4AUQB

Structure of birc7-ubch5b-ub complex.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
QLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
publication title Birc7-E2 Ubiquitin Conjugate Structure Reveals the Mechanism of Ubiquitin Transfer by a Ring Dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase/signalling protein
total genus 11
structure length 57
sequence length 57
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4auqB00
3T6RA 2VPEA 1G25A 1WEEA 3DPLR 4LADB 1WE9A 3SHBA 4AYCA 2EA6A 2Y43A 2LGLA 3L1ZB 3NG2A 1MM3A 4UP0A 2H0DB 5TABA 3N9PA 3MHSA 4AVXA 2KWKA 4X3GA 2YW8A 4N4FA 4R7EA 2YU4A 4F52B 2MA5A 2MNYA 2IDAA 2LQ6A 1T1HA 2KREA 2KR4A 3PURA 2HYED 2YSMA 2G45A 3O35A 5G05B 1IYMA 1VYXA 5KH3A 3O34A 2K4DA 3O37A 5LCWB 2M1RA 2G6QA 4FO9A 2LGVA 2CKLA 4LLBA 2VPDA 3I2DA 1JOCA 2HDPA 4IC3A 1DVPA 2KWNA 2VJEA 3N9MA 2CT2A 4TKPB 4B7YC 4XI1A 4FIPA 1WEQA 2JMIA 3N9QA 5H1UA 1LDKC 3ASLA 5DINA 2JRJA 2MT5A 3U5NA 2VJFB 4A4CA 2KFTA 5AIUA 4W4UA 2LGKA 3SOXA 3SOUA 2F6NA 2XB1A 3U5OA 1HYJA 2OXQC 1JM7B 5DKAA 3QZVA 3M63A 4P5OB 2KYUA 2DX8A 4B86C 4BBQA 2KWJA 5LKZA 3VK6A 2MNZA 4FJCA 2I50A 2VP7A 5JG6A 2ECNA 3KV6A 2H0DA 4FK5A 3PHDA 5B8DA 2CSZA 3ZPV1 3O70A 2LXHC 5B76A 2KU3A 2KIZA 4ZDTA 5TBNA 5H1TA 5B78A 2Y1NA 1WEUA 4LJNA 5LKUA 3FL2A 2FUUA 2L75A 3C5KA 2MUMA 1K2FA 3HCTA 3N9LA 4LKAA 2VNFA 2YHOA 3EB6A 2PNXA 5B79A 1N87A 3LQHA 3EB5A 3RTRB 5B77A 4WZ0A 2KGGA 5H1VA 3GV4A 1Z60A 2L80A 4V3KC 1MM2A 2AN6A 1WEWA 3O7AA 2YT5A 4I7DA 4R8PK 4I7CA 2ECGA 3O33A 2ECWA 2RI7A 4PPEA 2LGGA 1ZBDB 4L7XA 3HCUA 2FUIA 1WEMA 4YATA 5D1LB 1WFKA 2E6SA 1WEOA 5TDRA 2KWOA 2VJFA 1VFYA 4I7BA 1FBVA 1E4UA 5I3LA 1HYIA 2CSYA 5TRBA 3HCSA 4GNFA 1VD4A 1JM7A 4Q6FA 1WESA 2XEUA 5G0FA 4YAXA 4A0CD 3HTKC 4YC9A 2MD7B 2YREA 3MHHA 4ZQLA 3L11A 2F42A 2K16A 4UP5A 5FEYA 3RPGB 1WEPA 2ECTA 5KH9A 5C13A 1WIMA 4IC2A 2M85A 4ZUXU 2PUYA 2EGPA 2YUCA 5G04B 2BAYA 4L58A 4CA1A 4WZ3B 3IHPA 3V43A 1WILA 4BHWA 3T7LA 5FB1A 4WZ2A 2M6MA 4YBMA 1Z6UA 3KV5A 1U6GB 2D8SA 2E6RA 4AUQB 3LRQA 2YQLA 2FSAA 5TDWA 5LKTA 1FP0A 4V3LC 4NN2A 2MIQA 2JMJA 3L1XA 2VPBA 3O36A 3ZYQA 3RPGC 1CHCA 2YURA 4UI9B 1X4JA 4LK9A 4GNGA 2QICA 3ZVZB 3SOWA 3LQIA 2C2VS 3LQJA 2LXPC 1WENA 3ZNIA 5H9MA 2LV9A 2M3HA 1F62A 3N9OA 4YBSA 2QIZA 4AYCB 2LDRA 5D1KB 4YABA 4C9ZA 2KE1A 4AP4A 4YADA 2YQMA 5FERA 2MD8C 2LRIC 2YSJA 4MVTA 2MA6A 2G43A 4GNDA 3M62A 2QJ0A 2YYRA 2K1JA 4YBTA 5FB0A 2ECVA 4PTBA 4WA6A 2Y1MA 3KQIA 2VPGA 1X4UA 3U5PA 2RSDA 4QF2A 4S3OB 3N9NA 5B75A 2L43A 1WGMA 2ECJA 4A49A 1XWHA 2UZGA 2ECIA 5EYAF 4GNEA 5KH7A 2CKLB 1WEVA 4R2YA 4CCGX 2ZETC 3KNVA 2L0BA 1RMDA 3PUQA 2VJEB 3U5MA 4QF3A 2F6JA 3ZPVE 2KGIA 1Z2QA 1X4IA 1LDJB 2L5UA 2JMDA 3M99A 4N3WA 2YHNA 4O64A 5J3XA 4S3OC 3GL6A 2NAAA 3DQVR 2K17A 1BORA 3C6WA 4MSXA 4A4BA 2C2LA 5AITA 3ZVYA 1V87A 5LKXA 4GB0A 3ZTGA 2LN0A 2EODA 5C11A 5D1MB
chains in the Genus database with same CATH superfamily
3T6RA 2VPEA 1G25A 1WEEA 3DPLR 4LADB 1WE9A 3SHBA 4OGEA 2XOCA 4AYCA 2EA6A 2Y43A 2LGLA 3L1ZB 3NG2A 1MM3A 4UP0A 2H0DB 5TABA 3O47A 3N9PA 3MHSA 4AVXA 2KWKA 4X3GA 2YW8A 2JM3A 4N4FA 4R7EA 2YU4A 4F52B 2MA5A 2MNYA 2IDAA 3Q1DA 3PLWA 2LQ6A 1T1HA 2KREA 2KR4A 3PURA 2HYED 2YSMA 2G45A 3O35A 5G05B 1IYMA 1VYXA 5KH3A 3O34A 2K4DA 3O37A 5LCWB 2M1RA 4QQ4A 2G6QA 2B0OE 2FD4A 4FO9A 2LGVA 2CKLA 2P57A 4LLBA 2VPDA 3I2DA 1JOCA 2HDPA 4IC3A 1DVPA 2KWNA 2VJEA 3N9MA 2CT2A 4TKPB 4B7YC 4XI1A 4FIPA 1WEQA 2JMIA 3N9QA 5H1UA 1LDKC 3ASLA 5DINA 2JRJA 2MT5A 3U5NA 2LAUA 2VJFB 4A4CA 2KFTA 5AIUA 4W4UA 2LGKA 3SOXA 1DCQA 3SOUA 3LDYA 2F6NA 2XB1A 3U5OA 1HYJA 2OXQC 1JM7B 5DKAA 3QZVA 3FM8C 3M63A 3FANA 3LJUX 4P5OB 2KYUA 2DX8A 4B86C 2XOYA 3FEHA 4BBQA 2KWJA 5LKZA 3VK6A 2MNZA 4FJCA 2I50A 2MKEA 2VP7A 2XOZA 5JG6A 2ECNA 3KV6A 2H0DA 3SUBA 4FK5A 3PHDA 5B8DA 2CSZA 3ZPV1 3O70A 2LXHC 4F1PA 5B76A 2KU3A 2KIZA 4ZDTA 5TBNA 5H1TA 5B78A 2Y1NA 1WEUA 4LJNA 5LKUA 3FL2A 2FUUA 2L75A 3C5KA 2MUMA 1K2FA 3HCTA 3N9LA 2KKYA 4LKAA 2VNFA 2YHOA 3EB6A 2PNXA 5B79A 1N87A 3LQHA 3EB5A 3RTRB 2CONA 5B77A 4WZ0A 5SVYA 3MDBC 2KGGA 5H1VA 3GV4A 1Z60A 5K3QA 2L80A 4V3KC 1MM2A 2AN6A 1WEWA 3O7AA 2YT5A 3H7HA 4I7DA 4R8PK 4I7CA 2ECGA 3O33A 2ECWA 2RI7A 4PPEA 2LGGA 1ZBDB 4L7XA 3HCUA 2FUIA 1WEMA 4YATA 5D1LB 4OGCA 1WFKA 3FJUB 2E6SA 1WEOA 5TDRA 2KWOA 2VJFA 1VFYA 4I7BA 1FBVA 3JUEA 1E4UA 5I3LA 1HYIA 2DSMA 2CSYA 5TRBA 3HCSA 4GNFA 1VD4A 1JM7A 4Q6FA 1WESA 2RR4A 2XEUA 5G0FA 4YAXA 4A0CD 3HTKC 4YC9A 2MD7B 2YREA 3MHHA 2M13A 4ZQLA 3L11A 2F42A 2K16A 4UP5A 5FEYA 3RPGB 1WEPA 2ECTA 5KH9A 5C13A 1WIMA 4IC2A 2M85A 4ZUXU 2PUYA 2EGPA 2YVRA 2YUCA 5G04B 2BAYA 4L58A 4CA1A 4WZ3B 2OWAA 3IHPA 3V43A 1WILA 1MBMA 3DWDA 4BHWA 3T7LA 2IQJA 5FB1A 4WZ2A 2M6MA 4YBMA 1Z6UA 3KV5A 1U6GB 2D8SA 4Z0OA 2E6RA 4AUQB 3LRQA 2YQLA 2FSAA 5TDWA 5LKTA 1FP0A 4V3LC 4NN2A 2MIQA 2JMJA 3L1XA 2VPBA 3T9KA 3O36A 3ZYQA 3RPGC 1CHCA 2YURA 4UI9B 1X4JA 4LK9A 4GNGA 2QICA 3ZVZB 5SVIB 3SOWA 3LQIA 2C2VS 3LQJA 2LXPC 3E2DA 1WENA 3ZNIA 5H9MA 2LV9A 2M3HA 1F62A 3N9OA 4YBSA 2XP0A 4O62A 2QIZA 4AYCB 2LDRA 4H9DA 5D1KB 4YABA 4C9ZA 2KE1A 4AP4A 4YADA 2YQMA 5FERA 4Z0RA 2MD8C 2LRIC 2YSJA 4MVTA 2MA6A 2G43A 4GNDA 3M62A 2QJ0A 2YYRA 2K1JA 4YBTA 5FB0A 2ECVA 4PTBA 4WA6A 2Y1MA 3KQIA 2VPGA 1X4UA 2FFWA 3U5PA 2RSDA 4QF2A 2CSVA 2KKXA 4S3OB 3N9NA 5B75A 2L43A 2EGMA 1WGMA 2ECJA 4A49A 1XWHA 2UZGA 2ECIA 2L7PA 5EYAF 2D8UA 3KDEC 3LVQE 4GNEA 5KH7A 2CKLB 1WEVA 4R2YA 4CCGX 2ZETC 3KNVA 2L0BA 1RMDA 3PUQA 2VJEB 3U5MA 3M7KA 4QF3A 2F6JA 3ZPVE 2KGIA 2CRWA 1Z2QA 2E61A 1X4IA 1LDJB 2L5UA 2EXUA 5SVXA 2JMDA 3M99A 4N3WA 2JUNA 2YHNA 4O64A 3LVRE 5J3XA 4S3OC 3GL6A 2NAAA 3DQVR 2K17A 1BORA 3C6WA 4MSXA 4A4BA 2C2LA 5AITA 2CRRA 3ZVYA 1V87A 5LKXA 5SVIA 2DJAA 4GB0A 3ZTGA 2LN0A 2EODA 3DDTA 5C11A 3FAOA 5D1MB
chains in the Genus database with same CATH topology
3T6RA 2VPEA 1G25A 1WEEA 3DPLR 4LADB 1WE9A 3SHBA 4AYCA 2EA6A 2Y43A 2LGLA 3L1ZB 3NG2A 1MM3A 4UP0A 2H0DB 5TABA 3N9PA 3MHSA 4AVXA 2KWKA 4X3GA 2YW8A 4N4FA 4R7EA 2YU4A 4F52B 2MA5A 2MNYA 2IDAA 2LQ6A 1T1HA 2KREA 2KR4A 3PURA 2HYED 2YSMA 2G45A 3O35A 5G05B 1IYMA 1VYXA 5KH3A 3O34A 2K4DA 3O37A 5LCWB 2M1RA 2G6QA 4FO9A 2LGVA 2CKLA 4LLBA 2VPDA 3I2DA 1JOCA 2HDPA 4IC3A 1DVPA 2KWNA 2VJEA 3N9MA 2CT2A 4TKPB 4B7YC 4XI1A 4FIPA 1WEQA 2JMIA 3N9QA 5H1UA 1LDKC 3ASLA 5DINA 2JRJA 2MT5A 3U5NA 2VJFB 4A4CA 2KFTA 5AIUA 4W4UA 2LGKA 3SOXA 3SOUA 2F6NA 2XB1A 3U5OA 1HYJA 2OXQC 1JM7B 5DKAA 3QZVA 3M63A 4P5OB 2KYUA 2DX8A 4B86C 4BBQA 2KWJA 5LKZA 3VK6A 2MNZA 4FJCA 2I50A 2VP7A 5JG6A 2ECNA 3KV6A 2H0DA 4FK5A 3PHDA 5B8DA 2CSZA 3ZPV1 3O70A 2LXHC 5B76A 2KU3A 2KIZA 4ZDTA 5TBNA 5H1TA 5B78A 2Y1NA 1WEUA 4LJNA 5LKUA 3FL2A 2FUUA 2L75A 3C5KA 2MUMA 1K2FA 3HCTA 3N9LA 4LKAA 2VNFA 2YHOA 3EB6A 2PNXA 5B79A 1N87A 3LQHA 3EB5A 3RTRB 5B77A 4WZ0A 2KGGA 5H1VA 3GV4A 1Z60A 2L80A 4V3KC 1MM2A 2AN6A 1WEWA 3O7AA 2YT5A 4I7DA 4R8PK 4I7CA 2ECGA 3O33A 2ECWA 2RI7A 4PPEA 2LGGA 1ZBDB 4L7XA 3HCUA 2FUIA 1WEMA 4YATA 5D1LB 1WFKA 2E6SA 1WEOA 5TDRA 2KWOA 2VJFA 1VFYA 4I7BA 1FBVA 1E4UA 5I3LA 1HYIA 2CSYA 5TRBA 3HCSA 4GNFA 1VD4A 1JM7A 4Q6FA 1WESA 2XEUA 5G0FA 4YAXA 4A0CD 3HTKC 4YC9A 2MD7B 2YREA 3MHHA 4ZQLA 3L11A 2F42A 2K16A 4UP5A 5FEYA 3RPGB 1WEPA 2ECTA 5KH9A 5C13A 1WIMA 4IC2A 2M85A 4ZUXU 2PUYA 2EGPA 2YUCA 5G04B 2BAYA 4L58A 4CA1A 4WZ3B 3IHPA 3V43A 1WILA 4BHWA 3T7LA 5FB1A 4WZ2A 2M6MA 4YBMA 1Z6UA 3KV5A 1U6GB 2D8SA 2E6RA 4AUQB 3LRQA 2YQLA 2FSAA 5TDWA 5LKTA 1FP0A 4V3LC 4NN2A 2MIQA 2JMJA 3L1XA 2VPBA 3O36A 3ZYQA 3RPGC 1CHCA 2YURA 4UI9B 1X4JA 4LK9A 4GNGA 2QICA 3ZVZB 3SOWA 3LQIA 2C2VS 3LQJA 2LXPC 1WENA 3ZNIA 5H9MA 2LV9A 2M3HA 1F62A 3N9OA 4YBSA 2QIZA 4AYCB 2LDRA 5D1KB 4YABA 4C9ZA 2KE1A 4AP4A 4YADA 2YQMA 5FERA 2MD8C 2LRIC 2YSJA 4MVTA 2MA6A 2G43A 4GNDA 3M62A 2QJ0A 2YYRA 2K1JA 4YBTA 5FB0A 2ECVA 4PTBA 4WA6A 2Y1MA 3KQIA 2VPGA 1X4UA 3U5PA 2RSDA 4QF2A 4S3OB 3N9NA 5B75A 2L43A 1WGMA 2ECJA 4A49A 1XWHA 2UZGA 2ECIA 5EYAF 4GNEA 5KH7A 2CKLB 1WEVA 4R2YA 4CCGX 2ZETC 3KNVA 2L0BA 1RMDA 3PUQA 2VJEB 3U5MA 4QF3A 2F6JA 3ZPVE 2KGIA 1Z2QA 1X4IA 1LDJB 2L5UA 2JMDA 3M99A 4N3WA 2YHNA 4O64A 5J3XA 4S3OC 3GL6A 2NAAA 3DQVR 2K17A 1BORA 3C6WA 4MSXA 4A4BA 2C2LA 5AITA 3ZVYA 1V87A 5LKXA 4GB0A 3ZTGA 2LN0A 2EODA 5C11A 5D1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6R A;  2VPE A;  1G25 A;  1WEE A;  3DPL R;  4LAD B;  1WE9 A;  3SHB A;  4AYC A;  2EA6 A;  2Y43 A;  2LGL A;  3L1Z B;  3NG2 A;  1MM3 A;  4UP0 A;  2H0D B;  5TAB A;  3N9P A;  3MHS A;  4AVX A;  2KWK A;  4X3G A;  2YW8 A;  4N4F A;  4R7E A;  2YU4 A;  4F52 B;  2MA5 A;  2MNY A;  2IDA A;  2LQ6 A;  1T1H A;  2KRE A;  2KR4 A;  3PUR A;  2HYE D;  2YSM A;  2G45 A;  3O35 A;  5G05 B;  1IYM A;  1VYX A;  5KH3 A;  3O34 A;  2K4D A;  3O37 A;  5LCW B;  2M1R A;  2G6Q A;  4FO9 A;  2LGV A;  2CKL A;  4LLB A;  2VPD A;  3I2D A;  1JOC A;  2HDP A;  4IC3 A;  1DVP A;  2KWN A;  2VJE A;  3N9M A;  2CT2 A;  4TKP B;  4B7Y C;  4XI1 A;  4FIP A;  1WEQ A;  2JMI A;  3N9Q A;  5H1U A;  1LDK C;  3ASL A;  5DIN A;  2JRJ A;  2MT5 A;  3U5N A;  2VJF B;  4A4C A;  2KFT A;  5AIU A;  4W4U A;  2LGK A;  3SOX A;  3SOU A;  2F6N A;  2XB1 A;  3U5O A;  1HYJ A;  2OXQ C;  1JM7 B;  5DKA A;  3QZV A;  3M63 A;  4P5O B;  2KYU A;  2DX8 A;  4B86 C;  4BBQ A;  2KWJ A;  5LKZ A;  3VK6 A;  2MNZ A;  4FJC A;  2I50 A;  2VP7 A;  5JG6 A;  2ECN A;  3KV6 A;  2H0D A;  4FK5 A;  3PHD A;  5B8D A;  2CSZ A;  3ZPV 1;  3O70 A;  2LXH C;  5B76 A;  2KU3 A;  2KIZ A;  4ZDT A;  5TBN A;  5H1T A;  5B78 A;  2Y1N A;  1WEU A;  4LJN A;  5LKU A;  3FL2 A;  2FUU A;  2L75 A;  3C5K A;  2MUM A;  1K2F A;  3HCT A;  3N9L A;  4LKA A;  2VNF A;  2YHO A;  3EB6 A;  2PNX A;  5B79 A;  1N87 A;  3LQH A;  3EB5 A;  3RTR B;  5B77 A;  4WZ0 A;  2KGG A;  5H1V A;  3GV4 A;  1Z60 A;  2L80 A;  4V3K C;  1MM2 A;  2AN6 A;  1WEW A;  3O7A A;  2YT5 A;  4I7D A;  4R8P K;  4I7C A;  2ECG A;  3O33 A;  2ECW A;  2RI7 A;  4PPE A;  2LGG A;  1ZBD B;  4L7X A;  3HCU A;  2FUI A;  1WEM A;  4YAT A;  5D1L B;  1WFK A;  2E6S A;  1WEO A;  5TDR A;  2KWO A;  2VJF A;  1VFY A;  4I7B A;  1FBV A;  1E4U A;  5I3L A;  1HYI A;  2CSY A;  5TRB A;  3HCS A;  4GNF A;  1VD4 A;  1JM7 A;  4Q6F A;  1WES A;  2XEU A;  5G0F A;  4YAX A;  4A0C D;  3HTK C;  4YC9 A;  2MD7 B;  2YRE A;  3MHH A;  4ZQL A;  3L11 A;  2F42 A;  2K16 A;  4UP5 A;  5FEY A;  3RPG B;  1WEP A;  2ECT A;  5KH9 A;  5C13 A;  1WIM A;  4IC2 A;  2M85 A;  4ZUX U;  2PUY A;  2EGP A;  2YUC A;  5G04 B;  2BAY A;  4L58 A;  4CA1 A;  4WZ3 B;  3IHP A;  3V43 A;  1WIL A;  4BHW A;  3T7L A;  5FB1 A;  4WZ2 A;  2M6M A;  4YBM A;  1Z6U A;  3KV5 A;  1U6G B;  2D8S A;  2E6R A;  4AUQ B;  3LRQ A;  2YQL A;  2FSA A;  5TDW A;  5LKT A;  1FP0 A;  4V3L C;  4NN2 A;  2MIQ A;  2JMJ A;  3L1X A;  2VPB A;  3O36 A;  3ZYQ A;  3RPG C;  1CHC A;  2YUR A;  4UI9 B;  1X4J A;  4LK9 A;  4GNG A;  2QIC A;  3ZVZ B;  3SOW A;  3LQI A;  2C2V S;  3LQJ A;  2LXP C;  1WEN A;  3ZNI A;  5H9M A;  2LV9 A;  2M3H A;  1F62 A;  3N9O A;  4YBS A;  2QIZ A;  4AYC B;  2LDR A;  5D1K B;  4YAB A;  4C9Z A;  2KE1 A;  4AP4 A;  4YAD A;  2YQM A;  5FER A;  2MD8 C;  2LRI C;  2YSJ A;  4MVT A;  2MA6 A;  2G43 A;  4GND A;  3M62 A;  2QJ0 A;  2YYR A;  2K1J A;  4YBT A;  5FB0 A;  2ECV A;  4PTB A;  4WA6 A;  2Y1M A;  3KQI A;  2VPG A;  1X4U A;  3U5P A;  2RSD A;  4QF2 A;  4S3O B;  3N9N A;  5B75 A;  2L43 A;  1WGM A;  2ECJ A;  4A49 A;  1XWH A;  2UZG A;  2ECI A;  5EYA F;  4GNE A;  5KH7 A;  2CKL B;  1WEV A;  4R2Y A;  4CCG X;  2ZET C;  3KNV A;  2L0B A;  1RMD A;  3PUQ A;  2VJE B;  3U5M A;  4QF3 A;  2F6J A;  3ZPV E;  2KGI A;  1Z2Q A;  1X4I A;  1LDJ B;  2L5U A;  2JMD A;  3M99 A;  4N3W A;  2YHN A;  4O64 A;  5J3X A;  4S3O C;  3GL6 A;  2NAA A;  3DQV R;  2K17 A;  1BOR A;  3C6W A;  4MSX A;  4A4B A;  2C2L A;  5AIT A;  3ZVY A;  1V87 A;  5LKX A;  4GB0 A;  3ZTG A;  2LN0 A;  2EOD A;  5C11 A;  5D1M B; 
#chains in the Genus database with same CATH topology
 3T6R A;  2VPE A;  1G25 A;  1WEE A;  3DPL R;  4LAD B;  1WE9 A;  3SHB A;  4OGE A;  2XOC A;  4AYC A;  2EA6 A;  2Y43 A;  2LGL A;  3L1Z B;  3NG2 A;  1MM3 A;  4UP0 A;  2H0D B;  5TAB A;  3O47 A;  3N9P A;  3MHS A;  4AVX A;  2KWK A;  4X3G A;  2YW8 A;  2JM3 A;  4N4F A;  4R7E A;  2YU4 A;  4F52 B;  2MA5 A;  2MNY A;  2IDA A;  3Q1D A;  3PLW A;  2LQ6 A;  1T1H A;  2KRE A;  2KR4 A;  3PUR A;  2HYE D;  2YSM A;  2G45 A;  3O35 A;  5G05 B;  1IYM A;  1VYX A;  5KH3 A;  3O34 A;  2K4D A;  3O37 A;  5LCW B;  2M1R A;  4QQ4 A;  2G6Q A;  2B0O E;  2FD4 A;  4FO9 A;  2LGV A;  2CKL A;  2P57 A;  4LLB A;  2VPD A;  3I2D A;  1JOC A;  2HDP A;  4IC3 A;  1DVP A;  2KWN A;  2VJE A;  3N9M A;  2CT2 A;  4TKP B;  4B7Y C;  4XI1 A;  4FIP A;  1WEQ A;  2JMI A;  3N9Q A;  5H1U A;  1LDK C;  3ASL A;  5DIN A;  2JRJ A;  2MT5 A;  3U5N A;  2LAU A;  2VJF B;  4A4C A;  2KFT A;  5AIU A;  4W4U A;  2LGK A;  3SOX A;  1DCQ A;  3SOU A;  3LDY A;  2F6N A;  2XB1 A;  3U5O A;  1HYJ A;  2OXQ C;  1JM7 B;  5DKA A;  3QZV A;  3FM8 C;  3M63 A;  3FAN A;  3LJU X;  4P5O B;  2KYU A;  2DX8 A;  4B86 C;  2XOY A;  3FEH A;  4BBQ A;  2KWJ A;  5LKZ A;  3VK6 A;  2MNZ A;  4FJC A;  2I50 A;  2MKE A;  2VP7 A;  2XOZ A;  5JG6 A;  2ECN A;  3KV6 A;  2H0D A;  3SUB A;  4FK5 A;  3PHD A;  5B8D A;  2CSZ A;  3ZPV 1;  3O70 A;  2LXH C;  4F1P A;  5B76 A;  2KU3 A;  2KIZ A;  4ZDT A;  5TBN A;  5H1T A;  5B78 A;  2Y1N A;  1WEU A;  4LJN A;  5LKU A;  3FL2 A;  2FUU A;  2L75 A;  3C5K A;  2MUM A;  1K2F A;  3HCT A;  3N9L A;  2KKY A;  4LKA A;  2VNF A;  2YHO A;  3EB6 A;  2PNX A;  5B79 A;  1N87 A;  3LQH A;  3EB5 A;  3RTR B;  2CON A;  5B77 A;  4WZ0 A;  5SVY A;  3MDB C;  2KGG A;  5H1V A;  3GV4 A;  1Z60 A;  5K3Q A;  2L80 A;  4V3K C;  1MM2 A;  2AN6 A;  1WEW A;  3O7A A;  2YT5 A;  3H7H A;  4I7D A;  4R8P K;  4I7C A;  2ECG A;  3O33 A;  2ECW A;  2RI7 A;  4PPE A;  2LGG A;  1ZBD B;  4L7X A;  3HCU A;  2FUI A;  1WEM A;  4YAT A;  5D1L B;  4OGC A;  1WFK A;  3FJU B;  2E6S A;  1WEO A;  5TDR A;  2KWO A;  2VJF A;  1VFY A;  4I7B A;  1FBV A;  3JUE A;  1E4U A;  5I3L A;  1HYI A;  2DSM A;  2CSY A;  5TRB A;  3HCS A;  4GNF A;  1VD4 A;  1JM7 A;  4Q6F A;  1WES A;  2RR4 A;  2XEU A;  5G0F A;  4YAX A;  4A0C D;  3HTK C;  4YC9 A;  2MD7 B;  2YRE A;  3MHH A;  2M13 A;  4ZQL A;  3L11 A;  2F42 A;  2K16 A;  4UP5 A;  5FEY A;  3RPG B;  1WEP A;  2ECT A;  5KH9 A;  5C13 A;  1WIM A;  4IC2 A;  2M85 A;  4ZUX U;  2PUY A;  2EGP A;  2YVR A;  2YUC A;  5G04 B;  2BAY A;  4L58 A;  4CA1 A;  4WZ3 B;  2OWA A;  3IHP A;  3V43 A;  1WIL A;  1MBM A;  3DWD A;  4BHW A;  3T7L A;  2IQJ A;  5FB1 A;  4WZ2 A;  2M6M A;  4YBM A;  1Z6U A;  3KV5 A;  1U6G B;  2D8S A;  4Z0O A;  2E6R A;  4AUQ B;  3LRQ A;  2YQL A;  2FSA A;  5TDW A;  5LKT A;  1FP0 A;  4V3L C;  4NN2 A;  2MIQ A;  2JMJ A;  3L1X A;  2VPB A;  3T9K A;  3O36 A;  3ZYQ A;  3RPG C;  1CHC A;  2YUR A;  4UI9 B;  1X4J A;  4LK9 A;  4GNG A;  2QIC A;  3ZVZ B;  5SVI B;  3SOW A;  3LQI A;  2C2V S;  3LQJ A;  2LXP C;  3E2D A;  1WEN A;  3ZNI A;  5H9M A;  2LV9 A;  2M3H A;  1F62 A;  3N9O A;  4YBS A;  2XP0 A;  4O62 A;  2QIZ A;  4AYC B;  2LDR A;  4H9D A;  5D1K B;  4YAB A;  4C9Z A;  2KE1 A;  4AP4 A;  4YAD A;  2YQM A;  5FER A;  4Z0R A;  2MD8 C;  2LRI C;  2YSJ A;  4MVT A;  2MA6 A;  2G43 A;  4GND A;  3M62 A;  2QJ0 A;  2YYR A;  2K1J A;  4YBT A;  5FB0 A;  2ECV A;  4PTB A;  4WA6 A;  2Y1M A;  3KQI A;  2VPG A;  1X4U A;  2FFW A;  3U5P A;  2RSD A;  4QF2 A;  2CSV A;  2KKX A;  4S3O B;  3N9N A;  5B75 A;  2L43 A;  2EGM A;  1WGM A;  2ECJ A;  4A49 A;  1XWH A;  2UZG A;  2ECI A;  2L7P A;  5EYA F;  2D8U A;  3KDE C;  3LVQ E;  4GNE A;  5KH7 A;  2CKL B;  1WEV A;  4R2Y A;  4CCG X;  2ZET C;  3KNV A;  2L0B A;  1RMD A;  3PUQ A;  2VJE B;  3U5M A;  3M7K A;  4QF3 A;  2F6J A;  3ZPV E;  2KGI A;  2CRW A;  1Z2Q A;  2E61 A;  1X4I A;  1LDJ B;  2L5U A;  2EXU A;  5SVX A;  2JMD A;  3M99 A;  4N3W A;  2JUN A;  2YHN A;  4O64 A;  3LVR E;  5J3X A;  4S3O C;  3GL6 A;  2NAA A;  3DQV R;  2K17 A;  1BOR A;  3C6W A;  4MSX A;  4A4B A;  2C2L A;  5AIT A;  2CRR A;  3ZVY A;  1V87 A;  5LKX A;  5SVI A;  2DJA A;  4GB0 A;  3ZTG A;  2LN0 A;  2EOD A;  3DDT A;  5C11 A;  3FAO A;  5D1M B; 
#chains in the Genus database with same CATH homology
 3T6R A;  2VPE A;  1G25 A;  1WEE A;  3DPL R;  4LAD B;  1WE9 A;  3SHB A;  4AYC A;  2EA6 A;  2Y43 A;  2LGL A;  3L1Z B;  3NG2 A;  1MM3 A;  4UP0 A;  2H0D B;  5TAB A;  3N9P A;  3MHS A;  4AVX A;  2KWK A;  4X3G A;  2YW8 A;  4N4F A;  4R7E A;  2YU4 A;  4F52 B;  2MA5 A;  2MNY A;  2IDA A;  2LQ6 A;  1T1H A;  2KRE A;  2KR4 A;  3PUR A;  2HYE D;  2YSM A;  2G45 A;  3O35 A;  5G05 B;  1IYM A;  1VYX A;  5KH3 A;  3O34 A;  2K4D A;  3O37 A;  5LCW B;  2M1R A;  2G6Q A;  4FO9 A;  2LGV A;  2CKL A;  4LLB A;  2VPD A;  3I2D A;  1JOC A;  2HDP A;  4IC3 A;  1DVP A;  2KWN A;  2VJE A;  3N9M A;  2CT2 A;  4TKP B;  4B7Y C;  4XI1 A;  4FIP A;  1WEQ A;  2JMI A;  3N9Q A;  5H1U A;  1LDK C;  3ASL A;  5DIN A;  2JRJ A;  2MT5 A;  3U5N A;  2VJF B;  4A4C A;  2KFT A;  5AIU A;  4W4U A;  2LGK A;  3SOX A;  3SOU A;  2F6N A;  2XB1 A;  3U5O A;  1HYJ A;  2OXQ C;  1JM7 B;  5DKA A;  3QZV A;  3M63 A;  4P5O B;  2KYU A;  2DX8 A;  4B86 C;  4BBQ A;  2KWJ A;  5LKZ A;  3VK6 A;  2MNZ A;  4FJC A;  2I50 A;  2VP7 A;  5JG6 A;  2ECN A;  3KV6 A;  2H0D A;  4FK5 A;  3PHD A;  5B8D A;  2CSZ A;  3ZPV 1;  3O70 A;  2LXH C;  5B76 A;  2KU3 A;  2KIZ A;  4ZDT A;  5TBN A;  5H1T A;  5B78 A;  2Y1N A;  1WEU A;  4LJN A;  5LKU A;  3FL2 A;  2FUU A;  2L75 A;  3C5K A;  2MUM A;  1K2F A;  3HCT A;  3N9L A;  4LKA A;  2VNF A;  2YHO A;  3EB6 A;  2PNX A;  5B79 A;  1N87 A;  3LQH A;  3EB5 A;  3RTR B;  5B77 A;  4WZ0 A;  2KGG A;  5H1V A;  3GV4 A;  1Z60 A;  2L80 A;  4V3K C;  1MM2 A;  2AN6 A;  1WEW A;  3O7A A;  2YT5 A;  4I7D A;  4R8P K;  4I7C A;  2ECG A;  3O33 A;  2ECW A;  2RI7 A;  4PPE A;  2LGG A;  1ZBD B;  4L7X A;  3HCU A;  2FUI A;  1WEM A;  4YAT A;  5D1L B;  1WFK A;  2E6S A;  1WEO A;  5TDR A;  2KWO A;  2VJF A;  1VFY A;  4I7B A;  1FBV A;  1E4U A;  5I3L A;  1HYI A;  2CSY A;  5TRB A;  3HCS A;  4GNF A;  1VD4 A;  1JM7 A;  4Q6F A;  1WES A;  2XEU A;  5G0F A;  4YAX A;  4A0C D;  3HTK C;  4YC9 A;  2MD7 B;  2YRE A;  3MHH A;  4ZQL A;  3L11 A;  2F42 A;  2K16 A;  4UP5 A;  5FEY A;  3RPG B;  1WEP A;  2ECT A;  5KH9 A;  5C13 A;  1WIM A;  4IC2 A;  2M85 A;  4ZUX U;  2PUY A;  2EGP A;  2YUC A;  5G04 B;  2BAY A;  4L58 A;  4CA1 A;  4WZ3 B;  3IHP A;  3V43 A;  1WIL A;  4BHW A;  3T7L A;  5FB1 A;  4WZ2 A;  2M6M A;  4YBM A;  1Z6U A;  3KV5 A;  1U6G B;  2D8S A;  2E6R A;  4AUQ B;  3LRQ A;  2YQL A;  2FSA A;  5TDW A;  5LKT A;  1FP0 A;  4V3L C;  4NN2 A;  2MIQ A;  2JMJ A;  3L1X A;  2VPB A;  3O36 A;  3ZYQ A;  3RPG C;  1CHC A;  2YUR A;  4UI9 B;  1X4J A;  4LK9 A;  4GNG A;  2QIC A;  3ZVZ B;  3SOW A;  3LQI A;  2C2V S;  3LQJ A;  2LXP C;  1WEN A;  3ZNI A;  5H9M A;  2LV9 A;  2M3H A;  1F62 A;  3N9O A;  4YBS A;  2QIZ A;  4AYC B;  2LDR A;  5D1K B;  4YAB A;  4C9Z A;  2KE1 A;  4AP4 A;  4YAD A;  2YQM A;  5FER A;  2MD8 C;  2LRI C;  2YSJ A;  4MVT A;  2MA6 A;  2G43 A;  4GND A;  3M62 A;  2QJ0 A;  2YYR A;  2K1J A;  4YBT A;  5FB0 A;  2ECV A;  4PTB A;  4WA6 A;  2Y1M A;  3KQI A;  2VPG A;  1X4U A;  3U5P A;  2RSD A;  4QF2 A;  4S3O B;  3N9N A;  5B75 A;  2L43 A;  1WGM A;  2ECJ A;  4A49 A;  1XWH A;  2UZG A;  2ECI A;  5EYA F;  4GNE A;  5KH7 A;  2CKL B;  1WEV A;  4R2Y A;  4CCG X;  2ZET C;  3KNV A;  2L0B A;  1RMD A;  3PUQ A;  2VJE B;  3U5M A;  4QF3 A;  2F6J A;  3ZPV E;  2KGI A;  1Z2Q A;  1X4I A;  1LDJ B;  2L5U A;  2JMD A;  3M99 A;  4N3W A;  2YHN A;  4O64 A;  5J3X A;  4S3O C;  3GL6 A;  2NAA A;  3DQV R;  2K17 A;  1BOR A;  3C6W A;  4MSX A;  4A4B A;  2C2L A;  5AIT A;  3ZVY A;  1V87 A;  5LKX A;  4GB0 A;  3ZTG A;  2LN0 A;  2EOD A;  5C11 A;  5D1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...