5LKT A;  3O70 A;  4YAD A;  3JUE A;  1VYX A;  4Z0R A;  5J3X A;  3SOX A;  4LAD B;  4YBT A;  2CON A;  2K16 A;  2MNZ A;  4R7E A;  1CHC A;  5B75 A;  2KRE A;  2VJE B;  2YSJ A;  2LDR A;  2H0D B;  2CRW A;  3FAN A;  5FB1 A;  4AP4 A;  1WEO A;  1WFK A;  4OGC A;  2MIQ A;  2PNX A;  4MVT A;  4ZUX U;  5TDR A;  4GNF A;  3ZPV E;  3Q1D A;  5EYA F;  3M62 A;  4L58 A;  5SVI A;  1MBM A;  2LN0 A;  3I2D A;  2RR4 A;  5D1K B;  5KH7 A;  1X4U A;  2ECT A;  3GV4 A;  2YHN A;  5H1V A;  4PTB A;  2YW8 A;  1FP0 A;  5SVX A;  4V3K C;  2MKE A;  1HYJ A;  5JG6 A;  4YAX A;  5C11 A;  2G43 A;  4A49 A;  2ECV A;  2CSZ A;  4A0C D;  4YBS A;  5B8D A;  2RI7 A;  3MHH A;  2VJF A;  4L7X A;  1ZBD B;  4FIP A;  5SVI B;  1MM3 A;  3RPG C;  2MD7 B;  1WIM A;  2BAY A;  4AYC A;  3L11 A;  3PUR A;  3VK6 A;  2EA6 A;  1G25 A;  1X4J A;  4B7Y C;  3KDE C;  2YT5 A;  4UI9 B;  2K17 A;  2ZET C;  2KE1 A;  5G05 B;  2YRE A;  3HCT A;  4O62 A;  2B0O E;  2VJE A;  5AIU A;  2LRI C;  1JM7 B;  4O64 A;  3O7A A;  2LGK A;  2M3H A;  2KWN A;  2JM3 A;  2JMI A;  2EGP A;  2MD8 C;  2EXU A;  4OGE A;  4LJN A;  3O33 A;  3M7K A;  3C5K A;  4FK5 A;  4WZ3 B;  3RTR B;  2VJF B;  2E6S A;  3DDT A;  2FUI A;  5G04 B;  3KQI A;  2MNY A;  4AYC B;  2Y43 A;  5H9M A;  4A4B A;  3N9N A;  3ZNI A;  3LQJ A;  2ECW A;  2CSV A;  4YC9 A;  2LXP C;  4LKA A;  1WE9 A;  3M99 A;  5D1L B;  5D1M B;  1FBV A;  2Y1N A;  1WEU A;  2LGV A;  3FAO A;  3SOW A;  3ZPV 1;  4LK9 A;  3C6W A;  4BBQ A;  3ZVY A;  3HCU A;  2F6J A;  2XB1 A;  2YSM A;  3DWD A;  5FB0 A;  2ECN A;  3ZYQ A;  3LDY A;  4F52 B;  2HYE D;  3FEH A;  4B86 C;  2C2V S;  4QF2 A;  2KWK A;  2ECJ A;  1F62 A;  5H1T A;  1N87 A;  4WZ0 A;  4LLB A;  5C13 A;  2DX8 A;  3DQV R;  3T9K A;  3EB5 A;  3KV5 A;  3PLW A;  1JM7 A;  2DJA A;  1WEN A;  4ZDT A;  5B77 A;  1X4I A;  4R8P K;  5KH3 A;  4F1P A;  2MT5 A;  5AIT A;  3SOU A;  2LGG A;  4S3O B;  2FSA A;  3HTK C;  2YUC A;  2QJ0 A;  4GB0 A;  2JRJ A;  1LDJ B;  2G6Q A;  2YQM A;  3KNV A;  5LKZ A;  2K1J A;  4N3W A;  3U5O A;  2P57 A;  5LKX A;  2G45 A;  2CRR A;  2KWJ A;  4V3L C;  2C2L A;  4YAB A;  3SUB A;  5TBN A;  1U6G B;  2F6N A;  2JUN A;  2CSY A;  2NAA A;  4IC2 A;  4A4C A;  2YYR A;  4CA1 A;  5SVY A;  3EB6 A;  3FJU B;  4I7C A;  3RPG B;  2KU3 A;  4UP5 A;  2MA6 A;  2VNF A;  3O47 A; 
#chains in the Genus database with same CATH homology
 4W4U A;  2KFT A;  3HCS A;  1WGM A;  1JOC A;  2VP7 A;  3T6R A;  4MSX A;  1WEW A;  3PUQ A;  4WZ2 A;  2YU4 A;  2M6M A;  5DIN A;  1VFY A;  2CT2 A;  2YHO A;  3U5M A;  5H1U A;  3N9Q A;  5LKU A;  4FO9 A;  1T1H A;  5B76 A;  2QIZ A;  2VPD A;  4IC3 A;  2L80 A;  2VPG A;  4I7B A;  2MA5 A;  4GNE A;  4YAT A;  1HYI A;  3U5P A;  3ZTG A;  4AVX A;  3KV6 A;  4P5O B;  1Z6U A;  2UZG A;  4XI1 A;  2D8S A;  3SHB A;  4ZQL A;  3LQH A;  2LXH C;  1WES A;  1WEQ A;  2RSD A;  3NG2 A;  4GND A;  3N9P A;  3FL2 A;  2AN6 A;  2ECG A;  5TRB A;  5TAB A;  5LCW B;  1BOR A;  3O34 A;  2F42 A;  2XEU A;  4R2Y A;  3N9O A;  2ECI A;  2PUY A;  5DKA A;  2L43 A;  1RMD A;  4CCG X;  4TKP B;  2VPB A;  4Q6F A;  2K4D A;  2L0B A;  3N9L A;  1LDK C;  1MM2 A;  3U5N A;  1K2F A;  2CKL B;  4I7D A;  1Z60 A;  1DVP A;  1E4U A;  2Y1M A;  3V43 A;  2HDP A;  2VPE A;  3LRQ A;  4FJC A;  4X3G A;  3ASL A;  3IHP A;  1WEE A;  1WEM A;  4YBM A;  2JMJ A;  1WEP A;  2LV9 A;  4S3O C;  3ZVZ B;  2M85 A;  3O37 A;  2YUR A;  1WIL A;  3N9M A;  2E6R A;  4GNG A;  1Z2Q A;  2KIZ A;  2OXQ C;  2YQL A;  4QF3 A;  3L1X A;  4UP0 A;  3M63 A;  3DPL R;  1XWH A;  3MHS A;  5KH9 A;  2EOD A;  2L75 A;  3QZV A;  2KYU A;  5FEY A;  2MUM A;  3L1Z B;  2KGI A;  2KWO A;  2M1R A;  5G0F A;  3PHD A;  4N4F A;  2IDA A;  4AUQ B;  1VD4 A;  2JMD A;  2KGG A;  2I50 A;  2LQ6 A;  4BHW A;  2FUU A;  2H0D A;  5B78 A;  5I3L A;  2L5U A;  5B79 A;  4NN2 A;  2KR4 A;  3GL6 A;  3LQI A;  5TDW A;  1WEV A;  3O35 A;  2CKL A;  1V87 A;  2LGL A;  2QIC A;  4C9Z A;  4WA6 A;  4PPE A;  3T7L A;  1IYM A;  3O36 A;  5FER A;  5LKT A;  3O70 A;  4YAD A;  1VYX A;  5J3X A;  3SOX A;  4LAD B;  4YBT A;  2K16 A;  2MNZ A;  4R7E A;  1CHC A;  5B75 A;  2KRE A;  2VJE B;  2YSJ A;  2LDR A;  2H0D B;  5FB1 A;  4AP4 A;  1WEO A;  1WFK A;  2MIQ A;  2PNX A;  4MVT A;  4ZUX U;  5TDR A;  4GNF A;  3ZPV E;  5EYA F;  3M62 A;  4L58 A;  2LN0 A;  3I2D A;  5D1K B;  5KH7 A;  1X4U A;  2ECT A;  3GV4 A;  2YHN A;  5H1V A;  4PTB A;  2YW8 A;  1FP0 A;  4V3K C;  1HYJ A;  5JG6 A;  4YAX A;  5C11 A;  2G43 A;  4A49 A;  2ECV A;  2CSZ A;  4A0C D;  4YBS A;  5B8D A;  2RI7 A;  3MHH A;  2VJF A;  4L7X A;  1ZBD B;  4FIP A;  1MM3 A;  3RPG C;  2MD7 B;  1WIM A;  2BAY A;  4AYC A;  3L11 A;  3PUR A;  3VK6 A;  2EA6 A;  1G25 A;  1X4J A;  4B7Y C;  2YT5 A;  4UI9 B;  2K17 A;  2ZET C;  2KE1 A;  5G05 B;  2YRE A;  3HCT A;  2VJE A;  5AIU A;  2LRI C;  1JM7 B;  4O64 A;  3O7A A;  2LGK A;  2M3H A;  2KWN A;  2JMI A;  2EGP A;  2MD8 C;  4LJN A;  3O33 A;  3C5K A;  4FK5 A;  4WZ3 B;  3RTR B;  2VJF B;  2E6S A;  2FUI A;  5G04 B;  3KQI A;  2MNY A;  4AYC B;  2Y43 A;  5H9M A;  4A4B A;  3N9N A;  3ZNI A;  3LQJ A;  2ECW A;  4YC9 A;  2LXP C;  4LKA A;  1WE9 A;  3M99 A;  5D1L B;  5D1M B;  1FBV A;  2Y1N A;  1WEU A;  2LGV A;  3SOW A;  3ZPV 1;  4LK9 A;  3C6W A;  4BBQ A;  3ZVY A;  3HCU A;  2F6J A;  2XB1 A;  2YSM A;  5FB0 A;  2ECN A;  3ZYQ A;  4F52 B;  2HYE D;  4B86 C;  2C2V S;  4QF2 A;  2KWK A;  2ECJ A;  1F62 A;  5H1T A;  1N87 A;  4WZ0 A;  4LLB A;  5C13 A;  2DX8 A;  3DQV R;  3EB5 A;  3KV5 A;  1JM7 A;  1WEN A;  4ZDT A;  5B77 A;  1X4I A;  4R8P K;  5KH3 A;  2MT5 A;  5AIT A;  3SOU A;  2LGG A;  4S3O B;  2FSA A;  3HTK C;  2YUC A;  2QJ0 A;  4GB0 A;  2JRJ A;  1LDJ B;  2G6Q A;  2YQM A;  3KNV A;  5LKZ A;  2K1J A;  4N3W A;  3U5O A;  5LKX A;  2G45 A;  2KWJ A;  4V3L C;  2C2L A;  4YAB A;  5TBN A;  1U6G B;  2F6N A;  2CSY A;  2NAA A;  4IC2 A;  4A4C A;  2YYR A;  4CA1 A;  3EB6 A;  4I7C A;  3RPG B;  2KU3 A;  4UP5 A;  2MA6 A;  2VNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...