4AUQB

Structure of birc7-ubch5b-ub complex.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'QLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Birc7-E2 Ubiquitin Conjugate Structure Reveals the Mechanism of Ubiquitin Transfer by a Ring Dimer.
pubmed doi rcsb
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 D2
source organism Homo sapiens
molecule tags Ligase/ligase/signalling protein
total genus 11
structure length 57
sequence length 57
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4auqB00
2YSJA 4B86C 5KH3A 3IHPA 1WFKA 3O7AA 2VPBA 5D1MB 4A4BA 3O34A 1MM3A 2ZETC 3L1XA 2I50A 3KNVA 5H1UA 5KH9A 2DX8A 2VJFB 4A4CA 2ECGA 3QZVA 2RI7A 3SOWA 1T1HA 5B8DA 3HCUA 2VJFA 2VJEB 2MNYA 3KV5A 3N9QA 3L11A 1WIMA 3U5OA 4YC9A 5B75A 4MSXA 3RPGC 1X4UA 4UP5A 2L80A 2LGLA 2MD8C 3O37A 2H0DA 4PTBA 4AVXA 2MNZA 3LQIA 4YBSA 1LDKC 1X4JA 3HCSA 3T7LA 4V3KC 1N87A 3MHHA 4A49A 3N9NA 4AYCB 3ZVZB 1BORA 5TDRA 1X4IA 5B77A 1DVPA 5FEYA 2FUIA 4I7DA 4B7YC 2EODA 2EGPA 5AIUA 4I7BA 2MA5A 4NN2A 2YQMA 4CCGX 3EB6A 3LQJA 2K4DA 4QF3A 4LADB 2QIZA 2L43A 2Y43A 5TBNA 1FBVA 2JMIA 1U6GB 2KWKA 2ECJA 2MA6A 2ECTA 2IDAA 3I2DA 4LLBA 2E6SA 2LQ6A 2C2VS 1JOCA 2M85A 4IC3A 2M1RA 4XI1A 4S3OB 3KQIA 4P5OB 2JMJA 4FK5A 1WEUA 2KREA 1WEVA 3FL2A 1WEEA 2CT2A 2AN6A 5I3LA 3PUQA 4L58A 4O64A 2XB1A 1G25A 5C13A 3MHSA 3ZVYA 4A0CD 1VYXA 4YABA 5TDWA 3DPLR 4QF2A 3PHDA 4ZDTA 2YW8A 3C5KA 3NG2A 2E6RA 2PUYA 4MVTA 3ASLA 2VJEA 2UZGA 2YU4A 2VPGA 5LKXA 3HCTA 4X3GA 1V87A 5J3XA 4GNEA 5FB0A 1MM2A 5D1LB 4FIPA 4Q6FA 3SHBA 4WZ3B 2LN0A 2M6MA 5LKTA 1E4UA 2K16A 3L1ZB 2YURA 2G6QA 1WESA 5TRBA 4TKPB 2YT5A 4AYCA 2KWJA 4YAXA 3RTRB 5LKZA 2NAAA 4UP0A 4GB0A 1CHCA 2LXHC 2G45A 3SOUA 1WEOA 2VPEA 5B79A 3M63A 1HYJA 2LXPC 1XWHA 2MUMA 3DQVR 4UI9B 4S3OC 4WZ2A 2L5UA 2Y1NA 3V43A 2HYED 3O70A 4F52B 1RMDA 4IC2A 2KR4A 4YBTA 4ZUXU 2MT5A 5EYAF 1WGMA 4GNGA 2KYUA 5G0FA 2CSZA 1Z60A 3T6RA 5G04B 3N9LA 3M99A 2VPDA 1JM7B 2CKLB 3HTKC 4GNFA 4I7CA 2YHOA 4PPEA 2YHNA 4AP4A 3ZPVE 1JM7A 2CKLA 3ZNIA 2FSAA 2YREA 2ECNA 1WEWA 3PURA 5G05B 2F6NA 4BBQA 1WEPA 3N9MA 4N4FA 1FP0A 3ZYQA 3O36A 5FB1A 5KH7A 2QICA 5C11A 4N3WA 5B76A 2LGGA 2VNFA 3O35A 2KGIA 2MIQA 1HYIA 2JRJA 3GV4A 4FO9A 2ECIA 2G43A 4R8PK 1WILA 4CA1A 5FERA 2LGVA 3ZPV1 2KIZA 2VP7A 5AITA 3LQHA 2EA6A 3O33A 3M62A 4YATA 2KE1A 2LGKA 1VFYA 5D1KB 4R7EA 3VK6A 2QJ0A 2KWOA 2LV9A 2L75A 2Y1MA 5B78A 4ZQLA 2BAYA 1Z6UA 1VD4A 1WEMA 5H1TA 4LJNA 4FJCA 3U5MA 1K2FA 2H0DB 3GL6A 2F42A 2FUUA 5LCWB 5TABA 2HDPA 4WZ0A 1ZBDB 2LRIC 4YBMA 5H1VA 5H9MA 2KGGA 5DKAA 1IYMA 3KV6A 2KU3A 2XEUA 1WENA 2CSYA 2RSDA 2K17A 2YQLA 3N9PA 3SOXA 2LDRA 4GNDA 3U5NA 1Z2QA 3C6WA 4L7XA 4LK9A 2YSMA 2K1JA 2F6JA 3RPGB 2ECWA 2C2LA 4AUQB 3LRQA 2PNXA 5DINA 4R2YA 3EB5A 1WE9A 1LDJB 2OXQC 2M3HA 4LKAA 2L0BA 5JG6A 4BHWA 2MD7B 2KWNA 4V3LC 2YUCA 2D8SA 2ECVA 2KFTA 1WEQA 4W4UA 1F62A 3U5PA 4WA6A 2JMDA 4C9ZA 2YYRA 5LKUA 4YADA 3ZTGA 3N9OA
chains in the Genus database with same CATH superfamily
2YSJA 4B86C 5KH3A 2IQJA 2XOZA 3LDYA 3IHPA 1WFKA 3O7AA 2VPBA 5D1MB 3DWDA 4A4BA 3O34A 1MM3A 2ZETC 3L1XA 2I50A 3KNVA 2YVRA 5H1UA 5KH9A 2DX8A 2VJFB 4A4CA 2ECGA 3QZVA 3Q1DA 2RI7A 3SOWA 1T1HA 5B8DA 3HCUA 3T9KA 2D8UA 2VJFA 2MNYA 2VJEB 1MBMA 3KV5A 3N9QA 3L11A 1WIMA 3U5OA 4YC9A 5B75A 4MSXA 3RPGC 3PLWA 1X4UA 4Z0RA 2L80A 2LGLA 4UP5A 2MD8C 3O37A 2H0DA 4PTBA 4AVXA 2MNZA 3LQIA 4YBSA 1LDKC 1X4JA 3HCSA 3T7LA 4V3KC 1N87A 3MHHA 4A49A 3N9NA 4AYCB 1DCQA 3ZVZB 1BORA 2EGMA 5TDRA 1X4IA 5B77A 3SUBA 1DVPA 5FEYA 2FUIA 4I7DA 4O62A 4B7YC 2EODA 2EGPA 4Z0OA 5AIUA 4I7BA 3O47A 2MA5A 4NN2A 2YQMA 4CCGX 3EB6A 3LQJA 2K4DA 4QF3A 4LADB 2QIZA 3LVRE 2L43A 2Y43A 5TBNA 1FBVA 2JMIA 4OGCA 1U6GB 2KWKA 2ECJA 2MA6A 2ECTA 2IDAA 3I2DA 4LLBA 3FAOA 5SVIB 2E6SA 2LQ6A 2C2VS 2JM3A 1JOCA 2M85A 4IC3A 2CSVA 2M1RA 4XI1A 4S3OB 3KQIA 4P5OB 2JMJA 4FK5A 1WEUA 2KREA 1WEVA 3FL2A 1WEEA 2CT2A 2AN6A 5I3LA 2RR4A 3PUQA 4L58A 4O64A 2XB1A 2CRRA 1G25A 5C13A 3MHSA 3ZVYA 4A0CD 1VYXA 4YABA 5TDWA 3DPLR 4QF2A 3PHDA 4ZDTA 2YW8A 3C5KA 3NG2A 2E6RA 3LJUX 2PUYA 4MVTA 3ASLA 2VJEA 2UZGA 2YU4A 2VPGA 5LKXA 3HCTA 4X3GA 1V87A 5J3XA 4GNEA 2CRWA 5FB0A 1MM2A 5D1LB 4FIPA 4Q6FA 3SHBA 4WZ3B 2LN0A 2M6MA 5LKTA 1E4UA 2K16A 5SVYA 3L1ZB 2YURA 2G6QA 1WESA 5TRBA 4TKPB 2YT5A 4AYCA 2KWJA 4YAXA 3RTRB 5LKZA 5SVXA 2NAAA 2L7PA 4UP0A 2LAUA 4GB0A 1CHCA 2LXHC 2G45A 3SOUA 3KDEC 1WEOA 2VPEA 5B79A 2XP0A 3M63A 1HYJA 2LXPC 1XWHA 2MUMA 3DQVR 4UI9B 4S3OC 4WZ2A 2L5UA 2Y1NA 3V43A 2HYED 3O70A 4F52B 1RMDA 4IC2A 2KR4A 4YBTA 4ZUXU 2FD4A 2MT5A 5EYAF 1WGMA 4GNGA 2KYUA 5G0FA 2CSZA 1Z60A 2XOCA 3T6RA 5G04B 3N9LA 3M99A 2VPDA 2CONA 1JM7B 5SVIA 2CKLB 3HTKC 4GNFA 4I7CA 2YHOA 4PPEA 2YHNA 4AP4A 3ZPVE 1JM7A 2CKLA 3ZNIA 2FSAA 2KKYA 4F1PA 2YREA 2ECNA 1WEWA 3PURA 5G05B 2F6NA 3FM8C 4BBQA 1WEPA 3N9MA 4N4FA 1FP0A 3ZYQA 3O36A 5FB1A 5KH7A 2QICA 5C11A 4N3WA 3M7KA 3LVQE 5B76A 2LGGA 2VNFA 3O35A 2KGIA 2MIQA 1HYIA 2JRJA 3GV4A 4FO9A 2ECIA 2G43A 2DJAA 4R8PK 1WILA 4CA1A 5FERA 2LGVA 3ZPV1 2KIZA 2VP7A 5AITA 3LQHA 2EA6A 3O33A 3M62A 4YATA 2KE1A 2LGKA 1VFYA 4R7EA 5D1KB 3VK6A 2QJ0A 2KWOA 2LV9A 2L75A 2Y1MA 5B78A 4ZQLA 2BAYA 2DSMA 1Z6UA 1VD4A 1WEMA 5H1TA 4LJNA 4FJCA 3U5MA 1K2FA 2H0DB 3GL6A 2F42A 2FUUA 5LCWB 5TABA 2HDPA 4WZ0A 1ZBDB 3E2DA 2LRIC 4YBMA 5H1VA 5H9MA 5K3QA 2KGGA 5DKAA 1IYMA 3KV6A 2KU3A 3H7HA 2XEUA 1WENA 2MKEA 2CSYA 2RSDA 2K17A 3MDBC 2JUNA 2YQLA 3N9PA 3SOXA 2XOYA 2LDRA 4GNDA 3U5NA 1Z2QA 3C6WA 4OGEA 4L7XA 4LK9A 2M13A 2YSMA 2K1JA 2F6JA 3RPGB 2B0OE 3FANA 2ECWA 2OWAA 2C2LA 3JUEA 4AUQB 3LRQA 2PNXA 5DINA 4QQ4A 4R2YA 3EB5A 2FFWA 1WE9A 3FEHA 1LDJB 2OXQC 2M3HA 4LKAA 2L0BA 5JG6A 4BHWA 2MD7B 2KWNA 4V3LC 2YUCA 2D8SA 2ECVA 2KFTA 1WEQA 2P57A 4W4UA 1F62A 3U5PA 3DDTA 4WA6A 2JMDA 2E61A 4C9ZA 2YYRA 5LKUA 2EXUA 4H9DA 4YADA 3ZTGA 3FJUB 2KKXA 3N9OA
chains in the Genus database with same CATH topology
2YSJA 4B86C 5KH3A 3IHPA 1WFKA 3O7AA 2VPBA 5D1MB 4A4BA 3O34A 1MM3A 2ZETC 3L1XA 2I50A 3KNVA 5H1UA 5KH9A 2DX8A 2VJFB 4A4CA 2ECGA 3QZVA 2RI7A 3SOWA 1T1HA 5B8DA 3HCUA 2VJFA 2VJEB 2MNYA 3KV5A 3N9QA 3L11A 1WIMA 3U5OA 4YC9A 5B75A 4MSXA 3RPGC 1X4UA 4UP5A 2L80A 2LGLA 2MD8C 3O37A 2H0DA 4PTBA 4AVXA 2MNZA 3LQIA 4YBSA 1LDKC 1X4JA 3HCSA 3T7LA 4V3KC 1N87A 3MHHA 4A49A 3N9NA 4AYCB 3ZVZB 1BORA 5TDRA 1X4IA 5B77A 1DVPA 5FEYA 2FUIA 4I7DA 4B7YC 2EODA 2EGPA 5AIUA 4I7BA 2MA5A 4NN2A 2YQMA 4CCGX 3EB6A 3LQJA 2K4DA 4QF3A 4LADB 2QIZA 2L43A 2Y43A 5TBNA 1FBVA 2JMIA 1U6GB 2KWKA 2ECJA 2MA6A 2ECTA 2IDAA 3I2DA 4LLBA 2E6SA 2LQ6A 2C2VS 1JOCA 2M85A 4IC3A 2M1RA 4XI1A 4S3OB 3KQIA 4P5OB 2JMJA 4FK5A 1WEUA 2KREA 1WEVA 3FL2A 1WEEA 2CT2A 2AN6A 5I3LA 3PUQA 4L58A 4O64A 2XB1A 1G25A 5C13A 3MHSA 3ZVYA 4A0CD 1VYXA 4YABA 5TDWA 3DPLR 4QF2A 3PHDA 4ZDTA 2YW8A 3C5KA 3NG2A 2E6RA 2PUYA 4MVTA 3ASLA 2VJEA 2UZGA 2YU4A 2VPGA 5LKXA 3HCTA 4X3GA 1V87A 5J3XA 4GNEA 5FB0A 1MM2A 5D1LB 4FIPA 4Q6FA 3SHBA 4WZ3B 2LN0A 2M6MA 5LKTA 1E4UA 2K16A 3L1ZB 2YURA 2G6QA 1WESA 5TRBA 4TKPB 2YT5A 4AYCA 2KWJA 4YAXA 3RTRB 5LKZA 2NAAA 4UP0A 4GB0A 1CHCA 2LXHC 2G45A 3SOUA 1WEOA 2VPEA 5B79A 3M63A 1HYJA 2LXPC 1XWHA 2MUMA 3DQVR 4UI9B 4S3OC 4WZ2A 2L5UA 2Y1NA 3V43A 2HYED 3O70A 4F52B 1RMDA 4IC2A 2KR4A 4YBTA 4ZUXU 2MT5A 5EYAF 1WGMA 4GNGA 2KYUA 5G0FA 2CSZA 1Z60A 3T6RA 5G04B 3N9LA 3M99A 2VPDA 1JM7B 2CKLB 3HTKC 4GNFA 4I7CA 2YHOA 4PPEA 2YHNA 4AP4A 3ZPVE 1JM7A 2CKLA 3ZNIA 2FSAA 2YREA 2ECNA 1WEWA 3PURA 5G05B 2F6NA 4BBQA 1WEPA 3N9MA 4N4FA 1FP0A 3ZYQA 3O36A 5FB1A 5KH7A 2QICA 5C11A 4N3WA 5B76A 2LGGA 2VNFA 3O35A 2KGIA 2MIQA 1HYIA 2JRJA 3GV4A 4FO9A 2ECIA 2G43A 4R8PK 1WILA 4CA1A 5FERA 2LGVA 3ZPV1 2KIZA 2VP7A 5AITA 3LQHA 2EA6A 3O33A 3M62A 4YATA 2KE1A 2LGKA 1VFYA 5D1KB 4R7EA 3VK6A 2QJ0A 2KWOA 2LV9A 2L75A 2Y1MA 5B78A 4ZQLA 2BAYA 1Z6UA 1VD4A 1WEMA 5H1TA 4LJNA 4FJCA 3U5MA 1K2FA 2H0DB 3GL6A 2F42A 2FUUA 5LCWB 5TABA 2HDPA 4WZ0A 1ZBDB 2LRIC 4YBMA 5H1VA 5H9MA 2KGGA 5DKAA 1IYMA 3KV6A 2KU3A 2XEUA 1WENA 2CSYA 2RSDA 2K17A 2YQLA 3N9PA 3SOXA 2LDRA 4GNDA 3U5NA 1Z2QA 3C6WA 4L7XA 4LK9A 2YSMA 2K1JA 2F6JA 3RPGB 2ECWA 2C2LA 4AUQB 3LRQA 2PNXA 5DINA 4R2YA 3EB5A 1WE9A 1LDJB 2OXQC 2M3HA 4LKAA 2L0BA 5JG6A 4BHWA 2MD7B 2KWNA 4V3LC 2YUCA 2D8SA 2ECVA 2KFTA 1WEQA 4W4UA 1F62A 3U5PA 4WA6A 2JMDA 4C9ZA 2YYRA 5LKUA 4YADA 3ZTGA 3N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSJ A;  4B86 C;  5KH3 A;  3IHP A;  1WFK A;  3O7A A;  2VPB A;  5D1M B;  4A4B A;  3O34 A;  1MM3 A;  2ZET C;  3L1X A;  2I50 A;  3KNV A;  5H1U A;  5KH9 A;  2DX8 A;  2VJF B;  4A4C A;  2ECG A;  3QZV A;  2RI7 A;  3SOW A;  1T1H A;  5B8D A;  3HCU A;  2VJF A;  2VJE B;  2MNY A;  3KV5 A;  3N9Q A;  3L11 A;  1WIM A;  3U5O A;  4YC9 A;  5B75 A;  4MSX A;  3RPG C;  1X4U A;  4UP5 A;  2L80 A;  2LGL A;  2MD8 C;  3O37 A;  2H0D A;  4PTB A;  4AVX A;  2MNZ A;  3LQI A;  4YBS A;  1LDK C;  1X4J A;  3HCS A;  3T7L A;  4V3K C;  1N87 A;  3MHH A;  4A49 A;  3N9N A;  4AYC B;  3ZVZ B;  1BOR A;  5TDR A;  1X4I A;  5B77 A;  1DVP A;  5FEY A;  2FUI A;  4I7D A;  4B7Y C;  2EOD A;  2EGP A;  5AIU A;  4I7B A;  2MA5 A;  4NN2 A;  2YQM A;  4CCG X;  3EB6 A;  3LQJ A;  2K4D A;  4QF3 A;  4LAD B;  2QIZ A;  2L43 A;  2Y43 A;  5TBN A;  1FBV A;  2JMI A;  1U6G B;  2KWK A;  2ECJ A;  2MA6 A;  2ECT A;  2IDA A;  3I2D A;  4LLB A;  2E6S A;  2LQ6 A;  2C2V S;  1JOC A;  2M85 A;  4IC3 A;  2M1R A;  4XI1 A;  4S3O B;  3KQI A;  4P5O B;  2JMJ A;  4FK5 A;  1WEU A;  2KRE A;  1WEV A;  3FL2 A;  1WEE A;  2CT2 A;  2AN6 A;  5I3L A;  3PUQ A;  4L58 A;  4O64 A;  2XB1 A;  1G25 A;  5C13 A;  3MHS A;  3ZVY A;  4A0C D;  1VYX A;  4YAB A;  5TDW A;  3DPL R;  4QF2 A;  3PHD A;  4ZDT A;  2YW8 A;  3C5K A;  3NG2 A;  2E6R A;  2PUY A;  4MVT A;  3ASL A;  2VJE A;  2UZG A;  2YU4 A;  2VPG A;  5LKX A;  3HCT A;  4X3G A;  1V87 A;  5J3X A;  4GNE A;  5FB0 A;  1MM2 A;  5D1L B;  4FIP A;  4Q6F A;  3SHB A;  4WZ3 B;  2LN0 A;  2M6M A;  5LKT A;  1E4U A;  2K16 A;  3L1Z B;  2YUR A;  2G6Q A;  1WES A;  5TRB A;  4TKP B;  2YT5 A;  4AYC A;  2KWJ A;  4YAX A;  3RTR B;  5LKZ A;  2NAA A;  4UP0 A;  4GB0 A;  1CHC A;  2LXH C;  2G45 A;  3SOU A;  1WEO A;  2VPE A;  5B79 A;  3M63 A;  1HYJ A;  2LXP C;  1XWH A;  2MUM A;  3DQV R;  4UI9 B;  4S3O C;  4WZ2 A;  2L5U A;  2Y1N A;  3V43 A;  2HYE D;  3O70 A;  4F52 B;  1RMD A;  4IC2 A;  2KR4 A;  4YBT A;  4ZUX U;  2MT5 A;  5EYA F;  1WGM A;  4GNG A;  2KYU A;  5G0F A;  2CSZ A;  1Z60 A;  3T6R A;  5G04 B;  3N9L A;  3M99 A;  2VPD A;  1JM7 B;  2CKL B;  3HTK C;  4GNF A;  4I7C A;  2YHO A;  4PPE A;  2YHN A;  4AP4 A;  3ZPV E;  1JM7 A;  2CKL A;  3ZNI A;  2FSA A;  2YRE A;  2ECN A;  1WEW A;  3PUR A;  5G05 B;  2F6N A;  4BBQ A;  1WEP A;  3N9M A;  4N4F A;  1FP0 A;  3ZYQ A;  3O36 A;  5FB1 A;  5KH7 A;  2QIC A;  5C11 A;  4N3W A;  5B76 A;  2LGG A;  2VNF A;  3O35 A;  2KGI A;  2MIQ A;  1HYI A;  2JRJ A;  3GV4 A;  4FO9 A;  2ECI A;  2G43 A;  4R8P K;  1WIL A;  4CA1 A;  5FER A;  2LGV A;  3ZPV 1;  2KIZ A;  2VP7 A;  5AIT A;  3LQH A;  2EA6 A;  3O33 A;  3M62 A;  4YAT A;  2KE1 A;  2LGK A;  1VFY A;  5D1K B;  4R7E A;  3VK6 A;  2QJ0 A;  2KWO A;  2LV9 A;  2L75 A;  2Y1M A;  5B78 A;  4ZQL A;  2BAY A;  1Z6U A;  1VD4 A;  1WEM A;  5H1T A;  4LJN A;  4FJC A;  3U5M A;  1K2F A;  2H0D B;  3GL6 A;  2F42 A;  2FUU A;  5LCW B;  5TAB A;  2HDP A;  4WZ0 A;  1ZBD B;  2LRI C;  4YBM A;  5H1V A;  5H9M A;  2KGG A;  5DKA A;  1IYM A;  3KV6 A;  2KU3 A;  2XEU A;  1WEN A;  2CSY A;  2RSD A;  2K17 A;  2YQL A;  3N9P A;  3SOX A;  2LDR A;  4GND A;  3U5N A;  1Z2Q A;  3C6W A;  4L7X A;  4LK9 A;  2YSM A;  2K1J A;  2F6J A;  3RPG B;  2ECW A;  2C2L A;  4AUQ B;  3LRQ A;  2PNX A;  5DIN A;  4R2Y A;  3EB5 A;  1WE9 A;  1LDJ B;  2OXQ C;  2M3H A;  4LKA A;  2L0B A;  5JG6 A;  4BHW A;  2MD7 B;  2KWN A;  4V3L C;  2YUC A;  2D8S A;  2ECV A;  2KFT A;  1WEQ A;  4W4U A;  1F62 A;  3U5P A;  4WA6 A;  2JMD A;  4C9Z A;  2YYR A;  5LKU A;  4YAD A;  3ZTG A;  3N9O A; 
#chains in the Genus database with same CATH topology
 2YSJ A;  4B86 C;  5KH3 A;  2IQJ A;  2XOZ A;  3LDY A;  3IHP A;  1WFK A;  3O7A A;  2VPB A;  5D1M B;  3DWD A;  4A4B A;  3O34 A;  1MM3 A;  2ZET C;  3L1X A;  2I50 A;  3KNV A;  2YVR A;  5H1U A;  5KH9 A;  2DX8 A;  2VJF B;  4A4C A;  2ECG A;  3QZV A;  3Q1D A;  2RI7 A;  3SOW A;  1T1H A;  5B8D A;  3HCU A;  3T9K A;  2D8U A;  2VJF A;  2MNY A;  2VJE B;  1MBM A;  3KV5 A;  3N9Q A;  3L11 A;  1WIM A;  3U5O A;  4YC9 A;  5B75 A;  4MSX A;  3RPG C;  3PLW A;  1X4U A;  4Z0R A;  2L80 A;  2LGL A;  4UP5 A;  2MD8 C;  3O37 A;  2H0D A;  4PTB A;  4AVX A;  2MNZ A;  3LQI A;  4YBS A;  1LDK C;  1X4J A;  3HCS A;  3T7L A;  4V3K C;  1N87 A;  3MHH A;  4A49 A;  3N9N A;  4AYC B;  1DCQ A;  3ZVZ B;  1BOR A;  2EGM A;  5TDR A;  1X4I A;  5B77 A;  3SUB A;  1DVP A;  5FEY A;  2FUI A;  4I7D A;  4O62 A;  4B7Y C;  2EOD A;  2EGP A;  4Z0O A;  5AIU A;  4I7B A;  3O47 A;  2MA5 A;  4NN2 A;  2YQM A;  4CCG X;  3EB6 A;  3LQJ A;  2K4D A;  4QF3 A;  4LAD B;  2QIZ A;  3LVR E;  2L43 A;  2Y43 A;  5TBN A;  1FBV A;  2JMI A;  4OGC A;  1U6G B;  2KWK A;  2ECJ A;  2MA6 A;  2ECT A;  2IDA A;  3I2D A;  4LLB A;  3FAO A;  5SVI B;  2E6S A;  2LQ6 A;  2C2V S;  2JM3 A;  1JOC A;  2M85 A;  4IC3 A;  2CSV A;  2M1R A;  4XI1 A;  4S3O B;  3KQI A;  4P5O B;  2JMJ A;  4FK5 A;  1WEU A;  2KRE A;  1WEV A;  3FL2 A;  1WEE A;  2CT2 A;  2AN6 A;  5I3L A;  2RR4 A;  3PUQ A;  4L58 A;  4O64 A;  2XB1 A;  2CRR A;  1G25 A;  5C13 A;  3MHS A;  3ZVY A;  4A0C D;  1VYX A;  4YAB A;  5TDW A;  3DPL R;  4QF2 A;  3PHD A;  4ZDT A;  2YW8 A;  3C5K A;  3NG2 A;  2E6R A;  3LJU X;  2PUY A;  4MVT A;  3ASL A;  2VJE A;  2UZG A;  2YU4 A;  2VPG A;  5LKX A;  3HCT A;  4X3G A;  1V87 A;  5J3X A;  4GNE A;  2CRW A;  5FB0 A;  1MM2 A;  5D1L B;  4FIP A;  4Q6F A;  3SHB A;  4WZ3 B;  2LN0 A;  2M6M A;  5LKT A;  1E4U A;  2K16 A;  5SVY A;  3L1Z B;  2YUR A;  2G6Q A;  1WES A;  5TRB A;  4TKP B;  2YT5 A;  4AYC A;  2KWJ A;  4YAX A;  3RTR B;  5LKZ A;  5SVX A;  2NAA A;  2L7P A;  4UP0 A;  2LAU A;  4GB0 A;  1CHC A;  2LXH C;  2G45 A;  3SOU A;  3KDE C;  1WEO A;  2VPE A;  5B79 A;  2XP0 A;  3M63 A;  1HYJ A;  2LXP C;  1XWH A;  2MUM A;  3DQV R;  4UI9 B;  4S3O C;  4WZ2 A;  2L5U A;  2Y1N A;  3V43 A;  2HYE D;  3O70 A;  4F52 B;  1RMD A;  4IC2 A;  2KR4 A;  4YBT A;  4ZUX U;  2FD4 A;  2MT5 A;  5EYA F;  1WGM A;  4GNG A;  2KYU A;  5G0F A;  2CSZ A;  1Z60 A;  2XOC A;  3T6R A;  5G04 B;  3N9L A;  3M99 A;  2VPD A;  2CON A;  1JM7 B;  5SVI A;  2CKL B;  3HTK C;  4GNF A;  4I7C A;  2YHO A;  4PPE A;  2YHN A;  4AP4 A;  3ZPV E;  1JM7 A;  2CKL A;  3ZNI A;  2FSA A;  2KKY A;  4F1P A;  2YRE A;  2ECN A;  1WEW A;  3PUR A;  5G05 B;  2F6N A;  3FM8 C;  4BBQ A;  1WEP A;  3N9M A;  4N4F A;  1FP0 A;  3ZYQ A;  3O36 A;  5FB1 A;  5KH7 A;  2QIC A;  5C11 A;  4N3W A;  3M7K A;  3LVQ E;  5B76 A;  2LGG A;  2VNF A;  3O35 A;  2KGI A;  2MIQ A;  1HYI A;  2JRJ A;  3GV4 A;  4FO9 A;  2ECI A;  2G43 A;  2DJA A;  4R8P K;  1WIL A;  4CA1 A;  5FER A;  2LGV A;  3ZPV 1;  2KIZ A;  2VP7 A;  5AIT A;  3LQH A;  2EA6 A;  3O33 A;  3M62 A;  4YAT A;  2KE1 A;  2LGK A;  1VFY A;  4R7E A;  5D1K B;  3VK6 A;  2QJ0 A;  2KWO A;  2LV9 A;  2L75 A;  2Y1M A;  5B78 A;  4ZQL A;  2BAY A;  2DSM A;  1Z6U A;  1VD4 A;  1WEM A;  5H1T A;  4LJN A;  4FJC A;  3U5M A;  1K2F A;  2H0D B;  3GL6 A;  2F42 A;  2FUU A;  5LCW B;  5TAB A;  2HDP A;  4WZ0 A;  1ZBD B;  3E2D A;  2LRI C;  4YBM A;  5H1V A;  5H9M A;  5K3Q A;  2KGG A;  5DKA A;  1IYM A;  3KV6 A;  2KU3 A;  3H7H A;  2XEU A;  1WEN A;  2MKE A;  2CSY A;  2RSD A;  2K17 A;  3MDB C;  2JUN A;  2YQL A;  3N9P A;  3SOX A;  2XOY A;  2LDR A;  4GND A;  3U5N A;  1Z2Q A;  3C6W A;  4OGE A;  4L7X A;  4LK9 A;  2M13 A;  2YSM A;  2K1J A;  2F6J A;  3RPG B;  2B0O E;  3FAN A;  2ECW A;  2OWA A;  2C2L A;  3JUE A;  4AUQ B;  3LRQ A;  2PNX A;  5DIN A;  4QQ4 A;  4R2Y A;  3EB5 A;  2FFW A;  1WE9 A;  3FEH A;  1LDJ B;  2OXQ C;  2M3H A;  4LKA A;  2L0B A;  5JG6 A;  4BHW A;  2MD7 B;  2KWN A;  4V3L C;  2YUC A;  2D8S A;  2ECV A;  2KFT A;  1WEQ A;  2P57 A;  4W4U A;  1F62 A;  3U5P A;  3DDT A;  4WA6 A;  2JMD A;  2E61 A;  4C9Z A;  2YYR A;  5LKU A;  2EXU A;  4H9D A;  4YAD A;  3ZTG A;  3FJU B;  2KKX A;  3N9O A; 
#chains in the Genus database with same CATH homology
 2YSJ A;  4B86 C;  5KH3 A;  3IHP A;  1WFK A;  3O7A A;  2VPB A;  5D1M B;  4A4B A;  3O34 A;  1MM3 A;  2ZET C;  3L1X A;  2I50 A;  3KNV A;  5H1U A;  5KH9 A;  2DX8 A;  2VJF B;  4A4C A;  2ECG A;  3QZV A;  2RI7 A;  3SOW A;  1T1H A;  5B8D A;  3HCU A;  2VJF A;  2VJE B;  2MNY A;  3KV5 A;  3N9Q A;  3L11 A;  1WIM A;  3U5O A;  4YC9 A;  5B75 A;  4MSX A;  3RPG C;  1X4U A;  4UP5 A;  2L80 A;  2LGL A;  2MD8 C;  3O37 A;  2H0D A;  4PTB A;  4AVX A;  2MNZ A;  3LQI A;  4YBS A;  1LDK C;  1X4J A;  3HCS A;  3T7L A;  4V3K C;  1N87 A;  3MHH A;  4A49 A;  3N9N A;  4AYC B;  3ZVZ B;  1BOR A;  5TDR A;  1X4I A;  5B77 A;  1DVP A;  5FEY A;  2FUI A;  4I7D A;  4B7Y C;  2EOD A;  2EGP A;  5AIU A;  4I7B A;  2MA5 A;  4NN2 A;  2YQM A;  4CCG X;  3EB6 A;  3LQJ A;  2K4D A;  4QF3 A;  4LAD B;  2QIZ A;  2L43 A;  2Y43 A;  5TBN A;  1FBV A;  2JMI A;  1U6G B;  2KWK A;  2ECJ A;  2MA6 A;  2ECT A;  2IDA A;  3I2D A;  4LLB A;  2E6S A;  2LQ6 A;  2C2V S;  1JOC A;  2M85 A;  4IC3 A;  2M1R A;  4XI1 A;  4S3O B;  3KQI A;  4P5O B;  2JMJ A;  4FK5 A;  1WEU A;  2KRE A;  1WEV A;  3FL2 A;  1WEE A;  2CT2 A;  2AN6 A;  5I3L A;  3PUQ A;  4L58 A;  4O64 A;  2XB1 A;  1G25 A;  5C13 A;  3MHS A;  3ZVY A;  4A0C D;  1VYX A;  4YAB A;  5TDW A;  3DPL R;  4QF2 A;  3PHD A;  4ZDT A;  2YW8 A;  3C5K A;  3NG2 A;  2E6R A;  2PUY A;  4MVT A;  3ASL A;  2VJE A;  2UZG A;  2YU4 A;  2VPG A;  5LKX A;  3HCT A;  4X3G A;  1V87 A;  5J3X A;  4GNE A;  5FB0 A;  1MM2 A;  5D1L B;  4FIP A;  4Q6F A;  3SHB A;  4WZ3 B;  2LN0 A;  2M6M A;  5LKT A;  1E4U A;  2K16 A;  3L1Z B;  2YUR A;  2G6Q A;  1WES A;  5TRB A;  4TKP B;  2YT5 A;  4AYC A;  2KWJ A;  4YAX A;  3RTR B;  5LKZ A;  2NAA A;  4UP0 A;  4GB0 A;  1CHC A;  2LXH C;  2G45 A;  3SOU A;  1WEO A;  2VPE A;  5B79 A;  3M63 A;  1HYJ A;  2LXP C;  1XWH A;  2MUM A;  3DQV R;  4UI9 B;  4S3O C;  4WZ2 A;  2L5U A;  2Y1N A;  3V43 A;  2HYE D;  3O70 A;  4F52 B;  1RMD A;  4IC2 A;  2KR4 A;  4YBT A;  4ZUX U;  2MT5 A;  5EYA F;  1WGM A;  4GNG A;  2KYU A;  5G0F A;  2CSZ A;  1Z60 A;  3T6R A;  5G04 B;  3N9L A;  3M99 A;  2VPD A;  1JM7 B;  2CKL B;  3HTK C;  4GNF A;  4I7C A;  2YHO A;  4PPE A;  2YHN A;  4AP4 A;  3ZPV E;  1JM7 A;  2CKL A;  3ZNI A;  2FSA A;  2YRE A;  2ECN A;  1WEW A;  3PUR A;  5G05 B;  2F6N A;  4BBQ A;  1WEP A;  3N9M A;  4N4F A;  1FP0 A;  3ZYQ A;  3O36 A;  5FB1 A;  5KH7 A;  2QIC A;  5C11 A;  4N3W A;  5B76 A;  2LGG A;  2VNF A;  3O35 A;  2KGI A;  2MIQ A;  1HYI A;  2JRJ A;  3GV4 A;  4FO9 A;  2ECI A;  2G43 A;  4R8P K;  1WIL A;  4CA1 A;  5FER A;  2LGV A;  3ZPV 1;  2KIZ A;  2VP7 A;  5AIT A;  3LQH A;  2EA6 A;  3O33 A;  3M62 A;  4YAT A;  2KE1 A;  2LGK A;  1VFY A;  5D1K B;  4R7E A;  3VK6 A;  2QJ0 A;  2KWO A;  2LV9 A;  2L75 A;  2Y1M A;  5B78 A;  4ZQL A;  2BAY A;  1Z6U A;  1VD4 A;  1WEM A;  5H1T A;  4LJN A;  4FJC A;  3U5M A;  1K2F A;  2H0D B;  3GL6 A;  2F42 A;  2FUU A;  5LCW B;  5TAB A;  2HDP A;  4WZ0 A;  1ZBD B;  2LRI C;  4YBM A;  5H1V A;  5H9M A;  2KGG A;  5DKA A;  1IYM A;  3KV6 A;  2KU3 A;  2XEU A;  1WEN A;  2CSY A;  2RSD A;  2K17 A;  2YQL A;  3N9P A;  3SOX A;  2LDR A;  4GND A;  3U5N A;  1Z2Q A;  3C6W A;  4L7X A;  4LK9 A;  2YSM A;  2K1J A;  2F6J A;  3RPG B;  2ECW A;  2C2L A;  4AUQ B;  3LRQ A;  2PNX A;  5DIN A;  4R2Y A;  3EB5 A;  1WE9 A;  1LDJ B;  2OXQ C;  2M3H A;  4LKA A;  2L0B A;  5JG6 A;  4BHW A;  2MD7 B;  2KWN A;  4V3L C;  2YUC A;  2D8S A;  2ECV A;  2KFT A;  1WEQ A;  4W4U A;  1F62 A;  3U5P A;  4WA6 A;  2JMD A;  4C9Z A;  2YYR A;  5LKU A;  4YAD A;  3ZTG A;  3N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...