4AUQB

Structure of birc7-ubch5b-ub complex.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'QLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Birc7-E2 Ubiquitin Conjugate Structure Reveals the Mechanism of Ubiquitin Transfer by a Ring Dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase/signalling protein
total genus 11
structure length 57
sequence length 57
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4auqB00
3HCUA 2KWOA 2ECWA 3EB5A 4XI1A 3DPLR 1Z60A 2YYRA 1WEQA 4TKPB 5TRBA 3ZVYA 4X3GA 4B7YC 3N9OA 4LK9A 3C6WA 1JM7A 4L58A 4O64A 2QICA 2EA6A 3N9LA 4FIPA 4YAXA 2VJFA 3IHPA 5D1LB 1WEPA 5C11A 1VYXA 2LGVA 2LGLA 4C9ZA 3GV4A 3L1ZB 2VJEB 3U5NA 4AUQB 1WENA 2LGKA 2FUIA 1X4UA 1G25A 1U6GB 3O35A 3O37A 1Z6UA 3LQHA 4ZDTA 1WEEA 3O33A 2OXQC 2IDAA 2K17A 5B78A 2M1RA 1K2FA 4A4CA 3EB6A 4A4BA 2KWKA 5G0FA 2HDPA 3ZTGA 1VFYA 2KR4A 2KFTA 4MSXA 2LXPC 3KNVA 3ZNIA 4WA6A 3O36A 5FERA 2XB1A 4W4UA 2K4DA 2VNFA 2MIQA 1Z2QA 3KV5A 4AP4A 1T1HA 2PUYA 5G05B 4IC3A 2YREA 1WEWA 2ECJA 5LKXA 5H9MA 3RPGB 5DKAA 2KWJA 2F6NA 2D8SA 2ECTA 2VP7A 1WILA 2KE1A 4N3WA 2LN0A 2YURA 5DINA 3LRQA 2YW8A 2JMIA 2Y1MA 3N9QA 2I50A 3RTRB 2ECVA 4LLBA 5KH3A 3SOWA 2JMDA 1V87A 2LXHC 3L1XA 2CKLA 2E6SA 2ECGA 1MM2A 3PUQA 4PTBA 4AYCA 2C2LA 4GNEA 2UZGA 5FEYA 4AVXA 2LRIC 1HYJA 2Y1NA 2E6RA 5D1KB 2YHNA 2LQ6A 1WEUA 4N4FA 3VK6A 2L0BA 5TBNA 3ZPV1 2YHOA 2MNYA 5FB0A 1JM7B 2M3HA 3M63A 4S3OB 2H0DA 3NG2A 2VJFB 4A0CD 2KWNA 2HYED 5TDWA 1XWHA 3M62A 3DQVR 3KQIA 2YSMA 4F52B 1DVPA 4I7CA 5LKTA 5G04B 1WEVA 5H1VA 5B77A 2EODA 2RSDA 5KH9A 3HTKC 4L7XA 2L43A 1WFKA 4BHWA 2L75A 4UI9B 3PURA 2PNXA 2K1JA 5D1MB 4YC9A 5B76A 2YSJA 2C2VS 4GNFA 1VD4A 2BAYA 3FL2A 3M99A 1JOCA 2CSZA 2FSAA 2KIZA 2M6MA 3O34A 2G43A 4YADA 3SOXA 2ECNA 1WGMA 2G6QA 3V43A 3LQJA 2L80A 3PHDA 2MD7B 1CHCA 2VPBA 1BORA 4R2YA 3QZVA 1LDJB 3LQIA 5TDRA 4GB0A 3O70A 3KV6A 2G45A 5FB1A 5J3XA 2QJ0A 5LKUA 3ZYQA 4YABA 4R7EA 4ZUXU 2K16A 2AN6A 2YT5A 4CA1A 3SHBA 2CKLB 2FUUA 4AYCB 4FO9A 4UP5A 2YUCA 1FBVA 3MHSA 1X4IA 5H1UA 5LKZA 1MM3A 2ECIA 2CSYA 1WIMA 2EGPA 3I2DA 3RPGC 2KREA 1IYMA 3U5PA 3T7LA 3GL6A 5B8DA 4B86C 4YBSA 1WE9A 2H0DB 4WZ0A 2KGIA 2VPEA 3U5MA 3ZVZB 2MT5A 2KYUA 4NN2A 3O7AA 2LV9A 2M85A 2VPDA 4PPEA 4LADB 4GNDA 5H1TA 4YBMA 4IC2A 5JG6A 4YBTA 4WZ2A 2JMJA 2VJEA 1E4UA 5LCWB 2LDRA 3T6RA 2MUMA 5KH7A 2NAAA 4I7DA 1WEMA 2MA5A 2KGGA 2XEUA 4S3OC 4V3LC 1FP0A 4MVTA 1WEOA 5I3LA 4BBQA 3N9NA 2YQLA 2MNZA 4Q6FA 2QIZA 2CT2A 5B79A 1RMDA 4I7BA 4FK5A 3N9PA 3ZPVE 1HYIA 3HCSA 5TABA 2RI7A 5AIUA 5B75A 5C13A 1X4JA 4QF3A 1F62A 4R8PK 4YATA 2VPGA 4LKAA 4QF2A 5EYAF 3U5OA 4UP0A 1N87A 1WESA 4LJNA 3L11A 2YQMA 4P5OB 2DX8A 4CCGX 4WZ3B 5AITA 3SOUA 1LDKC 2MA6A 4A49A 3ASLA 3N9MA 2YU4A 4FJCA 2F6JA 2JRJA 2Y43A 2F42A 2L5UA 4ZQLA 3HCTA 4GNGA 3C5KA 2LGGA 4V3KC 2KU3A 2ZETC 1ZBDB 2MD8C 3MHHA
chains in the Genus database with same CATH superfamily
2FD4A 3HCUA 2KWOA 2XOCA 2ECWA 3EB5A 4XI1A 3DPLR 1Z60A 2YYRA 1WEQA 2L7PA 4TKPB 5TRBA 2CRWA 3ZVYA 2EGMA 4X3GA 2FFWA 4B7YC 3N9OA 4LK9A 3C6WA 1JM7A 4L58A 4O64A 2QICA 2EA6A 3N9LA 4FIPA 4YAXA 2VJFA 3IHPA 5D1LB 1WEPA 5C11A 1VYXA 2LGVA 2LGLA 4C9ZA 3GV4A 3L1ZB 2VJEB 3U5NA 4AUQB 2IQJA 1WENA 2LGKA 2FUIA 1X4UA 1G25A 1U6GB 3O35A 3O37A 1Z6UA 3LQHA 4ZDTA 5SVXA 3KDEC 2B0OE 1WEEA 3O33A 2OXQC 2IDAA 2K17A 5B78A 2M1RA 1K2FA 4A4CA 3EB6A 4A4BA 2KWKA 5G0FA 2HDPA 3ZTGA 1VFYA 2KR4A 2KFTA 4MSXA 2LXPC 3KNVA 3ZNIA 4WA6A 3O36A 5FERA 5K3QA 2XB1A 4W4UA 2K4DA 2VNFA 2MIQA 1Z2QA 3KV5A 4AP4A 5SVIA 1T1HA 2KKYA 2PUYA 5G05B 4IC3A 5SVYA 2YREA 1WEWA 4Z0OA 2XP0A 2ECJA 5LKXA 5H9MA 5DKAA 3RPGB 2KWJA 2F6NA 2D8SA 2ECTA 2VP7A 1WILA 2KE1A 4N3WA 2LN0A 2YURA 5DINA 3LRQA 2YW8A 2DJAA 2JMIA 2Y1MA 3N9QA 2I50A 3RTRB 2ECVA 4LLBA 5KH3A 3SOWA 2JMDA 1V87A 2LXHC 3L1XA 2CKLA 2E6SA 2ECGA 1MM2A 3PUQA 3E2DA 4PTBA 4AYCA 2C2LA 4GNEA 2UZGA 5FEYA 4AVXA 2LRIC 1HYJA 2JUNA 2Y1NA 2E6RA 5D1KB 2YHNA 2LQ6A 1WEUA 4N4FA 3VK6A 4OGCA 2L0BA 5TBNA 3M7KA 3ZPV1 2YHOA 2MNYA 5FB0A 2CRRA 1JM7B 2M3HA 3M63A 4S3OB 2H0DA 3NG2A 2VJFB 4A0CD 2KWNA 2HYED 5TDWA 1XWHA 2M13A 3M62A 3DQVR 3KQIA 2YSMA 4O62A 4F52B 1DVPA 4I7CA 5LKTA 5G04B 1WEVA 5H1VA 5B77A 2EODA 2RSDA 2CONA 5KH9A 3LVRE 3HTKC 4L7XA 2L43A 1WFKA 4BHWA 3LDYA 2L75A 4UI9B 4H9DA 2KKXA 2PNXA 3PURA 2K1JA 5D1MB 4YC9A 5B76A 2YSJA 2C2VS 4GNFA 1VD4A 2BAYA 3FL2A 3M99A 1JOCA 2CSZA 2FSAA 2KIZA 2M6MA 3Q1DA 3O34A 2G43A 4YADA 3SOXA 3LVQE 2ECNA 1WGMA 2G6QA 3V43A 3LQJA 5SVIB 2L80A 3PHDA 3SUBA 2MD7B 2P57A 1CHCA 2VPBA 1BORA 4R2YA 3QZVA 1LDJB 3LQIA 5TDRA 4GB0A 3O70A 3FJUB 2EXUA 2DSMA 3KV6A 2G45A 5FB1A 5J3XA 3PLWA 2JM3A 3JUEA 2QJ0A 5LKUA 3ZYQA 4YABA 4R7EA 4ZUXU 2K16A 2AN6A 3MDBC 2YT5A 4CA1A 3SHBA 2CKLB 2FUUA 4AYCB 2LAUA 4FO9A 4UP5A 2YUCA 1FBVA 3MHSA 1X4IA 5H1UA 5LKZA 1MM3A 2ECIA 2CSYA 1WIMA 2XOZA 2EGPA 3I2DA 3RPGC 2KREA 1IYMA 3U5PA 3T7LA 3T9KA 2RR4A 3GL6A 5B8DA 4B86C 4YBSA 1WE9A 2H0DB 4WZ0A 2KGIA 2VPEA 3U5MA 3ZVZB 2MT5A 2KYUA 4NN2A 2MKEA 3O7AA 1MBMA 2LV9A 2M85A 2XOYA 2D8UA 2VPDA 4PPEA 4LADB 4GNDA 2E61A 5H1TA 4YBMA 4IC2A 3FM8C 5JG6A 4YBTA 4WZ2A 4QQ4A 2JMJA 2CSVA 2VJEA 1E4UA 5LCWB 2LDRA 3T6RA 2MUMA 5KH7A 2NAAA 4I7DA 1WEMA 2MA5A 2KGGA 2XEUA 4S3OC 4MVTA 1FP0A 4V3LC 1WEOA 5I3LA 4BBQA 3N9NA 2YQLA 1DCQA 3FANA 3FAOA 2MNZA 4Q6FA 4Z0RA 2QIZA 3DWDA 2CT2A 3DDTA 5B79A 1RMDA 4I7BA 4FK5A 3N9PA 3ZPVE 1HYIA 3HCSA 2YVRA 2OWAA 5TABA 2RI7A 5AIUA 5B75A 5C13A 1X4JA 4QF3A 1F62A 4R8PK 4YATA 2VPGA 3H7HA 4LKAA 4QF2A 5EYAF 3U5OA 4UP0A 1N87A 1WESA 4LJNA 3L11A 2YQMA 4P5OB 2DX8A 4CCGX 3LJUX 4WZ3B 5AITA 3SOUA 1LDKC 2MA6A 4A49A 3ASLA 3FEHA 3O47A 3N9MA 2YU4A 4FJCA 2F6JA 2JRJA 2Y43A 2F42A 2L5UA 4ZQLA 3HCTA 4GNGA 4OGEA 3C5KA 2LGGA 4V3KC 2KU3A 2ZETC 1ZBDB 2MD8C 3MHHA 4F1PA
chains in the Genus database with same CATH topology
3HCUA 2KWOA 2ECWA 3EB5A 4XI1A 3DPLR 1Z60A 2YYRA 1WEQA 4TKPB 5TRBA 3ZVYA 4X3GA 4B7YC 3N9OA 4LK9A 3C6WA 1JM7A 4L58A 4O64A 2QICA 2EA6A 3N9LA 4FIPA 4YAXA 2VJFA 3IHPA 5D1LB 1WEPA 5C11A 1VYXA 2LGVA 2LGLA 4C9ZA 3GV4A 3L1ZB 2VJEB 3U5NA 4AUQB 1WENA 2LGKA 2FUIA 1X4UA 1G25A 1U6GB 3O35A 3O37A 1Z6UA 3LQHA 4ZDTA 1WEEA 3O33A 2OXQC 2IDAA 2K17A 5B78A 2M1RA 1K2FA 4A4CA 3EB6A 4A4BA 2KWKA 5G0FA 2HDPA 3ZTGA 1VFYA 2KR4A 2KFTA 4MSXA 2LXPC 3KNVA 3ZNIA 4WA6A 3O36A 5FERA 2XB1A 4W4UA 2K4DA 2VNFA 2MIQA 1Z2QA 3KV5A 4AP4A 1T1HA 2PUYA 5G05B 4IC3A 2YREA 1WEWA 2ECJA 5LKXA 5H9MA 3RPGB 5DKAA 2KWJA 2F6NA 2D8SA 2ECTA 2VP7A 1WILA 2KE1A 4N3WA 2LN0A 2YURA 5DINA 3LRQA 2YW8A 2JMIA 2Y1MA 3N9QA 2I50A 3RTRB 2ECVA 4LLBA 5KH3A 3SOWA 2JMDA 1V87A 2LXHC 3L1XA 2CKLA 2E6SA 2ECGA 1MM2A 3PUQA 4PTBA 4AYCA 2C2LA 4GNEA 2UZGA 5FEYA 4AVXA 2LRIC 1HYJA 2Y1NA 2E6RA 5D1KB 2YHNA 2LQ6A 1WEUA 4N4FA 3VK6A 2L0BA 5TBNA 3ZPV1 2YHOA 2MNYA 5FB0A 1JM7B 2M3HA 3M63A 4S3OB 2H0DA 3NG2A 2VJFB 4A0CD 2KWNA 2HYED 5TDWA 1XWHA 3M62A 3DQVR 3KQIA 2YSMA 4F52B 1DVPA 4I7CA 5LKTA 5G04B 1WEVA 5H1VA 5B77A 2EODA 2RSDA 5KH9A 3HTKC 4L7XA 2L43A 1WFKA 4BHWA 2L75A 4UI9B 3PURA 2PNXA 2K1JA 5D1MB 4YC9A 5B76A 2YSJA 2C2VS 4GNFA 1VD4A 2BAYA 3FL2A 3M99A 1JOCA 2CSZA 2FSAA 2KIZA 2M6MA 3O34A 2G43A 4YADA 3SOXA 2ECNA 1WGMA 2G6QA 3V43A 3LQJA 2L80A 3PHDA 2MD7B 1CHCA 2VPBA 1BORA 4R2YA 3QZVA 1LDJB 3LQIA 5TDRA 4GB0A 3O70A 3KV6A 2G45A 5FB1A 5J3XA 2QJ0A 5LKUA 3ZYQA 4YABA 4R7EA 4ZUXU 2K16A 2AN6A 2YT5A 4CA1A 3SHBA 2CKLB 2FUUA 4AYCB 4FO9A 4UP5A 2YUCA 1FBVA 3MHSA 1X4IA 5H1UA 5LKZA 1MM3A 2ECIA 2CSYA 1WIMA 2EGPA 3I2DA 3RPGC 2KREA 1IYMA 3U5PA 3T7LA 3GL6A 5B8DA 4B86C 4YBSA 1WE9A 2H0DB 4WZ0A 2KGIA 2VPEA 3U5MA 3ZVZB 2MT5A 2KYUA 4NN2A 3O7AA 2LV9A 2M85A 2VPDA 4PPEA 4LADB 4GNDA 5H1TA 4YBMA 4IC2A 5JG6A 4YBTA 4WZ2A 2JMJA 2VJEA 1E4UA 5LCWB 2LDRA 3T6RA 2MUMA 5KH7A 2NAAA 4I7DA 1WEMA 2MA5A 2KGGA 2XEUA 4S3OC 4V3LC 1FP0A 4MVTA 1WEOA 5I3LA 4BBQA 3N9NA 2YQLA 2MNZA 4Q6FA 2QIZA 2CT2A 5B79A 1RMDA 4I7BA 4FK5A 3N9PA 3ZPVE 1HYIA 3HCSA 5TABA 2RI7A 5AIUA 5B75A 5C13A 1X4JA 4QF3A 1F62A 4R8PK 4YATA 2VPGA 4LKAA 4QF2A 5EYAF 3U5OA 4UP0A 1N87A 1WESA 4LJNA 3L11A 2YQMA 4P5OB 2DX8A 4CCGX 4WZ3B 5AITA 3SOUA 1LDKC 2MA6A 4A49A 3ASLA 3N9MA 2YU4A 4FJCA 2F6JA 2JRJA 2Y43A 2F42A 2L5UA 4ZQLA 3HCTA 4GNGA 3C5KA 2LGGA 4V3KC 2KU3A 2ZETC 1ZBDB 2MD8C 3MHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCU A;  2KWO A;  2ECW A;  3EB5 A;  4XI1 A;  3DPL R;  1Z60 A;  2YYR A;  1WEQ A;  4TKP B;  5TRB A;  3ZVY A;  4X3G A;  4B7Y C;  3N9O A;  4LK9 A;  3C6W A;  1JM7 A;  4L58 A;  4O64 A;  2QIC A;  2EA6 A;  3N9L A;  4FIP A;  4YAX A;  2VJF A;  3IHP A;  5D1L B;  1WEP A;  5C11 A;  1VYX A;  2LGV A;  2LGL A;  4C9Z A;  3GV4 A;  3L1Z B;  2VJE B;  3U5N A;  4AUQ B;  1WEN A;  2LGK A;  2FUI A;  1X4U A;  1G25 A;  1U6G B;  3O35 A;  3O37 A;  1Z6U A;  3LQH A;  4ZDT A;  1WEE A;  3O33 A;  2OXQ C;  2IDA A;  2K17 A;  5B78 A;  2M1R A;  1K2F A;  4A4C A;  3EB6 A;  4A4B A;  2KWK A;  5G0F A;  2HDP A;  3ZTG A;  1VFY A;  2KR4 A;  2KFT A;  4MSX A;  2LXP C;  3KNV A;  3ZNI A;  4WA6 A;  3O36 A;  5FER A;  2XB1 A;  4W4U A;  2K4D A;  2VNF A;  2MIQ A;  1Z2Q A;  3KV5 A;  4AP4 A;  1T1H A;  2PUY A;  5G05 B;  4IC3 A;  2YRE A;  1WEW A;  2ECJ A;  5LKX A;  5H9M A;  3RPG B;  5DKA A;  2KWJ A;  2F6N A;  2D8S A;  2ECT A;  2VP7 A;  1WIL A;  2KE1 A;  4N3W A;  2LN0 A;  2YUR A;  5DIN A;  3LRQ A;  2YW8 A;  2JMI A;  2Y1M A;  3N9Q A;  2I50 A;  3RTR B;  2ECV A;  4LLB A;  5KH3 A;  3SOW A;  2JMD A;  1V87 A;  2LXH C;  3L1X A;  2CKL A;  2E6S A;  2ECG A;  1MM2 A;  3PUQ A;  4PTB A;  4AYC A;  2C2L A;  4GNE A;  2UZG A;  5FEY A;  4AVX A;  2LRI C;  1HYJ A;  2Y1N A;  2E6R A;  5D1K B;  2YHN A;  2LQ6 A;  1WEU A;  4N4F A;  3VK6 A;  2L0B A;  5TBN A;  3ZPV 1;  2YHO A;  2MNY A;  5FB0 A;  1JM7 B;  2M3H A;  3M63 A;  4S3O B;  2H0D A;  3NG2 A;  2VJF B;  4A0C D;  2KWN A;  2HYE D;  5TDW A;  1XWH A;  3M62 A;  3DQV R;  3KQI A;  2YSM A;  4F52 B;  1DVP A;  4I7C A;  5LKT A;  5G04 B;  1WEV A;  5H1V A;  5B77 A;  2EOD A;  2RSD A;  5KH9 A;  3HTK C;  4L7X A;  2L43 A;  1WFK A;  4BHW A;  2L75 A;  4UI9 B;  3PUR A;  2PNX A;  2K1J A;  5D1M B;  4YC9 A;  5B76 A;  2YSJ A;  2C2V S;  4GNF A;  1VD4 A;  2BAY A;  3FL2 A;  3M99 A;  1JOC A;  2CSZ A;  2FSA A;  2KIZ A;  2M6M A;  3O34 A;  2G43 A;  4YAD A;  3SOX A;  2ECN A;  1WGM A;  2G6Q A;  3V43 A;  3LQJ A;  2L80 A;  3PHD A;  2MD7 B;  1CHC A;  2VPB A;  1BOR A;  4R2Y A;  3QZV A;  1LDJ B;  3LQI A;  5TDR A;  4GB0 A;  3O70 A;  3KV6 A;  2G45 A;  5FB1 A;  5J3X A;  2QJ0 A;  5LKU A;  3ZYQ A;  4YAB A;  4R7E A;  4ZUX U;  2K16 A;  2AN6 A;  2YT5 A;  4CA1 A;  3SHB A;  2CKL B;  2FUU A;  4AYC B;  4FO9 A;  4UP5 A;  2YUC A;  1FBV A;  3MHS A;  1X4I A;  5H1U A;  5LKZ A;  1MM3 A;  2ECI A;  2CSY A;  1WIM A;  2EGP A;  3I2D A;  3RPG C;  2KRE A;  1IYM A;  3U5P A;  3T7L A;  3GL6 A;  5B8D A;  4B86 C;  4YBS A;  1WE9 A;  2H0D B;  4WZ0 A;  2KGI A;  2VPE A;  3U5M A;  3ZVZ B;  2MT5 A;  2KYU A;  4NN2 A;  3O7A A;  2LV9 A;  2M85 A;  2VPD A;  4PPE A;  4LAD B;  4GND A;  5H1T A;  4YBM A;  4IC2 A;  5JG6 A;  4YBT A;  4WZ2 A;  2JMJ A;  2VJE A;  1E4U A;  5LCW B;  2LDR A;  3T6R A;  2MUM A;  5KH7 A;  2NAA A;  4I7D A;  1WEM A;  2MA5 A;  2KGG A;  2XEU A;  4S3O C;  4V3L C;  1FP0 A;  4MVT A;  1WEO A;  5I3L A;  4BBQ A;  3N9N A;  2YQL A;  2MNZ A;  4Q6F A;  2QIZ A;  2CT2 A;  5B79 A;  1RMD A;  4I7B A;  4FK5 A;  3N9P A;  3ZPV E;  1HYI A;  3HCS A;  5TAB A;  2RI7 A;  5AIU A;  5B75 A;  5C13 A;  1X4J A;  4QF3 A;  1F62 A;  4R8P K;  4YAT A;  2VPG A;  4LKA A;  4QF2 A;  5EYA F;  3U5O A;  4UP0 A;  1N87 A;  1WES A;  4LJN A;  3L11 A;  2YQM A;  4P5O B;  2DX8 A;  4CCG X;  4WZ3 B;  5AIT A;  3SOU A;  1LDK C;  2MA6 A;  4A49 A;  3ASL A;  3N9M A;  2YU4 A;  4FJC A;  2F6J A;  2JRJ A;  2Y43 A;  2F42 A;  2L5U A;  4ZQL A;  3HCT A;  4GNG A;  3C5K A;  2LGG A;  4V3K C;  2KU3 A;  2ZET C;  1ZBD B;  2MD8 C;  3MHH A; 
#chains in the Genus database with same CATH topology
 2FD4 A;  3HCU A;  2KWO A;  2XOC A;  2ECW A;  3EB5 A;  4XI1 A;  3DPL R;  1Z60 A;  2YYR A;  1WEQ A;  2L7P A;  4TKP B;  5TRB A;  2CRW A;  3ZVY A;  2EGM A;  4X3G A;  2FFW A;  4B7Y C;  3N9O A;  4LK9 A;  3C6W A;  1JM7 A;  4L58 A;  4O64 A;  2QIC A;  2EA6 A;  3N9L A;  4FIP A;  4YAX A;  2VJF A;  3IHP A;  5D1L B;  1WEP A;  5C11 A;  1VYX A;  2LGV A;  2LGL A;  4C9Z A;  3GV4 A;  3L1Z B;  2VJE B;  3U5N A;  4AUQ B;  2IQJ A;  1WEN A;  2LGK A;  2FUI A;  1X4U A;  1G25 A;  1U6G B;  3O35 A;  3O37 A;  1Z6U A;  3LQH A;  4ZDT A;  5SVX A;  3KDE C;  2B0O E;  1WEE A;  3O33 A;  2OXQ C;  2IDA A;  2K17 A;  5B78 A;  2M1R A;  1K2F A;  4A4C A;  3EB6 A;  4A4B A;  2KWK A;  5G0F A;  2HDP A;  3ZTG A;  1VFY A;  2KR4 A;  2KFT A;  4MSX A;  2LXP C;  3KNV A;  3ZNI A;  4WA6 A;  3O36 A;  5FER A;  5K3Q A;  2XB1 A;  4W4U A;  2K4D A;  2VNF A;  2MIQ A;  1Z2Q A;  3KV5 A;  4AP4 A;  5SVI A;  1T1H A;  2KKY A;  2PUY A;  5G05 B;  4IC3 A;  5SVY A;  2YRE A;  1WEW A;  4Z0O A;  2XP0 A;  2ECJ A;  5LKX A;  5H9M A;  5DKA A;  3RPG B;  2KWJ A;  2F6N A;  2D8S A;  2ECT A;  2VP7 A;  1WIL A;  2KE1 A;  4N3W A;  2LN0 A;  2YUR A;  5DIN A;  3LRQ A;  2YW8 A;  2DJA A;  2JMI A;  2Y1M A;  3N9Q A;  2I50 A;  3RTR B;  2ECV A;  4LLB A;  5KH3 A;  3SOW A;  2JMD A;  1V87 A;  2LXH C;  3L1X A;  2CKL A;  2E6S A;  2ECG A;  1MM2 A;  3PUQ A;  3E2D A;  4PTB A;  4AYC A;  2C2L A;  4GNE A;  2UZG A;  5FEY A;  4AVX A;  2LRI C;  1HYJ A;  2JUN A;  2Y1N A;  2E6R A;  5D1K B;  2YHN A;  2LQ6 A;  1WEU A;  4N4F A;  3VK6 A;  4OGC A;  2L0B A;  5TBN A;  3M7K A;  3ZPV 1;  2YHO A;  2MNY A;  5FB0 A;  2CRR A;  1JM7 B;  2M3H A;  3M63 A;  4S3O B;  2H0D A;  3NG2 A;  2VJF B;  4A0C D;  2KWN A;  2HYE D;  5TDW A;  1XWH A;  2M13 A;  3M62 A;  3DQV R;  3KQI A;  2YSM A;  4O62 A;  4F52 B;  1DVP A;  4I7C A;  5LKT A;  5G04 B;  1WEV A;  5H1V A;  5B77 A;  2EOD A;  2RSD A;  2CON A;  5KH9 A;  3LVR E;  3HTK C;  4L7X A;  2L43 A;  1WFK A;  4BHW A;  3LDY A;  2L75 A;  4UI9 B;  4H9D A;  2KKX A;  2PNX A;  3PUR A;  2K1J A;  5D1M B;  4YC9 A;  5B76 A;  2YSJ A;  2C2V S;  4GNF A;  1VD4 A;  2BAY A;  3FL2 A;  3M99 A;  1JOC A;  2CSZ A;  2FSA A;  2KIZ A;  2M6M A;  3Q1D A;  3O34 A;  2G43 A;  4YAD A;  3SOX A;  3LVQ E;  2ECN A;  1WGM A;  2G6Q A;  3V43 A;  3LQJ A;  5SVI B;  2L80 A;  3PHD A;  3SUB A;  2MD7 B;  2P57 A;  1CHC A;  2VPB A;  1BOR A;  4R2Y A;  3QZV A;  1LDJ B;  3LQI A;  5TDR A;  4GB0 A;  3O70 A;  3FJU B;  2EXU A;  2DSM A;  3KV6 A;  2G45 A;  5FB1 A;  5J3X A;  3PLW A;  2JM3 A;  3JUE A;  2QJ0 A;  5LKU A;  3ZYQ A;  4YAB A;  4R7E A;  4ZUX U;  2K16 A;  2AN6 A;  3MDB C;  2YT5 A;  4CA1 A;  3SHB A;  2CKL B;  2FUU A;  4AYC B;  2LAU A;  4FO9 A;  4UP5 A;  2YUC A;  1FBV A;  3MHS A;  1X4I A;  5H1U A;  5LKZ A;  1MM3 A;  2ECI A;  2CSY A;  1WIM A;  2XOZ A;  2EGP A;  3I2D A;  3RPG C;  2KRE A;  1IYM A;  3U5P A;  3T7L A;  3T9K A;  2RR4 A;  3GL6 A;  5B8D A;  4B86 C;  4YBS A;  1WE9 A;  2H0D B;  4WZ0 A;  2KGI A;  2VPE A;  3U5M A;  3ZVZ B;  2MT5 A;  2KYU A;  4NN2 A;  2MKE A;  3O7A A;  1MBM A;  2LV9 A;  2M85 A;  2XOY A;  2D8U A;  2VPD A;  4PPE A;  4LAD B;  4GND A;  2E61 A;  5H1T A;  4YBM A;  4IC2 A;  3FM8 C;  5JG6 A;  4YBT A;  4WZ2 A;  4QQ4 A;  2JMJ A;  2CSV A;  2VJE A;  1E4U A;  5LCW B;  2LDR A;  3T6R A;  2MUM A;  5KH7 A;  2NAA A;  4I7D A;  1WEM A;  2MA5 A;  2KGG A;  2XEU A;  4S3O C;  4MVT A;  1FP0 A;  4V3L C;  1WEO A;  5I3L A;  4BBQ A;  3N9N A;  2YQL A;  1DCQ A;  3FAN A;  3FAO A;  2MNZ A;  4Q6F A;  4Z0R A;  2QIZ A;  3DWD A;  2CT2 A;  3DDT A;  5B79 A;  1RMD A;  4I7B A;  4FK5 A;  3N9P A;  3ZPV E;  1HYI A;  3HCS A;  2YVR A;  2OWA A;  5TAB A;  2RI7 A;  5AIU A;  5B75 A;  5C13 A;  1X4J A;  4QF3 A;  1F62 A;  4R8P K;  4YAT A;  2VPG A;  3H7H A;  4LKA A;  4QF2 A;  5EYA F;  3U5O A;  4UP0 A;  1N87 A;  1WES A;  4LJN A;  3L11 A;  2YQM A;  4P5O B;  2DX8 A;  4CCG X;  3LJU X;  4WZ3 B;  5AIT A;  3SOU A;  1LDK C;  2MA6 A;  4A49 A;  3ASL A;  3FEH A;  3O47 A;  3N9M A;  2YU4 A;  4FJC A;  2F6J A;  2JRJ A;  2Y43 A;  2F42 A;  2L5U A;  4ZQL A;  3HCT A;  4GNG A;  4OGE A;  3C5K A;  2LGG A;  4V3K C;  2KU3 A;  2ZET C;  1ZBD B;  2MD8 C;  3MHH A;  4F1P A; 
#chains in the Genus database with same CATH homology
 3HCU A;  2KWO A;  2ECW A;  3EB5 A;  4XI1 A;  3DPL R;  1Z60 A;  2YYR A;  1WEQ A;  4TKP B;  5TRB A;  3ZVY A;  4X3G A;  4B7Y C;  3N9O A;  4LK9 A;  3C6W A;  1JM7 A;  4L58 A;  4O64 A;  2QIC A;  2EA6 A;  3N9L A;  4FIP A;  4YAX A;  2VJF A;  3IHP A;  5D1L B;  1WEP A;  5C11 A;  1VYX A;  2LGV A;  2LGL A;  4C9Z A;  3GV4 A;  3L1Z B;  2VJE B;  3U5N A;  4AUQ B;  1WEN A;  2LGK A;  2FUI A;  1X4U A;  1G25 A;  1U6G B;  3O35 A;  3O37 A;  1Z6U A;  3LQH A;  4ZDT A;  1WEE A;  3O33 A;  2OXQ C;  2IDA A;  2K17 A;  5B78 A;  2M1R A;  1K2F A;  4A4C A;  3EB6 A;  4A4B A;  2KWK A;  5G0F A;  2HDP A;  3ZTG A;  1VFY A;  2KR4 A;  2KFT A;  4MSX A;  2LXP C;  3KNV A;  3ZNI A;  4WA6 A;  3O36 A;  5FER A;  2XB1 A;  4W4U A;  2K4D A;  2VNF A;  2MIQ A;  1Z2Q A;  3KV5 A;  4AP4 A;  1T1H A;  2PUY A;  5G05 B;  4IC3 A;  2YRE A;  1WEW A;  2ECJ A;  5LKX A;  5H9M A;  3RPG B;  5DKA A;  2KWJ A;  2F6N A;  2D8S A;  2ECT A;  2VP7 A;  1WIL A;  2KE1 A;  4N3W A;  2LN0 A;  2YUR A;  5DIN A;  3LRQ A;  2YW8 A;  2JMI A;  2Y1M A;  3N9Q A;  2I50 A;  3RTR B;  2ECV A;  4LLB A;  5KH3 A;  3SOW A;  2JMD A;  1V87 A;  2LXH C;  3L1X A;  2CKL A;  2E6S A;  2ECG A;  1MM2 A;  3PUQ A;  4PTB A;  4AYC A;  2C2L A;  4GNE A;  2UZG A;  5FEY A;  4AVX A;  2LRI C;  1HYJ A;  2Y1N A;  2E6R A;  5D1K B;  2YHN A;  2LQ6 A;  1WEU A;  4N4F A;  3VK6 A;  2L0B A;  5TBN A;  3ZPV 1;  2YHO A;  2MNY A;  5FB0 A;  1JM7 B;  2M3H A;  3M63 A;  4S3O B;  2H0D A;  3NG2 A;  2VJF B;  4A0C D;  2KWN A;  2HYE D;  5TDW A;  1XWH A;  3M62 A;  3DQV R;  3KQI A;  2YSM A;  4F52 B;  1DVP A;  4I7C A;  5LKT A;  5G04 B;  1WEV A;  5H1V A;  5B77 A;  2EOD A;  2RSD A;  5KH9 A;  3HTK C;  4L7X A;  2L43 A;  1WFK A;  4BHW A;  2L75 A;  4UI9 B;  3PUR A;  2PNX A;  2K1J A;  5D1M B;  4YC9 A;  5B76 A;  2YSJ A;  2C2V S;  4GNF A;  1VD4 A;  2BAY A;  3FL2 A;  3M99 A;  1JOC A;  2CSZ A;  2FSA A;  2KIZ A;  2M6M A;  3O34 A;  2G43 A;  4YAD A;  3SOX A;  2ECN A;  1WGM A;  2G6Q A;  3V43 A;  3LQJ A;  2L80 A;  3PHD A;  2MD7 B;  1CHC A;  2VPB A;  1BOR A;  4R2Y A;  3QZV A;  1LDJ B;  3LQI A;  5TDR A;  4GB0 A;  3O70 A;  3KV6 A;  2G45 A;  5FB1 A;  5J3X A;  2QJ0 A;  5LKU A;  3ZYQ A;  4YAB A;  4R7E A;  4ZUX U;  2K16 A;  2AN6 A;  2YT5 A;  4CA1 A;  3SHB A;  2CKL B;  2FUU A;  4AYC B;  4FO9 A;  4UP5 A;  2YUC A;  1FBV A;  3MHS A;  1X4I A;  5H1U A;  5LKZ A;  1MM3 A;  2ECI A;  2CSY A;  1WIM A;  2EGP A;  3I2D A;  3RPG C;  2KRE A;  1IYM A;  3U5P A;  3T7L A;  3GL6 A;  5B8D A;  4B86 C;  4YBS A;  1WE9 A;  2H0D B;  4WZ0 A;  2KGI A;  2VPE A;  3U5M A;  3ZVZ B;  2MT5 A;  2KYU A;  4NN2 A;  3O7A A;  2LV9 A;  2M85 A;  2VPD A;  4PPE A;  4LAD B;  4GND A;  5H1T A;  4YBM A;  4IC2 A;  5JG6 A;  4YBT A;  4WZ2 A;  2JMJ A;  2VJE A;  1E4U A;  5LCW B;  2LDR A;  3T6R A;  2MUM A;  5KH7 A;  2NAA A;  4I7D A;  1WEM A;  2MA5 A;  2KGG A;  2XEU A;  4S3O C;  4V3L C;  1FP0 A;  4MVT A;  1WEO A;  5I3L A;  4BBQ A;  3N9N A;  2YQL A;  2MNZ A;  4Q6F A;  2QIZ A;  2CT2 A;  5B79 A;  1RMD A;  4I7B A;  4FK5 A;  3N9P A;  3ZPV E;  1HYI A;  3HCS A;  5TAB A;  2RI7 A;  5AIU A;  5B75 A;  5C13 A;  1X4J A;  4QF3 A;  1F62 A;  4R8P K;  4YAT A;  2VPG A;  4LKA A;  4QF2 A;  5EYA F;  3U5O A;  4UP0 A;  1N87 A;  1WES A;  4LJN A;  3L11 A;  2YQM A;  4P5O B;  2DX8 A;  4CCG X;  4WZ3 B;  5AIT A;  3SOU A;  1LDK C;  2MA6 A;  4A49 A;  3ASL A;  3N9M A;  2YU4 A;  4FJC A;  2F6J A;  2JRJ A;  2Y43 A;  2F42 A;  2L5U A;  4ZQL A;  3HCT A;  4GNG A;  3C5K A;  2LGG A;  4V3K C;  2KU3 A;  2ZET C;  1ZBD B;  2MD8 C;  3MHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...