5B75A

Crystal structure of moz double phd finger in complex with histone h3 butyrylation at k14
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'LPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 25
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b75A00
3MHSA 1DVPA 3DPLR 3LQJA 2FSAA 2EA6A 5J3XA 2YHOA 5D1LB 2KWOA 2KWNA 5FERA 5FB0A 2M1RA 1WEQA 3N9QA 3U5NA 2G43A 2MT5A 3PHDA 4B7YC 3N9MA 2YT5A 4AP4A 2AN6A 1Z2QA 4X3GA 2FUUA 2MD7B 4O64A 3N9LA 5TDWA 2K17A 3PURA 2D8SA 2L80A 3T6RA 2VNFA 4WZ2A 2ECTA 5B79A 5B75A 3C6WA 2ECWA 4C9ZA 4ZQLA 4MVTA 2VPBA 3HCSA 3DQVR 5C13A 2CT2A 2VJEA 3SOWA 4GB0A 5I3LA 1JM7A 2E6SA 2MD8C 1WFKA 4Q6FA 2HYED 3KQIA 2JMJA 4BHWA 2PNXA 2IDAA 2ECNA 2XB1A 2KIZA 4FIPA 1VD4A 3ASLA 4R2YA 5AITA 3L1XA 4IC3A 1X4JA 2LXHC 4XI1A 3O7AA 3V43A 2C2LA 4L58A 2ECIA 2ZETC 2YW8A 4UP0A 3N9OA 4NN2A 2LGLA 4A4CA 4LLBA 5D1KB 2NAAA 4YABA 1Z6UA 2I50A 4BBQA 5TRBA 2L75A 3U5MA 3LQIA 1X4IA 4YATA 2CKLA 2KWKA 3LQHA 1WEVA 2ECGA 2LGVA 5TDRA 5LKUA 4V3LC 5AIUA 4S3OB 3ZNIA 1BORA 4AUQB 2DX8A 3KNVA 4PTBA 1F62A 2KYUA 3KV5A 5H1TA 1HYIA 2M3HA 5G0FA 3HTKC 2YREA 4L7XA 1CHCA 4FJCA 1N87A 5KH9A 2YYRA 1G25A 3QZVA 3SOXA 4LKAA 4ZDTA 4YC9A 4IC2A 1WGMA 2MIQA 1E4UA 3U5PA 3N9NA 4UP5A 3ZVYA 4WZ0A 1WEPA 1WESA 4WA6A 4B86C 2QICA 3SHBA 3O35A 3GL6A 2C2VS 2K1JA 2LRIC 2HDPA 2H0DB 1K2FA 3GV4A 2VJFB 3LRQA 2YSJA 4I7BA 4AVXA 2QJ0A 2EGPA 2RI7A 4I7DA 1WEMA 4LJNA 5KH7A 1HYJA 1WIMA 4TKPB 1FBVA 1V87A 4W4UA 1XWHA 2ECJA 4YADA 1WE9A 2KWJA 2QIZA 2G45A 5EYAF 5LCWB 4YBMA 4A4BA 4N3WA 3EB6A 5B8DA 2FUIA 5LKTA 2KU3A 2VPDA 2Y1MA 3M63A 2KR4A 4GNGA 2YSMA 3SOUA 3O36A 3U5OA 4LK9A 4AYCB 1Z60A 2CSYA 2KFTA 2VPEA 2YQMA 3IHPA 5TBNA 1FP0A 5DINA 1IYMA 2E6RA 2ECVA 2Y43A 2KGGA 4GNDA 1VYXA 2L43A 3ZTGA 3MHHA 3N9PA 1MM3A 4FO9A 4P5OB 4UI9B 3ZVZB 4ZUXU 1WEWA 2Y1NA 4R8PK 3ZPV1 2KREA 2H0DA 2BAYA 2UZGA 3PUQA 2F6JA 2M6MA 5LKXA 2LV9A 4QF3A 2VJFA 3M62A 4S3OC 4A49A 1WEUA 2MA6A 4I7CA 3NG2A 2LXPC 3HCTA 5JG6A 2LGKA 3FL2A 1VFYA 5H1VA 4YBTA 1U6GB 4A0CD 3C5KA 5B78A 2YUCA 3ZPVE 2LDRA 4YBSA 5B76A 1LDJB 2YU4A 5FEYA 2CKLB 2MA5A 2L5UA 2VP7A 2EODA 5TABA 2LQ6A 2OXQC 2KGIA 2XEUA 1LDKC 5LKZA 1ZBDB 3O33A 2K16A 4FK5A 1RMDA 4R7EA 5KH3A 1MM2A 4N4FA 2MNYA 2YQLA 5FB1A 4YAXA 2MNZA 3HCUA 2CSZA 3KV6A 4AYCA 4F52B 1T1HA 3RTRB 2F42A 2PUYA 5DKAA 2LGGA 5H9MA 2JMDA 4WZ3B 5B77A 4PPEA 5G05B 3O70A 4QF2A 4GNEA 4GNFA 2L0BA 5H1UA 5G04B 2F6NA 3RPGB 2M85A 4MSXA 2K4DA 3T7LA 3EB5A 3O37A 1WILA 5D1MB 3L1ZB 2RSDA 3RPGC 3ZYQA 2VJEB 4CA1A 1JM7B 2JMIA 3VK6A 2YURA 2KE1A 1X4UA 1WENA 4V3KC 2MUMA 1JOCA 2JRJA 4CCGX 3I2DA 1WEOA 2YHNA 1WEEA 3O34A 4LADB 3L11A 2G6QA 2VPGA 5C11A 2LN0A 3M99A
chains in the Genus database with same CATH superfamily
3MHSA 1DVPA 3DPLR 3LQJA 2FSAA 2MKEA 2EA6A 5J3XA 2YHOA 4OGCA 5D1LB 2KWOA 2KWNA 3PLWA 5FERA 2KKXA 5FB0A 2M1RA 1WEQA 2JM3A 2FD4A 3N9QA 3U5NA 2G43A 2MT5A 3PHDA 4B7YC 3N9MA 2YT5A 4Z0OA 4AP4A 2AN6A 1Z2QA 4X3GA 2FUUA 2JUNA 4OGEA 2MD7B 2XP0A 4O64A 3N9LA 3DDTA 5TDWA 2K17A 3PURA 2D8SA 2L80A 3T6RA 2VNFA 4WZ2A 2ECTA 1MBMA 5B79A 5B75A 3C6WA 2ECWA 4C9ZA 4ZQLA 4MVTA 2VPBA 2L7PA 3HCSA 3DQVR 5C13A 2CT2A 2VJEA 3SOWA 4GB0A 5I3LA 1JM7A 5SVIB 2E6SA 2MD8C 2CRWA 1WFKA 4Q6FA 2HYED 3KQIA 2JMJA 3LJUX 4BHWA 2PNXA 3FAOA 2IDAA 2ECNA 2XB1A 2CSVA 2KIZA 4FIPA 1VD4A 3ASLA 4R2YA 5AITA 3L1XA 4IC3A 1X4JA 2LXHC 4XI1A 3O7AA 3V43A 2C2LA 4L58A 2ECIA 2ZETC 2YW8A 4UP0A 3N9OA 4NN2A 2RR4A 5SVXA 2LGLA 4A4CA 4LLBA 5D1KB 2FFWA 2NAAA 4YABA 1Z6UA 2I50A 4BBQA 2KKYA 5TRBA 2L75A 3U5MA 3LQIA 1X4IA 3SUBA 4YATA 2CKLA 2KWKA 3LQHA 3LDYA 1WEVA 2ECGA 2LGVA 3DWDA 4Z0RA 5TDRA 3E2DA 5LKUA 4V3LC 5AIUA 4S3OB 3ZNIA 1BORA 4AUQB 2DX8A 3KNVA 4PTBA 1F62A 2KYUA 3KV5A 5H1TA 1HYIA 2M3HA 5G0FA 3HTKC 2YREA 4L7XA 1CHCA 4FJCA 1N87A 5KH9A 2YYRA 1G25A 3QZVA 3SOXA 4LKAA 4H9DA 4ZDTA 4YC9A 3M7KA 4IC2A 1WGMA 2MIQA 1E4UA 3U5PA 3N9NA 4UP5A 2D8UA 3ZVYA 4WZ0A 1WEPA 1WESA 4WA6A 4B86C 2EGMA 2QICA 3SHBA 3O35A 3GL6A 2EXUA 2C2VS 2K1JA 2LRIC 2HDPA 2H0DB 2IQJA 1K2FA 3GV4A 2VJFB 2YVRA 3LRQA 2YSJA 4I7BA 4AVXA 2QJ0A 2EGPA 4F1PA 2RI7A 4I7DA 1WEMA 4LJNA 5KH7A 1HYJA 1WIMA 4TKPB 1FBVA 1V87A 4W4UA 1XWHA 2DSMA 3O47A 2ECJA 3LVRE 4YADA 1WE9A 2KWJA 2QIZA 2G45A 5EYAF 5LCWB 5SVYA 4YBMA 3LVQE 4A4BA 4N3WA 3EB6A 5B8DA 3FJUB 2FUIA 5LKTA 2KU3A 2VPDA 2Y1MA 3M63A 2B0OE 2KR4A 3Q1DA 4GNGA 2YSMA 3SOUA 3O36A 3U5OA 4LK9A 4AYCB 1Z60A 2CSYA 2XOYA 2KFTA 2VPEA 2XOZA 2YQMA 3IHPA 5TBNA 1FP0A 5DINA 1IYMA 2E6RA 2ECVA 3FEHA 2Y43A 2KGGA 4GNDA 1VYXA 2L43A 3ZTGA 4O62A 3MHHA 3N9PA 1MM3A 4FO9A 2M13A 4P5OB 4UI9B 3ZVZB 5SVIA 1WEWA 4ZUXU 2Y1NA 4R8PK 3ZPV1 2KREA 2H0DA 2BAYA 2UZGA 3PUQA 2F6JA 2M6MA 5LKXA 2LV9A 4QF3A 2VJFA 3M62A 2CRRA 4S3OC 4A49A 3FM8C 1WEUA 2MA6A 4I7CA 3NG2A 2LXPC 3HCTA 5JG6A 2LGKA 3T9KA 3FANA 3FL2A 1VFYA 5H1VA 4YBTA 1U6GB 4A0CD 3C5KA 5B78A 2YUCA 3ZPVE 2LDRA 4YBSA 3MDBC 5B76A 1LDJB 2YU4A 5FEYA 2CKLB 2MA5A 2L5UA 3KDEC 2VP7A 2CONA 2EODA 5TABA 2LQ6A 2OXQC 2KGIA 2XEUA 1LDKC 5LKZA 1ZBDB 3O33A 2K16A 2DJAA 2LAUA 4FK5A 1RMDA 4R7EA 5KH3A 1MM2A 4N4FA 2MNYA 2YQLA 5FB1A 1DCQA 4YAXA 2MNZA 3HCUA 2CSZA 3KV6A 4AYCA 4F52B 1T1HA 3RTRB 2F42A 2PUYA 5DKAA 2LGGA 5H9MA 2JMDA 4WZ3B 5B77A 4PPEA 5G05B 3O70A 2OWAA 4QF2A 3JUEA 4GNEA 4GNFA 2L0BA 5H1UA 5G04B 2F6NA 3RPGB 2M85A 2XOCA 4MSXA 2K4DA 3T7LA 3EB5A 3O37A 1WILA 5D1MB 3L1ZB 2RSDA 3RPGC 3ZYQA 2VJEB 4CA1A 1JM7B 2JMIA 3VK6A 2YURA 3H7HA 2KE1A 1X4UA 1WENA 2P57A 4V3KC 2MUMA 1JOCA 5K3QA 2JRJA 4CCGX 3I2DA 1WEOA 2YHNA 1WEEA 3O34A 4LADB 3L11A 4QQ4A 2G6QA 2VPGA 2E61A 5C11A 2LN0A 3M99A
chains in the Genus database with same CATH topology
3MHSA 1DVPA 3DPLR 3LQJA 2FSAA 2EA6A 5J3XA 2YHOA 5D1LB 2KWOA 2KWNA 5FERA 5FB0A 2M1RA 1WEQA 3N9QA 3U5NA 2G43A 2MT5A 3PHDA 4B7YC 3N9MA 2YT5A 4AP4A 2AN6A 1Z2QA 4X3GA 2FUUA 2MD7B 4O64A 3N9LA 5TDWA 2K17A 3PURA 2D8SA 2L80A 3T6RA 2VNFA 4WZ2A 2ECTA 5B79A 5B75A 3C6WA 2ECWA 4C9ZA 4ZQLA 4MVTA 2VPBA 3HCSA 3DQVR 5C13A 2CT2A 2VJEA 3SOWA 4GB0A 5I3LA 1JM7A 2E6SA 2MD8C 1WFKA 4Q6FA 2HYED 3KQIA 2JMJA 4BHWA 2PNXA 2IDAA 2ECNA 2XB1A 2KIZA 4FIPA 1VD4A 3ASLA 4R2YA 5AITA 3L1XA 4IC3A 1X4JA 2LXHC 4XI1A 3O7AA 3V43A 2C2LA 4L58A 2ECIA 2ZETC 2YW8A 4UP0A 3N9OA 4NN2A 2LGLA 4A4CA 4LLBA 5D1KB 2NAAA 4YABA 1Z6UA 2I50A 4BBQA 5TRBA 2L75A 3U5MA 3LQIA 1X4IA 4YATA 2CKLA 2KWKA 3LQHA 1WEVA 2ECGA 2LGVA 5TDRA 5LKUA 4V3LC 5AIUA 4S3OB 3ZNIA 1BORA 4AUQB 2DX8A 3KNVA 4PTBA 1F62A 2KYUA 3KV5A 5H1TA 1HYIA 2M3HA 5G0FA 3HTKC 2YREA 4L7XA 1CHCA 4FJCA 1N87A 5KH9A 2YYRA 1G25A 3QZVA 3SOXA 4LKAA 4ZDTA 4YC9A 4IC2A 1WGMA 2MIQA 1E4UA 3U5PA 3N9NA 4UP5A 3ZVYA 4WZ0A 1WEPA 1WESA 4WA6A 4B86C 2QICA 3SHBA 3O35A 3GL6A 2C2VS 2K1JA 2LRIC 2HDPA 2H0DB 1K2FA 3GV4A 2VJFB 3LRQA 2YSJA 4I7BA 4AVXA 2QJ0A 2EGPA 2RI7A 4I7DA 1WEMA 4LJNA 5KH7A 1HYJA 1WIMA 4TKPB 1FBVA 1V87A 4W4UA 1XWHA 2ECJA 4YADA 1WE9A 2KWJA 2QIZA 2G45A 5EYAF 5LCWB 4YBMA 4A4BA 4N3WA 3EB6A 5B8DA 2FUIA 5LKTA 2KU3A 2VPDA 2Y1MA 3M63A 2KR4A 4GNGA 2YSMA 3SOUA 3O36A 3U5OA 4LK9A 4AYCB 1Z60A 2CSYA 2KFTA 2VPEA 2YQMA 3IHPA 5TBNA 1FP0A 5DINA 1IYMA 2E6RA 2ECVA 2Y43A 2KGGA 4GNDA 1VYXA 2L43A 3ZTGA 3MHHA 3N9PA 1MM3A 4FO9A 4P5OB 4UI9B 3ZVZB 4ZUXU 1WEWA 2Y1NA 4R8PK 3ZPV1 2KREA 2H0DA 2BAYA 2UZGA 3PUQA 2F6JA 2M6MA 5LKXA 2LV9A 4QF3A 2VJFA 3M62A 4S3OC 4A49A 1WEUA 2MA6A 4I7CA 3NG2A 2LXPC 3HCTA 5JG6A 2LGKA 3FL2A 1VFYA 5H1VA 4YBTA 1U6GB 4A0CD 3C5KA 5B78A 2YUCA 3ZPVE 2LDRA 4YBSA 5B76A 1LDJB 2YU4A 5FEYA 2CKLB 2MA5A 2L5UA 2VP7A 2EODA 5TABA 2LQ6A 2OXQC 2KGIA 2XEUA 1LDKC 5LKZA 1ZBDB 3O33A 2K16A 4FK5A 1RMDA 4R7EA 5KH3A 1MM2A 4N4FA 2MNYA 2YQLA 5FB1A 4YAXA 2MNZA 3HCUA 2CSZA 3KV6A 4AYCA 4F52B 1T1HA 3RTRB 2F42A 2PUYA 5DKAA 2LGGA 5H9MA 2JMDA 4WZ3B 5B77A 4PPEA 5G05B 3O70A 4QF2A 4GNEA 4GNFA 2L0BA 5H1UA 5G04B 2F6NA 3RPGB 2M85A 4MSXA 2K4DA 3T7LA 3EB5A 3O37A 1WILA 5D1MB 3L1ZB 2RSDA 3RPGC 3ZYQA 2VJEB 4CA1A 1JM7B 2JMIA 3VK6A 2YURA 2KE1A 1X4UA 1WENA 4V3KC 2MUMA 1JOCA 2JRJA 4CCGX 3I2DA 1WEOA 2YHNA 1WEEA 3O34A 4LADB 3L11A 2G6QA 2VPGA 5C11A 2LN0A 3M99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS A;  1DVP A;  3DPL R;  3LQJ A;  2FSA A;  2EA6 A;  5J3X A;  2YHO A;  5D1L B;  2KWO A;  2KWN A;  5FER A;  5FB0 A;  2M1R A;  1WEQ A;  3N9Q A;  3U5N A;  2G43 A;  2MT5 A;  3PHD A;  4B7Y C;  3N9M A;  2YT5 A;  4AP4 A;  2AN6 A;  1Z2Q A;  4X3G A;  2FUU A;  2MD7 B;  4O64 A;  3N9L A;  5TDW A;  2K17 A;  3PUR A;  2D8S A;  2L80 A;  3T6R A;  2VNF A;  4WZ2 A;  2ECT A;  5B79 A;  5B75 A;  3C6W A;  2ECW A;  4C9Z A;  4ZQL A;  4MVT A;  2VPB A;  3HCS A;  3DQV R;  5C13 A;  2CT2 A;  2VJE A;  3SOW A;  4GB0 A;  5I3L A;  1JM7 A;  2E6S A;  2MD8 C;  1WFK A;  4Q6F A;  2HYE D;  3KQI A;  2JMJ A;  4BHW A;  2PNX A;  2IDA A;  2ECN A;  2XB1 A;  2KIZ A;  4FIP A;  1VD4 A;  3ASL A;  4R2Y A;  5AIT A;  3L1X A;  4IC3 A;  1X4J A;  2LXH C;  4XI1 A;  3O7A A;  3V43 A;  2C2L A;  4L58 A;  2ECI A;  2ZET C;  2YW8 A;  4UP0 A;  3N9O A;  4NN2 A;  2LGL A;  4A4C A;  4LLB A;  5D1K B;  2NAA A;  4YAB A;  1Z6U A;  2I50 A;  4BBQ A;  5TRB A;  2L75 A;  3U5M A;  3LQI A;  1X4I A;  4YAT A;  2CKL A;  2KWK A;  3LQH A;  1WEV A;  2ECG A;  2LGV A;  5TDR A;  5LKU A;  4V3L C;  5AIU A;  4S3O B;  3ZNI A;  1BOR A;  4AUQ B;  2DX8 A;  3KNV A;  4PTB A;  1F62 A;  2KYU A;  3KV5 A;  5H1T A;  1HYI A;  2M3H A;  5G0F A;  3HTK C;  2YRE A;  4L7X A;  1CHC A;  4FJC A;  1N87 A;  5KH9 A;  2YYR A;  1G25 A;  3QZV A;  3SOX A;  4LKA A;  4ZDT A;  4YC9 A;  4IC2 A;  1WGM A;  2MIQ A;  1E4U A;  3U5P A;  3N9N A;  4UP5 A;  3ZVY A;  4WZ0 A;  1WEP A;  1WES A;  4WA6 A;  4B86 C;  2QIC A;  3SHB A;  3O35 A;  3GL6 A;  2C2V S;  2K1J A;  2LRI C;  2HDP A;  2H0D B;  1K2F A;  3GV4 A;  2VJF B;  3LRQ A;  2YSJ A;  4I7B A;  4AVX A;  2QJ0 A;  2EGP A;  2RI7 A;  4I7D A;  1WEM A;  4LJN A;  5KH7 A;  1HYJ A;  1WIM A;  4TKP B;  1FBV A;  1V87 A;  4W4U A;  1XWH A;  2ECJ A;  4YAD A;  1WE9 A;  2KWJ A;  2QIZ A;  2G45 A;  5EYA F;  5LCW B;  4YBM A;  4A4B A;  4N3W A;  3EB6 A;  5B8D A;  2FUI A;  5LKT A;  2KU3 A;  2VPD A;  2Y1M A;  3M63 A;  2KR4 A;  4GNG A;  2YSM A;  3SOU A;  3O36 A;  3U5O A;  4LK9 A;  4AYC B;  1Z60 A;  2CSY A;  2KFT A;  2VPE A;  2YQM A;  3IHP A;  5TBN A;  1FP0 A;  5DIN A;  1IYM A;  2E6R A;  2ECV A;  2Y43 A;  2KGG A;  4GND A;  1VYX A;  2L43 A;  3ZTG A;  3MHH A;  3N9P A;  1MM3 A;  4FO9 A;  4P5O B;  4UI9 B;  3ZVZ B;  4ZUX U;  1WEW A;  2Y1N A;  4R8P K;  3ZPV 1;  2KRE A;  2H0D A;  2BAY A;  2UZG A;  3PUQ A;  2F6J A;  2M6M A;  5LKX A;  2LV9 A;  4QF3 A;  2VJF A;  3M62 A;  4S3O C;  4A49 A;  1WEU A;  2MA6 A;  4I7C A;  3NG2 A;  2LXP C;  3HCT A;  5JG6 A;  2LGK A;  3FL2 A;  1VFY A;  5H1V A;  4YBT A;  1U6G B;  4A0C D;  3C5K A;  5B78 A;  2YUC A;  3ZPV E;  2LDR A;  4YBS A;  5B76 A;  1LDJ B;  2YU4 A;  5FEY A;  2CKL B;  2MA5 A;  2L5U A;  2VP7 A;  2EOD A;  5TAB A;  2LQ6 A;  2OXQ C;  2KGI A;  2XEU A;  1LDK C;  5LKZ A;  1ZBD B;  3O33 A;  2K16 A;  4FK5 A;  1RMD A;  4R7E A;  5KH3 A;  1MM2 A;  4N4F A;  2MNY A;  2YQL A;  5FB1 A;  4YAX A;  2MNZ A;  3HCU A;  2CSZ A;  3KV6 A;  4AYC A;  4F52 B;  1T1H A;  3RTR B;  2F42 A;  2PUY A;  5DKA A;  2LGG A;  5H9M A;  2JMD A;  4WZ3 B;  5B77 A;  4PPE A;  5G05 B;  3O70 A;  4QF2 A;  4GNE A;  4GNF A;  2L0B A;  5H1U A;  5G04 B;  2F6N A;  3RPG B;  2M85 A;  4MSX A;  2K4D A;  3T7L A;  3EB5 A;  3O37 A;  1WIL A;  5D1M B;  3L1Z B;  2RSD A;  3RPG C;  3ZYQ A;  2VJE B;  4CA1 A;  1JM7 B;  2JMI A;  3VK6 A;  2YUR A;  2KE1 A;  1X4U A;  1WEN A;  4V3K C;  2MUM A;  1JOC A;  2JRJ A;  4CCG X;  3I2D A;  1WEO A;  2YHN A;  1WEE A;  3O34 A;  4LAD B;  3L11 A;  2G6Q A;  2VPG A;  5C11 A;  2LN0 A;  3M99 A; 
#chains in the Genus database with same CATH topology
 3MHS A;  1DVP A;  3DPL R;  3LQJ A;  2FSA A;  2MKE A;  2EA6 A;  5J3X A;  2YHO A;  4OGC A;  5D1L B;  2KWO A;  2KWN A;  3PLW A;  5FER A;  2KKX A;  5FB0 A;  2M1R A;  1WEQ A;  2JM3 A;  2FD4 A;  3N9Q A;  3U5N A;  2G43 A;  2MT5 A;  3PHD A;  4B7Y C;  3N9M A;  2YT5 A;  4Z0O A;  4AP4 A;  2AN6 A;  1Z2Q A;  4X3G A;  2FUU A;  2JUN A;  4OGE A;  2MD7 B;  2XP0 A;  4O64 A;  3N9L A;  3DDT A;  5TDW A;  2K17 A;  3PUR A;  2D8S A;  2L80 A;  3T6R A;  2VNF A;  4WZ2 A;  2ECT A;  1MBM A;  5B79 A;  5B75 A;  3C6W A;  2ECW A;  4C9Z A;  4ZQL A;  4MVT A;  2VPB A;  2L7P A;  3HCS A;  3DQV R;  5C13 A;  2CT2 A;  2VJE A;  3SOW A;  4GB0 A;  5I3L A;  1JM7 A;  5SVI B;  2E6S A;  2MD8 C;  2CRW A;  1WFK A;  4Q6F A;  2HYE D;  3KQI A;  2JMJ A;  3LJU X;  4BHW A;  2PNX A;  3FAO A;  2IDA A;  2ECN A;  2XB1 A;  2CSV A;  2KIZ A;  4FIP A;  1VD4 A;  3ASL A;  4R2Y A;  5AIT A;  3L1X A;  4IC3 A;  1X4J A;  2LXH C;  4XI1 A;  3O7A A;  3V43 A;  2C2L A;  4L58 A;  2ECI A;  2ZET C;  2YW8 A;  4UP0 A;  3N9O A;  4NN2 A;  2RR4 A;  5SVX A;  2LGL A;  4A4C A;  4LLB A;  5D1K B;  2FFW A;  2NAA A;  4YAB A;  1Z6U A;  2I50 A;  4BBQ A;  2KKY A;  5TRB A;  2L75 A;  3U5M A;  3LQI A;  1X4I A;  3SUB A;  4YAT A;  2CKL A;  2KWK A;  3LQH A;  3LDY A;  1WEV A;  2ECG A;  2LGV A;  3DWD A;  4Z0R A;  5TDR A;  3E2D A;  5LKU A;  4V3L C;  5AIU A;  4S3O B;  3ZNI A;  1BOR A;  4AUQ B;  2DX8 A;  3KNV A;  4PTB A;  1F62 A;  2KYU A;  3KV5 A;  5H1T A;  1HYI A;  2M3H A;  5G0F A;  3HTK C;  2YRE A;  4L7X A;  1CHC A;  4FJC A;  1N87 A;  5KH9 A;  2YYR A;  1G25 A;  3QZV A;  3SOX A;  4LKA A;  4H9D A;  4ZDT A;  4YC9 A;  3M7K A;  4IC2 A;  1WGM A;  2MIQ A;  1E4U A;  3U5P A;  3N9N A;  4UP5 A;  2D8U A;  3ZVY A;  4WZ0 A;  1WEP A;  1WES A;  4WA6 A;  4B86 C;  2EGM A;  2QIC A;  3SHB A;  3O35 A;  3GL6 A;  2EXU A;  2C2V S;  2K1J A;  2LRI C;  2HDP A;  2H0D B;  2IQJ A;  1K2F A;  3GV4 A;  2VJF B;  2YVR A;  3LRQ A;  2YSJ A;  4I7B A;  4AVX A;  2QJ0 A;  2EGP A;  4F1P A;  2RI7 A;  4I7D A;  1WEM A;  4LJN A;  5KH7 A;  1HYJ A;  1WIM A;  4TKP B;  1FBV A;  1V87 A;  4W4U A;  1XWH A;  2DSM A;  3O47 A;  2ECJ A;  3LVR E;  4YAD A;  1WE9 A;  2KWJ A;  2QIZ A;  2G45 A;  5EYA F;  5LCW B;  5SVY A;  4YBM A;  3LVQ E;  4A4B A;  4N3W A;  3EB6 A;  5B8D A;  3FJU B;  2FUI A;  5LKT A;  2KU3 A;  2VPD A;  2Y1M A;  3M63 A;  2B0O E;  2KR4 A;  3Q1D A;  4GNG A;  2YSM A;  3SOU A;  3O36 A;  3U5O A;  4LK9 A;  4AYC B;  1Z60 A;  2CSY A;  2XOY A;  2KFT A;  2VPE A;  2XOZ A;  2YQM A;  3IHP A;  5TBN A;  1FP0 A;  5DIN A;  1IYM A;  2E6R A;  2ECV A;  3FEH A;  2Y43 A;  2KGG A;  4GND A;  1VYX A;  2L43 A;  3ZTG A;  4O62 A;  3MHH A;  3N9P A;  1MM3 A;  4FO9 A;  2M13 A;  4P5O B;  4UI9 B;  3ZVZ B;  5SVI A;  1WEW A;  4ZUX U;  2Y1N A;  4R8P K;  3ZPV 1;  2KRE A;  2H0D A;  2BAY A;  2UZG A;  3PUQ A;  2F6J A;  2M6M A;  5LKX A;  2LV9 A;  4QF3 A;  2VJF A;  3M62 A;  2CRR A;  4S3O C;  4A49 A;  3FM8 C;  1WEU A;  2MA6 A;  4I7C A;  3NG2 A;  2LXP C;  3HCT A;  5JG6 A;  2LGK A;  3T9K A;  3FAN A;  3FL2 A;  1VFY A;  5H1V A;  4YBT A;  1U6G B;  4A0C D;  3C5K A;  5B78 A;  2YUC A;  3ZPV E;  2LDR A;  4YBS A;  3MDB C;  5B76 A;  1LDJ B;  2YU4 A;  5FEY A;  2CKL B;  2MA5 A;  2L5U A;  3KDE C;  2VP7 A;  2CON A;  2EOD A;  5TAB A;  2LQ6 A;  2OXQ C;  2KGI A;  2XEU A;  1LDK C;  5LKZ A;  1ZBD B;  3O33 A;  2K16 A;  2DJA A;  2LAU A;  4FK5 A;  1RMD A;  4R7E A;  5KH3 A;  1MM2 A;  4N4F A;  2MNY A;  2YQL A;  5FB1 A;  1DCQ A;  4YAX A;  2MNZ A;  3HCU A;  2CSZ A;  3KV6 A;  4AYC A;  4F52 B;  1T1H A;  3RTR B;  2F42 A;  2PUY A;  5DKA A;  2LGG A;  5H9M A;  2JMD A;  4WZ3 B;  5B77 A;  4PPE A;  5G05 B;  3O70 A;  2OWA A;  4QF2 A;  3JUE A;  4GNE A;  4GNF A;  2L0B A;  5H1U A;  5G04 B;  2F6N A;  3RPG B;  2M85 A;  2XOC A;  4MSX A;  2K4D A;  3T7L A;  3EB5 A;  3O37 A;  1WIL A;  5D1M B;  3L1Z B;  2RSD A;  3RPG C;  3ZYQ A;  2VJE B;  4CA1 A;  1JM7 B;  2JMI A;  3VK6 A;  2YUR A;  3H7H A;  2KE1 A;  1X4U A;  1WEN A;  2P57 A;  4V3K C;  2MUM A;  1JOC A;  5K3Q A;  2JRJ A;  4CCG X;  3I2D A;  1WEO A;  2YHN A;  1WEE A;  3O34 A;  4LAD B;  3L11 A;  4QQ4 A;  2G6Q A;  2VPG A;  2E61 A;  5C11 A;  2LN0 A;  3M99 A; 
#chains in the Genus database with same CATH homology
 3MHS A;  1DVP A;  3DPL R;  3LQJ A;  2FSA A;  2EA6 A;  5J3X A;  2YHO A;  5D1L B;  2KWO A;  2KWN A;  5FER A;  5FB0 A;  2M1R A;  1WEQ A;  3N9Q A;  3U5N A;  2G43 A;  2MT5 A;  3PHD A;  4B7Y C;  3N9M A;  2YT5 A;  4AP4 A;  2AN6 A;  1Z2Q A;  4X3G A;  2FUU A;  2MD7 B;  4O64 A;  3N9L A;  5TDW A;  2K17 A;  3PUR A;  2D8S A;  2L80 A;  3T6R A;  2VNF A;  4WZ2 A;  2ECT A;  5B79 A;  5B75 A;  3C6W A;  2ECW A;  4C9Z A;  4ZQL A;  4MVT A;  2VPB A;  3HCS A;  3DQV R;  5C13 A;  2CT2 A;  2VJE A;  3SOW A;  4GB0 A;  5I3L A;  1JM7 A;  2E6S A;  2MD8 C;  1WFK A;  4Q6F A;  2HYE D;  3KQI A;  2JMJ A;  4BHW A;  2PNX A;  2IDA A;  2ECN A;  2XB1 A;  2KIZ A;  4FIP A;  1VD4 A;  3ASL A;  4R2Y A;  5AIT A;  3L1X A;  4IC3 A;  1X4J A;  2LXH C;  4XI1 A;  3O7A A;  3V43 A;  2C2L A;  4L58 A;  2ECI A;  2ZET C;  2YW8 A;  4UP0 A;  3N9O A;  4NN2 A;  2LGL A;  4A4C A;  4LLB A;  5D1K B;  2NAA A;  4YAB A;  1Z6U A;  2I50 A;  4BBQ A;  5TRB A;  2L75 A;  3U5M A;  3LQI A;  1X4I A;  4YAT A;  2CKL A;  2KWK A;  3LQH A;  1WEV A;  2ECG A;  2LGV A;  5TDR A;  5LKU A;  4V3L C;  5AIU A;  4S3O B;  3ZNI A;  1BOR A;  4AUQ B;  2DX8 A;  3KNV A;  4PTB A;  1F62 A;  2KYU A;  3KV5 A;  5H1T A;  1HYI A;  2M3H A;  5G0F A;  3HTK C;  2YRE A;  4L7X A;  1CHC A;  4FJC A;  1N87 A;  5KH9 A;  2YYR A;  1G25 A;  3QZV A;  3SOX A;  4LKA A;  4ZDT A;  4YC9 A;  4IC2 A;  1WGM A;  2MIQ A;  1E4U A;  3U5P A;  3N9N A;  4UP5 A;  3ZVY A;  4WZ0 A;  1WEP A;  1WES A;  4WA6 A;  4B86 C;  2QIC A;  3SHB A;  3O35 A;  3GL6 A;  2C2V S;  2K1J A;  2LRI C;  2HDP A;  2H0D B;  1K2F A;  3GV4 A;  2VJF B;  3LRQ A;  2YSJ A;  4I7B A;  4AVX A;  2QJ0 A;  2EGP A;  2RI7 A;  4I7D A;  1WEM A;  4LJN A;  5KH7 A;  1HYJ A;  1WIM A;  4TKP B;  1FBV A;  1V87 A;  4W4U A;  1XWH A;  2ECJ A;  4YAD A;  1WE9 A;  2KWJ A;  2QIZ A;  2G45 A;  5EYA F;  5LCW B;  4YBM A;  4A4B A;  4N3W A;  3EB6 A;  5B8D A;  2FUI A;  5LKT A;  2KU3 A;  2VPD A;  2Y1M A;  3M63 A;  2KR4 A;  4GNG A;  2YSM A;  3SOU A;  3O36 A;  3U5O A;  4LK9 A;  4AYC B;  1Z60 A;  2CSY A;  2KFT A;  2VPE A;  2YQM A;  3IHP A;  5TBN A;  1FP0 A;  5DIN A;  1IYM A;  2E6R A;  2ECV A;  2Y43 A;  2KGG A;  4GND A;  1VYX A;  2L43 A;  3ZTG A;  3MHH A;  3N9P A;  1MM3 A;  4FO9 A;  4P5O B;  4UI9 B;  3ZVZ B;  4ZUX U;  1WEW A;  2Y1N A;  4R8P K;  3ZPV 1;  2KRE A;  2H0D A;  2BAY A;  2UZG A;  3PUQ A;  2F6J A;  2M6M A;  5LKX A;  2LV9 A;  4QF3 A;  2VJF A;  3M62 A;  4S3O C;  4A49 A;  1WEU A;  2MA6 A;  4I7C A;  3NG2 A;  2LXP C;  3HCT A;  5JG6 A;  2LGK A;  3FL2 A;  1VFY A;  5H1V A;  4YBT A;  1U6G B;  4A0C D;  3C5K A;  5B78 A;  2YUC A;  3ZPV E;  2LDR A;  4YBS A;  5B76 A;  1LDJ B;  2YU4 A;  5FEY A;  2CKL B;  2MA5 A;  2L5U A;  2VP7 A;  2EOD A;  5TAB A;  2LQ6 A;  2OXQ C;  2KGI A;  2XEU A;  1LDK C;  5LKZ A;  1ZBD B;  3O33 A;  2K16 A;  4FK5 A;  1RMD A;  4R7E A;  5KH3 A;  1MM2 A;  4N4F A;  2MNY A;  2YQL A;  5FB1 A;  4YAX A;  2MNZ A;  3HCU A;  2CSZ A;  3KV6 A;  4AYC A;  4F52 B;  1T1H A;  3RTR B;  2F42 A;  2PUY A;  5DKA A;  2LGG A;  5H9M A;  2JMD A;  4WZ3 B;  5B77 A;  4PPE A;  5G05 B;  3O70 A;  4QF2 A;  4GNE A;  4GNF A;  2L0B A;  5H1U A;  5G04 B;  2F6N A;  3RPG B;  2M85 A;  4MSX A;  2K4D A;  3T7L A;  3EB5 A;  3O37 A;  1WIL A;  5D1M B;  3L1Z B;  2RSD A;  3RPG C;  3ZYQ A;  2VJE B;  4CA1 A;  1JM7 B;  2JMI A;  3VK6 A;  2YUR A;  2KE1 A;  1X4U A;  1WEN A;  4V3K C;  2MUM A;  1JOC A;  2JRJ A;  4CCG X;  3I2D A;  1WEO A;  2YHN A;  1WEE A;  3O34 A;  4LAD B;  3L11 A;  2G6Q A;  2VPG A;  5C11 A;  2LN0 A;  3M99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...