5B75A

Crystal structure of moz double phd finger in complex with histone h3 butyrylation at k14
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
LPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b75A00
4LADB 1VYXA 1BORA 2CKLB 5FERA 2LGVA 3RPGB 2ECWA 1WGMA 1Z60A 5KH3A 4V3LC 1WEUA 2DX8A 2D8SA 2CT2A 4MVTA 4WZ3B 5TBNA 4GNGA 4FO9A 5G05B 3N9OA 5H1TA 2PUYA 4AP4A 3HCTA 4A0CD 4LJNA 4FIPA 1WESA 1X4IA 5J3XA 4CA1A 3O33A 4GNFA 4V3KC 3MHHA 3KNVA 2L80A 2VPEA 3U5OA 4AYCA 2EGPA 5FB1A 5TDWA 1CHCA 4BBQA 4QF3A 4YADA 2LRIC 2Y1MA 2ECJA 5I3LA 1DVPA 2MA5A 3PUQA 3ASLA 1X4JA 3L11A 1WEMA 1WFKA 3FL2A 1MM2A 4F52B 3N9NA 2M6MA 3IHPA 2HYED 5B79A 4WA6A 2LQ6A 5AIUA 4B7YC 4GNDA 4S3OC 5D1LB 3LQIA 5TRBA 2ECVA 4A49A 4X3GA 5B8DA 3O36A 3PHDA 2LV9A 3ZVZB 2H0DB 2LXHC 1U6GB 4AVXA 2KR4A 3SOXA 4W4UA 2FUIA 3O35A 2C2LA 4S3OB 1T1HA 2JMJA 2JMDA 3ZPVE 4L7XA 1WE9A 5EYAF 3N9QA 4L58A 2KFTA 4YBSA 3NG2A 2YSJA 2YUCA 3RTRB 4WZ0A 2MT5A 3HCUA 2RSDA 4YABA 4IC2A 2IDAA 1WEVA 3LQHA 5KH9A 2OXQC 3M63A 1G25A 4FJCA 2VJFB 5H1UA 2YSMA 4A4CA 4ZUXU 1XWHA 2LGGA 2M3HA 2Y1NA 1E4UA 1JM7A 3EB6A 1RMDA 5G04B 3KV5A 2KWJA 5C13A 2E6RA 2QJ0A 2YQMA 3KV6A 2LGLA 4UP5A 5B78A 4P5OB 2VJEA 4I7DA 2G6QA 1Z6UA 1LDKC 1WEOA 3DQVR 5B76A 4UI9B 2MA6A 1V87A 2C2VS 4Q6FA 2PNXA 5LKTA 2LGKA 3HTKC 5H1VA 1MM3A 2ECNA 3O70A 3L1ZB 1HYJA 2G45A 4YAXA 2FSAA 5LKUA 2KGIA 4LK9A 2YU4A 4UP0A 2KWOA 3EB5A 2CSZA 2E6SA 4YATA 2ECGA 4LLBA 4GNEA 2M85A 1LDJB 4FK5A 3N9PA 3M62A 3C5KA 1WEWA 4I7BA 4AYCB 2VPGA 5FEYA 2BAYA 5FB0A 4BHWA 3ZPV1 3U5MA 2UZGA 3O7AA 4LKAA 2K1JA 2MUMA 2YHOA 4ZDTA 4C9ZA 5LKXA 2KYUA 1FP0A 2VP7A 3O34A 4PPEA 1WIMA 5H9MA 2VNFA 2ECIA 4IC3A 4XI1A 1IYMA 2L75A 3DPLR 2RI7A 4R7EA 4NN2A 4AUQB 5B77A 2CKLA 2K17A 3I2DA 1F62A 5LCWB 2MD8C 4N4FA 4GB0A 3MHSA 2L5UA 5C11A 2Y43A 2F6NA 3N9MA 4ZQLA 2MNZA 4R2YA 2VPBA 3V43A 3ZTGA 5DKAA 2QIZA 2YT5A 3PURA 3GV4A 5G0FA 2LDRA 4YBMA 2KGGA 4B86C 2K16A 4QF2A 2KWKA 2XB1A 3T7LA 1ZBDB 2K4DA 2LN0A 5D1MB 3SOWA 2F6JA 5TABA 1JOCA 3KQIA 3N9LA 1JM7B 1VFYA 2EA6A 1WEEA 3ZYQA 5KH7A 2QICA 3ZNIA 5TDRA 4TKPB 3LQJA 2ECTA 2VJEB 5AITA 2KU3A 4A4BA 3C6WA 2YQLA 3GL6A 2H0DA 4WZ2A 2HDPA 5JG6A 2MD7B 2MNYA 3M99A 3ZVYA 5B75A 2JRJA 3O37A 2KE1A 4MSXA 2NAAA 2YYRA 5DINA 2F42A 2YW8A 2KIZA 2KWNA 2ZETC 2FUUA 2M1RA 3U5PA 3T6RA 2XEUA 3QZVA 4O64A 3SHBA 4CCGX 1N87A 1Z2QA 1FBVA 2AN6A 4R8PK 1K2FA 3LRQA 2I50A 2VPDA 2EODA 5D1KB 2MIQA 2VJFA 4YC9A 4YBTA 3HCSA 2L43A 2YHNA 3L1XA 4I7CA 2CSYA 3U5NA 2KREA 1WILA 2YREA 1WEPA 3SOUA 2JMIA 3RPGC 1WENA 1VD4A 1X4UA 2G43A 3VK6A 1WEQA 4N3WA 4PTBA 5LKZA 1HYIA 2YURA 2LXPC 2L0BA
chains in the Genus database with same CATH superfamily
4LADB 1VYXA 1BORA 3LJUX 2CKLB 5FERA 2LGVA 3RPGB 2ECWA 1WGMA 1Z60A 5KH3A 4V3LC 1WEUA 2DX8A 2D8SA 2CT2A 4MVTA 4WZ3B 5TBNA 4GNGA 4FO9A 4Z0OA 5G05B 3N9OA 5H1TA 2PUYA 4AP4A 3HCTA 4A0CD 4LJNA 4FIPA 1WESA 1X4IA 5J3XA 4CA1A 2L7PA 3O33A 4GNFA 4V3KC 3MHHA 3KNVA 2L80A 2VPEA 3U5OA 2EXUA 4AYCA 2EGPA 5FB1A 5TDWA 1CHCA 4BBQA 4QF3A 4YADA 2LRIC 2Y1MA 2ECJA 2KKYA 5I3LA 1DVPA 2MA5A 2B0OE 3PUQA 3ASLA 1X4JA 3L11A 1WEMA 3FANA 1WFKA 3FL2A 1MM2A 4F52B 3N9NA 2M6MA 3IHPA 2HYED 5B79A 4WA6A 2LQ6A 5AIUA 4B7YC 4GNDA 3Q1DA 4S3OC 5D1LB 3LQIA 5TRBA 2ECVA 4A49A 2LAUA 4X3GA 2RR4A 2E61A 5B8DA 3O36A 3PHDA 2LV9A 3ZVZB 2H0DB 2LXHC 1U6GB 2IQJA 4AVXA 2KR4A 3SOXA 4W4UA 2FUIA 3O35A 2C2LA 3FJUB 4S3OB 1T1HA 2JMJA 3H7HA 2YVRA 2JMDA 3T9KA 3ZPVE 4L7XA 1DCQA 1WE9A 5EYAF 3N9QA 4L58A 2KFTA 3PLWA 1MBMA 4YBSA 3NG2A 2YSJA 2P57A 2YUCA 2FFWA 5K3QA 3RTRB 2DJAA 4WZ0A 2MT5A 3HCUA 2RSDA 4YABA 3LVRE 4IC2A 5SVYA 2IDAA 1WEVA 4O62A 3LQHA 5KH9A 3FAOA 2OXQC 3M63A 1G25A 4FJCA 2DSMA 2VJFB 5H1UA 2YSMA 4A4CA 4ZUXU 1XWHA 2LGGA 2M3HA 2Y1NA 1E4UA 1JM7A 3EB6A 1RMDA 5G04B 3KV5A 2KWJA 5C13A 2E6RA 2QJ0A 2YQMA 3KV6A 2LGLA 2KKXA 4UP5A 5B78A 4P5OB 2VJEA 4I7DA 2G6QA 1Z6UA 1LDKC 2CRRA 1WEOA 3DQVR 5B76A 4UI9B 2MA6A 1V87A 2C2VS 4Z0RA 4Q6FA 2PNXA 5LKTA 2LGKA 3HTKC 5H1VA 1MM3A 2ECNA 3O70A 3L1ZB 1HYJA 2G45A 2M13A 4YAXA 2XOCA 2FSAA 5LKUA 2KGIA 4LK9A 2YU4A 4UP0A 2KWOA 3EB5A 2CSZA 2E6SA 4YATA 2ECGA 4LLBA 4GNEA 2M85A 1LDJB 4FK5A 3N9PA 3M62A 3C5KA 1WEWA 4I7BA 4AYCB 2VPGA 3KDEC 3E2DA 2BAYA 5FEYA 5SVIB 5FB0A 4BHWA 3ZPV1 3U5MA 2UZGA 3O7AA 4LKAA 2K1JA 2MUMA 2YHOA 4ZDTA 4C9ZA 5LKXA 2KYUA 1FP0A 2VP7A 3O34A 4PPEA 1WIMA 5H9MA 2VNFA 2ECIA 4IC3A 4XI1A 1IYMA 2L75A 4OGCA 3JUEA 3DPLR 2RI7A 4R7EA 4NN2A 4AUQB 5B77A 2CKLA 2K17A 3I2DA 1F62A 5LCWB 2MD8C 2CRWA 4N4FA 4GB0A 3MHSA 2L5UA 5C11A 2Y43A 2F6NA 3N9MA 4ZQLA 2MNZA 4R2YA 2VPBA 3V43A 3ZTGA 5DKAA 2QIZA 2YT5A 3PURA 3GV4A 5G0FA 2LDRA 3O47A 4YBMA 2KGGA 4B86C 2K16A 4QF2A 2EGMA 2KWKA 2XB1A 3T7LA 1ZBDB 2K4DA 2LN0A 5D1MB 3SOWA 2FD4A 2F6JA 5TABA 1JOCA 3KQIA 2MKEA 3N9LA 1JM7B 1VFYA 2EA6A 1WEEA 3ZYQA 5KH7A 2QICA 3ZNIA 5TDRA 3LDYA 2XP0A 4TKPB 3LQJA 2ECTA 3FEHA 2VJEB 5AITA 3M7KA 4H9DA 2KU3A 4A4BA 3C6WA 2YQLA 5SVIA 3GL6A 2H0DA 4WZ2A 2HDPA 5JG6A 2MD7B 2XOZA 2CSVA 2MNYA 2JUNA 4OGEA 3M99A 3ZVYA 5B75A 2JRJA 3O37A 2KE1A 4MSXA 2NAAA 2YYRA 5DINA 2JM3A 2F42A 2YW8A 2KIZA 2KWNA 2ZETC 2FUUA 2M1RA 3U5PA 3T6RA 2XEUA 3QZVA 3SUBA 4O64A 3SHBA 4CCGX 1N87A 1Z2QA 1FBVA 2AN6A 4QQ4A 1K2FA 4R8PK 3LRQA 2I50A 5SVXA 2VPDA 3FM8C 2EODA 5D1KB 2MIQA 2VJFA 4YC9A 4YBTA 4F1PA 3HCSA 2L43A 2YHNA 3L1XA 4I7CA 2CSYA 2D8UA 2OWAA 3DWDA 3U5NA 2KREA 2XOYA 1WILA 2CONA 2YREA 1WEPA 3SOUA 2JMIA 3MDBC 3RPGC 1WENA 1VD4A 1X4UA 2G43A 3VK6A 3LVQE 1WEQA 3DDTA 4N3WA 4PTBA 5LKZA 1HYIA 2YURA 2LXPC 2L0BA
chains in the Genus database with same CATH topology
4LADB 1VYXA 1BORA 2CKLB 5FERA 2LGVA 3RPGB 2ECWA 1WGMA 1Z60A 5KH3A 4V3LC 1WEUA 2DX8A 2D8SA 2CT2A 4MVTA 4WZ3B 5TBNA 4GNGA 4FO9A 5G05B 3N9OA 5H1TA 2PUYA 4AP4A 3HCTA 4A0CD 4LJNA 4FIPA 1WESA 1X4IA 5J3XA 4CA1A 3O33A 4GNFA 4V3KC 3MHHA 3KNVA 2L80A 2VPEA 3U5OA 4AYCA 2EGPA 5FB1A 5TDWA 1CHCA 4BBQA 4QF3A 4YADA 2LRIC 2Y1MA 2ECJA 5I3LA 1DVPA 2MA5A 3PUQA 3ASLA 1X4JA 3L11A 1WEMA 1WFKA 3FL2A 1MM2A 4F52B 3N9NA 2M6MA 3IHPA 2HYED 5B79A 4WA6A 2LQ6A 5AIUA 4B7YC 4GNDA 4S3OC 5D1LB 3LQIA 5TRBA 2ECVA 4A49A 4X3GA 5B8DA 3O36A 3PHDA 2LV9A 3ZVZB 2H0DB 2LXHC 1U6GB 4AVXA 2KR4A 3SOXA 4W4UA 2FUIA 3O35A 2C2LA 4S3OB 1T1HA 2JMJA 2JMDA 3ZPVE 4L7XA 1WE9A 5EYAF 3N9QA 4L58A 2KFTA 4YBSA 3NG2A 2YSJA 2YUCA 3RTRB 4WZ0A 2MT5A 3HCUA 2RSDA 4YABA 4IC2A 2IDAA 1WEVA 3LQHA 5KH9A 2OXQC 3M63A 1G25A 4FJCA 2VJFB 5H1UA 2YSMA 4A4CA 4ZUXU 1XWHA 2LGGA 2M3HA 2Y1NA 1E4UA 1JM7A 3EB6A 1RMDA 5G04B 3KV5A 2KWJA 5C13A 2E6RA 2QJ0A 2YQMA 3KV6A 2LGLA 4UP5A 5B78A 4P5OB 2VJEA 4I7DA 2G6QA 1Z6UA 1LDKC 1WEOA 3DQVR 5B76A 4UI9B 2MA6A 1V87A 2C2VS 4Q6FA 2PNXA 5LKTA 2LGKA 3HTKC 5H1VA 1MM3A 2ECNA 3O70A 3L1ZB 1HYJA 2G45A 4YAXA 2FSAA 5LKUA 2KGIA 4LK9A 2YU4A 4UP0A 2KWOA 3EB5A 2CSZA 2E6SA 4YATA 2ECGA 4LLBA 4GNEA 2M85A 1LDJB 4FK5A 3N9PA 3M62A 3C5KA 1WEWA 4I7BA 4AYCB 2VPGA 5FEYA 2BAYA 5FB0A 4BHWA 3ZPV1 3U5MA 2UZGA 3O7AA 4LKAA 2K1JA 2MUMA 2YHOA 4ZDTA 4C9ZA 5LKXA 2KYUA 1FP0A 2VP7A 3O34A 4PPEA 1WIMA 5H9MA 2VNFA 2ECIA 4IC3A 4XI1A 1IYMA 2L75A 3DPLR 2RI7A 4R7EA 4NN2A 4AUQB 5B77A 2CKLA 2K17A 3I2DA 1F62A 5LCWB 2MD8C 4N4FA 4GB0A 3MHSA 2L5UA 5C11A 2Y43A 2F6NA 3N9MA 4ZQLA 2MNZA 4R2YA 2VPBA 3V43A 3ZTGA 5DKAA 2QIZA 2YT5A 3PURA 3GV4A 5G0FA 2LDRA 4YBMA 2KGGA 4B86C 2K16A 4QF2A 2KWKA 2XB1A 3T7LA 1ZBDB 2K4DA 2LN0A 5D1MB 3SOWA 2F6JA 5TABA 1JOCA 3KQIA 3N9LA 1JM7B 1VFYA 2EA6A 1WEEA 3ZYQA 5KH7A 2QICA 3ZNIA 5TDRA 4TKPB 3LQJA 2ECTA 2VJEB 5AITA 2KU3A 4A4BA 3C6WA 2YQLA 3GL6A 2H0DA 4WZ2A 2HDPA 5JG6A 2MD7B 2MNYA 3M99A 3ZVYA 5B75A 2JRJA 3O37A 2KE1A 4MSXA 2NAAA 2YYRA 5DINA 2F42A 2YW8A 2KIZA 2KWNA 2ZETC 2FUUA 2M1RA 3U5PA 3T6RA 2XEUA 3QZVA 4O64A 3SHBA 4CCGX 1N87A 1Z2QA 1FBVA 2AN6A 4R8PK 1K2FA 3LRQA 2I50A 2VPDA 2EODA 5D1KB 2MIQA 2VJFA 4YC9A 4YBTA 3HCSA 2L43A 2YHNA 3L1XA 4I7CA 2CSYA 3U5NA 2KREA 1WILA 2YREA 1WEPA 3SOUA 2JMIA 3RPGC 1WENA 1VD4A 1X4UA 2G43A 3VK6A 1WEQA 4N3WA 4PTBA 5LKZA 1HYIA 2YURA 2LXPC 2L0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAD B;  1VYX A;  1BOR A;  2CKL B;  5FER A;  2LGV A;  3RPG B;  2ECW A;  1WGM A;  1Z60 A;  5KH3 A;  4V3L C;  1WEU A;  2DX8 A;  2D8S A;  2CT2 A;  4MVT A;  4WZ3 B;  5TBN A;  4GNG A;  4FO9 A;  5G05 B;  3N9O A;  5H1T A;  2PUY A;  4AP4 A;  3HCT A;  4A0C D;  4LJN A;  4FIP A;  1WES A;  1X4I A;  5J3X A;  4CA1 A;  3O33 A;  4GNF A;  4V3K C;  3MHH A;  3KNV A;  2L80 A;  2VPE A;  3U5O A;  4AYC A;  2EGP A;  5FB1 A;  5TDW A;  1CHC A;  4BBQ A;  4QF3 A;  4YAD A;  2LRI C;  2Y1M A;  2ECJ A;  5I3L A;  1DVP A;  2MA5 A;  3PUQ A;  3ASL A;  1X4J A;  3L11 A;  1WEM A;  1WFK A;  3FL2 A;  1MM2 A;  4F52 B;  3N9N A;  2M6M A;  3IHP A;  2HYE D;  5B79 A;  4WA6 A;  2LQ6 A;  5AIU A;  4B7Y C;  4GND A;  4S3O C;  5D1L B;  3LQI A;  5TRB A;  2ECV A;  4A49 A;  4X3G A;  5B8D A;  3O36 A;  3PHD A;  2LV9 A;  3ZVZ B;  2H0D B;  2LXH C;  1U6G B;  4AVX A;  2KR4 A;  3SOX A;  4W4U A;  2FUI A;  3O35 A;  2C2L A;  4S3O B;  1T1H A;  2JMJ A;  2JMD A;  3ZPV E;  4L7X A;  1WE9 A;  5EYA F;  3N9Q A;  4L58 A;  2KFT A;  4YBS A;  3NG2 A;  2YSJ A;  2YUC A;  3RTR B;  4WZ0 A;  2MT5 A;  3HCU A;  2RSD A;  4YAB A;  4IC2 A;  2IDA A;  1WEV A;  3LQH A;  5KH9 A;  2OXQ C;  3M63 A;  1G25 A;  4FJC A;  2VJF B;  5H1U A;  2YSM A;  4A4C A;  4ZUX U;  1XWH A;  2LGG A;  2M3H A;  2Y1N A;  1E4U A;  1JM7 A;  3EB6 A;  1RMD A;  5G04 B;  3KV5 A;  2KWJ A;  5C13 A;  2E6R A;  2QJ0 A;  2YQM A;  3KV6 A;  2LGL A;  4UP5 A;  5B78 A;  4P5O B;  2VJE A;  4I7D A;  2G6Q A;  1Z6U A;  1LDK C;  1WEO A;  3DQV R;  5B76 A;  4UI9 B;  2MA6 A;  1V87 A;  2C2V S;  4Q6F A;  2PNX A;  5LKT A;  2LGK A;  3HTK C;  5H1V A;  1MM3 A;  2ECN A;  3O70 A;  3L1Z B;  1HYJ A;  2G45 A;  4YAX A;  2FSA A;  5LKU A;  2KGI A;  4LK9 A;  2YU4 A;  4UP0 A;  2KWO A;  3EB5 A;  2CSZ A;  2E6S A;  4YAT A;  2ECG A;  4LLB A;  4GNE A;  2M85 A;  1LDJ B;  4FK5 A;  3N9P A;  3M62 A;  3C5K A;  1WEW A;  4I7B A;  4AYC B;  2VPG A;  5FEY A;  2BAY A;  5FB0 A;  4BHW A;  3ZPV 1;  3U5M A;  2UZG A;  3O7A A;  4LKA A;  2K1J A;  2MUM A;  2YHO A;  4ZDT A;  4C9Z A;  5LKX A;  2KYU A;  1FP0 A;  2VP7 A;  3O34 A;  4PPE A;  1WIM A;  5H9M A;  2VNF A;  2ECI A;  4IC3 A;  4XI1 A;  1IYM A;  2L75 A;  3DPL R;  2RI7 A;  4R7E A;  4NN2 A;  4AUQ B;  5B77 A;  2CKL A;  2K17 A;  3I2D A;  1F62 A;  5LCW B;  2MD8 C;  4N4F A;  4GB0 A;  3MHS A;  2L5U A;  5C11 A;  2Y43 A;  2F6N A;  3N9M A;  4ZQL A;  2MNZ A;  4R2Y A;  2VPB A;  3V43 A;  3ZTG A;  5DKA A;  2QIZ A;  2YT5 A;  3PUR A;  3GV4 A;  5G0F A;  2LDR A;  4YBM A;  2KGG A;  4B86 C;  2K16 A;  4QF2 A;  2KWK A;  2XB1 A;  3T7L A;  1ZBD B;  2K4D A;  2LN0 A;  5D1M B;  3SOW A;  2F6J A;  5TAB A;  1JOC A;  3KQI A;  3N9L A;  1JM7 B;  1VFY A;  2EA6 A;  1WEE A;  3ZYQ A;  5KH7 A;  2QIC A;  3ZNI A;  5TDR A;  4TKP B;  3LQJ A;  2ECT A;  2VJE B;  5AIT A;  2KU3 A;  4A4B A;  3C6W A;  2YQL A;  3GL6 A;  2H0D A;  4WZ2 A;  2HDP A;  5JG6 A;  2MD7 B;  2MNY A;  3M99 A;  3ZVY A;  5B75 A;  2JRJ A;  3O37 A;  2KE1 A;  4MSX A;  2NAA A;  2YYR A;  5DIN A;  2F42 A;  2YW8 A;  2KIZ A;  2KWN A;  2ZET C;  2FUU A;  2M1R A;  3U5P A;  3T6R A;  2XEU A;  3QZV A;  4O64 A;  3SHB A;  4CCG X;  1N87 A;  1Z2Q A;  1FBV A;  2AN6 A;  4R8P K;  1K2F A;  3LRQ A;  2I50 A;  2VPD A;  2EOD A;  5D1K B;  2MIQ A;  2VJF A;  4YC9 A;  4YBT A;  3HCS A;  2L43 A;  2YHN A;  3L1X A;  4I7C A;  2CSY A;  3U5N A;  2KRE A;  1WIL A;  2YRE A;  1WEP A;  3SOU A;  2JMI A;  3RPG C;  1WEN A;  1VD4 A;  1X4U A;  2G43 A;  3VK6 A;  1WEQ A;  4N3W A;  4PTB A;  5LKZ A;  1HYI A;  2YUR A;  2LXP C;  2L0B A; 
#chains in the Genus database with same CATH topology
 4LAD B;  1VYX A;  1BOR A;  3LJU X;  2CKL B;  5FER A;  2LGV A;  3RPG B;  2ECW A;  1WGM A;  1Z60 A;  5KH3 A;  4V3L C;  1WEU A;  2DX8 A;  2D8S A;  2CT2 A;  4MVT A;  4WZ3 B;  5TBN A;  4GNG A;  4FO9 A;  4Z0O A;  5G05 B;  3N9O A;  5H1T A;  2PUY A;  4AP4 A;  3HCT A;  4A0C D;  4LJN A;  4FIP A;  1WES A;  1X4I A;  5J3X A;  4CA1 A;  2L7P A;  3O33 A;  4GNF A;  4V3K C;  3MHH A;  3KNV A;  2L80 A;  2VPE A;  3U5O A;  2EXU A;  4AYC A;  2EGP A;  5FB1 A;  5TDW A;  1CHC A;  4BBQ A;  4QF3 A;  4YAD A;  2LRI C;  2Y1M A;  2ECJ A;  2KKY A;  5I3L A;  1DVP A;  2MA5 A;  2B0O E;  3PUQ A;  3ASL A;  1X4J A;  3L11 A;  1WEM A;  3FAN A;  1WFK A;  3FL2 A;  1MM2 A;  4F52 B;  3N9N A;  2M6M A;  3IHP A;  2HYE D;  5B79 A;  4WA6 A;  2LQ6 A;  5AIU A;  4B7Y C;  4GND A;  3Q1D A;  4S3O C;  5D1L B;  3LQI A;  5TRB A;  2ECV A;  4A49 A;  2LAU A;  4X3G A;  2RR4 A;  2E61 A;  5B8D A;  3O36 A;  3PHD A;  2LV9 A;  3ZVZ B;  2H0D B;  2LXH C;  1U6G B;  2IQJ A;  4AVX A;  2KR4 A;  3SOX A;  4W4U A;  2FUI A;  3O35 A;  2C2L A;  3FJU B;  4S3O B;  1T1H A;  2JMJ A;  3H7H A;  2YVR A;  2JMD A;  3T9K A;  3ZPV E;  4L7X A;  1DCQ A;  1WE9 A;  5EYA F;  3N9Q A;  4L58 A;  2KFT A;  3PLW A;  1MBM A;  4YBS A;  3NG2 A;  2YSJ A;  2P57 A;  2YUC A;  2FFW A;  5K3Q A;  3RTR B;  2DJA A;  4WZ0 A;  2MT5 A;  3HCU A;  2RSD A;  4YAB A;  3LVR E;  4IC2 A;  5SVY A;  2IDA A;  1WEV A;  4O62 A;  3LQH A;  5KH9 A;  3FAO A;  2OXQ C;  3M63 A;  1G25 A;  4FJC A;  2DSM A;  2VJF B;  5H1U A;  2YSM A;  4A4C A;  4ZUX U;  1XWH A;  2LGG A;  2M3H A;  2Y1N A;  1E4U A;  1JM7 A;  3EB6 A;  1RMD A;  5G04 B;  3KV5 A;  2KWJ A;  5C13 A;  2E6R A;  2QJ0 A;  2YQM A;  3KV6 A;  2LGL A;  2KKX A;  4UP5 A;  5B78 A;  4P5O B;  2VJE A;  4I7D A;  2G6Q A;  1Z6U A;  1LDK C;  2CRR A;  1WEO A;  3DQV R;  5B76 A;  4UI9 B;  2MA6 A;  1V87 A;  2C2V S;  4Z0R A;  4Q6F A;  2PNX A;  5LKT A;  2LGK A;  3HTK C;  5H1V A;  1MM3 A;  2ECN A;  3O70 A;  3L1Z B;  1HYJ A;  2G45 A;  2M13 A;  4YAX A;  2XOC A;  2FSA A;  5LKU A;  2KGI A;  4LK9 A;  2YU4 A;  4UP0 A;  2KWO A;  3EB5 A;  2CSZ A;  2E6S A;  4YAT A;  2ECG A;  4LLB A;  4GNE A;  2M85 A;  1LDJ B;  4FK5 A;  3N9P A;  3M62 A;  3C5K A;  1WEW A;  4I7B A;  4AYC B;  2VPG A;  3KDE C;  3E2D A;  2BAY A;  5FEY A;  5SVI B;  5FB0 A;  4BHW A;  3ZPV 1;  3U5M A;  2UZG A;  3O7A A;  4LKA A;  2K1J A;  2MUM A;  2YHO A;  4ZDT A;  4C9Z A;  5LKX A;  2KYU A;  1FP0 A;  2VP7 A;  3O34 A;  4PPE A;  1WIM A;  5H9M A;  2VNF A;  2ECI A;  4IC3 A;  4XI1 A;  1IYM A;  2L75 A;  4OGC A;  3JUE A;  3DPL R;  2RI7 A;  4R7E A;  4NN2 A;  4AUQ B;  5B77 A;  2CKL A;  2K17 A;  3I2D A;  1F62 A;  5LCW B;  2MD8 C;  2CRW A;  4N4F A;  4GB0 A;  3MHS A;  2L5U A;  5C11 A;  2Y43 A;  2F6N A;  3N9M A;  4ZQL A;  2MNZ A;  4R2Y A;  2VPB A;  3V43 A;  3ZTG A;  5DKA A;  2QIZ A;  2YT5 A;  3PUR A;  3GV4 A;  5G0F A;  2LDR A;  3O47 A;  4YBM A;  2KGG A;  4B86 C;  2K16 A;  4QF2 A;  2EGM A;  2KWK A;  2XB1 A;  3T7L A;  1ZBD B;  2K4D A;  2LN0 A;  5D1M B;  3SOW A;  2FD4 A;  2F6J A;  5TAB A;  1JOC A;  3KQI A;  2MKE A;  3N9L A;  1JM7 B;  1VFY A;  2EA6 A;  1WEE A;  3ZYQ A;  5KH7 A;  2QIC A;  3ZNI A;  5TDR A;  3LDY A;  2XP0 A;  4TKP B;  3LQJ A;  2ECT A;  3FEH A;  2VJE B;  5AIT A;  3M7K A;  4H9D A;  2KU3 A;  4A4B A;  3C6W A;  2YQL A;  5SVI A;  3GL6 A;  2H0D A;  4WZ2 A;  2HDP A;  5JG6 A;  2MD7 B;  2XOZ A;  2CSV A;  2MNY A;  2JUN A;  4OGE A;  3M99 A;  3ZVY A;  5B75 A;  2JRJ A;  3O37 A;  2KE1 A;  4MSX A;  2NAA A;  2YYR A;  5DIN A;  2JM3 A;  2F42 A;  2YW8 A;  2KIZ A;  2KWN A;  2ZET C;  2FUU A;  2M1R A;  3U5P A;  3T6R A;  2XEU A;  3QZV A;  3SUB A;  4O64 A;  3SHB A;  4CCG X;  1N87 A;  1Z2Q A;  1FBV A;  2AN6 A;  4QQ4 A;  1K2F A;  4R8P K;  3LRQ A;  2I50 A;  5SVX A;  2VPD A;  3FM8 C;  2EOD A;  5D1K B;  2MIQ A;  2VJF A;  4YC9 A;  4YBT A;  4F1P A;  3HCS A;  2L43 A;  2YHN A;  3L1X A;  4I7C A;  2CSY A;  2D8U A;  2OWA A;  3DWD A;  3U5N A;  2KRE A;  2XOY A;  1WIL A;  2CON A;  2YRE A;  1WEP A;  3SOU A;  2JMI A;  3MDB C;  3RPG C;  1WEN A;  1VD4 A;  1X4U A;  2G43 A;  3VK6 A;  3LVQ E;  1WEQ A;  3DDT A;  4N3W A;  4PTB A;  5LKZ A;  1HYI A;  2YUR A;  2LXP C;  2L0B A; 
#chains in the Genus database with same CATH homology
 4LAD B;  1VYX A;  1BOR A;  2CKL B;  5FER A;  2LGV A;  3RPG B;  2ECW A;  1WGM A;  1Z60 A;  5KH3 A;  4V3L C;  1WEU A;  2DX8 A;  2D8S A;  2CT2 A;  4MVT A;  4WZ3 B;  5TBN A;  4GNG A;  4FO9 A;  5G05 B;  3N9O A;  5H1T A;  2PUY A;  4AP4 A;  3HCT A;  4A0C D;  4LJN A;  4FIP A;  1WES A;  1X4I A;  5J3X A;  4CA1 A;  3O33 A;  4GNF A;  4V3K C;  3MHH A;  3KNV A;  2L80 A;  2VPE A;  3U5O A;  4AYC A;  2EGP A;  5FB1 A;  5TDW A;  1CHC A;  4BBQ A;  4QF3 A;  4YAD A;  2LRI C;  2Y1M A;  2ECJ A;  5I3L A;  1DVP A;  2MA5 A;  3PUQ A;  3ASL A;  1X4J A;  3L11 A;  1WEM A;  1WFK A;  3FL2 A;  1MM2 A;  4F52 B;  3N9N A;  2M6M A;  3IHP A;  2HYE D;  5B79 A;  4WA6 A;  2LQ6 A;  5AIU A;  4B7Y C;  4GND A;  4S3O C;  5D1L B;  3LQI A;  5TRB A;  2ECV A;  4A49 A;  4X3G A;  5B8D A;  3O36 A;  3PHD A;  2LV9 A;  3ZVZ B;  2H0D B;  2LXH C;  1U6G B;  4AVX A;  2KR4 A;  3SOX A;  4W4U A;  2FUI A;  3O35 A;  2C2L A;  4S3O B;  1T1H A;  2JMJ A;  2JMD A;  3ZPV E;  4L7X A;  1WE9 A;  5EYA F;  3N9Q A;  4L58 A;  2KFT A;  4YBS A;  3NG2 A;  2YSJ A;  2YUC A;  3RTR B;  4WZ0 A;  2MT5 A;  3HCU A;  2RSD A;  4YAB A;  4IC2 A;  2IDA A;  1WEV A;  3LQH A;  5KH9 A;  2OXQ C;  3M63 A;  1G25 A;  4FJC A;  2VJF B;  5H1U A;  2YSM A;  4A4C A;  4ZUX U;  1XWH A;  2LGG A;  2M3H A;  2Y1N A;  1E4U A;  1JM7 A;  3EB6 A;  1RMD A;  5G04 B;  3KV5 A;  2KWJ A;  5C13 A;  2E6R A;  2QJ0 A;  2YQM A;  3KV6 A;  2LGL A;  4UP5 A;  5B78 A;  4P5O B;  2VJE A;  4I7D A;  2G6Q A;  1Z6U A;  1LDK C;  1WEO A;  3DQV R;  5B76 A;  4UI9 B;  2MA6 A;  1V87 A;  2C2V S;  4Q6F A;  2PNX A;  5LKT A;  2LGK A;  3HTK C;  5H1V A;  1MM3 A;  2ECN A;  3O70 A;  3L1Z B;  1HYJ A;  2G45 A;  4YAX A;  2FSA A;  5LKU A;  2KGI A;  4LK9 A;  2YU4 A;  4UP0 A;  2KWO A;  3EB5 A;  2CSZ A;  2E6S A;  4YAT A;  2ECG A;  4LLB A;  4GNE A;  2M85 A;  1LDJ B;  4FK5 A;  3N9P A;  3M62 A;  3C5K A;  1WEW A;  4I7B A;  4AYC B;  2VPG A;  5FEY A;  2BAY A;  5FB0 A;  4BHW A;  3ZPV 1;  3U5M A;  2UZG A;  3O7A A;  4LKA A;  2K1J A;  2MUM A;  2YHO A;  4ZDT A;  4C9Z A;  5LKX A;  2KYU A;  1FP0 A;  2VP7 A;  3O34 A;  4PPE A;  1WIM A;  5H9M A;  2VNF A;  2ECI A;  4IC3 A;  4XI1 A;  1IYM A;  2L75 A;  3DPL R;  2RI7 A;  4R7E A;  4NN2 A;  4AUQ B;  5B77 A;  2CKL A;  2K17 A;  3I2D A;  1F62 A;  5LCW B;  2MD8 C;  4N4F A;  4GB0 A;  3MHS A;  2L5U A;  5C11 A;  2Y43 A;  2F6N A;  3N9M A;  4ZQL A;  2MNZ A;  4R2Y A;  2VPB A;  3V43 A;  3ZTG A;  5DKA A;  2QIZ A;  2YT5 A;  3PUR A;  3GV4 A;  5G0F A;  2LDR A;  4YBM A;  2KGG A;  4B86 C;  2K16 A;  4QF2 A;  2KWK A;  2XB1 A;  3T7L A;  1ZBD B;  2K4D A;  2LN0 A;  5D1M B;  3SOW A;  2F6J A;  5TAB A;  1JOC A;  3KQI A;  3N9L A;  1JM7 B;  1VFY A;  2EA6 A;  1WEE A;  3ZYQ A;  5KH7 A;  2QIC A;  3ZNI A;  5TDR A;  4TKP B;  3LQJ A;  2ECT A;  2VJE B;  5AIT A;  2KU3 A;  4A4B A;  3C6W A;  2YQL A;  3GL6 A;  2H0D A;  4WZ2 A;  2HDP A;  5JG6 A;  2MD7 B;  2MNY A;  3M99 A;  3ZVY A;  5B75 A;  2JRJ A;  3O37 A;  2KE1 A;  4MSX A;  2NAA A;  2YYR A;  5DIN A;  2F42 A;  2YW8 A;  2KIZ A;  2KWN A;  2ZET C;  2FUU A;  2M1R A;  3U5P A;  3T6R A;  2XEU A;  3QZV A;  4O64 A;  3SHB A;  4CCG X;  1N87 A;  1Z2Q A;  1FBV A;  2AN6 A;  4R8P K;  1K2F A;  3LRQ A;  2I50 A;  2VPD A;  2EOD A;  5D1K B;  2MIQ A;  2VJF A;  4YC9 A;  4YBT A;  3HCS A;  2L43 A;  2YHN A;  3L1X A;  4I7C A;  2CSY A;  3U5N A;  2KRE A;  1WIL A;  2YRE A;  1WEP A;  3SOU A;  2JMI A;  3RPG C;  1WEN A;  1VD4 A;  1X4U A;  2G43 A;  3VK6 A;  1WEQ A;  4N3W A;  4PTB A;  5LKZ A;  1HYI A;  2YUR A;  2LXP C;  2L0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...