2LGLA

Nmr structure of the uhrf1 phd domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lglA00
4FIPA 4YBTA 2KE1A 3O35A 4PTBA 5TDWA 5TRBA 2F42A 3GL6A 1JOCA 2YSMA 2H0DA 2YREA 5KH7A 1F62A 1VD4A 4MSXA 2LQ6A 3N9NA 5J3XA 2LXHC 1WEUA 2MIQA 5B77A 4GB0A 2JMDA 2YHOA 2YT5A 2LDRA 4Q6FA 2ECJA 3SHBA 4A4CA 5EYAF 2KIZA 2LGLA 5FEYA 2KFTA 2KGIA 1Z60A 2M1RA 5LKTA 4BBQA 4YADA 2YHNA 3ZYQA 3ZPVE 3U5MA 3VK6A 2KWOA 2QJ0A 2KR4A 3RPGC 2C2VS 2YUCA 2MNYA 3PHDA 2M85A 2MD7B 2EA6A 2EGPA 5AIUA 5D1KB 2VJFA 1X4UA 3LQIA 1VFYA 4IC3A 2IDAA 1WE9A 3KNVA 2VJEB 4GNDA 2LRIC 3MHHA 4CCGX 2Y1NA 2HDPA 1WENA 2ECNA 4C9ZA 2VPEA 2CKLA 4CA1A 2VPDA 3L11A 5TBNA 5H1UA 1DVPA 4LK9A 4UP0A 2HYED 3O34A 2VNFA 2PNXA 3M99A 1IYMA 1WEWA 1MM3A 5G0FA 3RPGB 2L5UA 4A0CD 2K1JA 3M63A 4YC9A 2YQMA 2XB1A 2K4DA 2G6QA 5TDRA 3HCTA 1WESA 4NN2A 2LV9A 2BAYA 2ECGA 4A4BA 2KWKA 5LKXA 3PURA 5I3LA 4AYCB 5B78A 3N9PA 4O64A 5DKAA 5B8DA 2KYUA 3EB6A 4WZ0A 2MA5A 4LJNA 4XI1A 4GNGA 2KU3A 3U5PA 4GNEA 4IC2A 5H1TA 2QIZA 1RMDA 4FK5A 2QICA 2Y1MA 2YQLA 2C2LA 2UZGA 3PUQA 2ECWA 3M62A 4PPEA 2XEUA 2D8SA 3DQVR 3SOUA 2LGKA 5H1VA 2ECTA 3IHPA 4YBSA 3EB5A 4WA6A 4N4FA 3DPLR 2YW8A 1N87A 3ZPV1 2I50A 2M3HA 2PUYA 2G43A 2NAAA 4AUQB 1WGMA 4LADB 1WEOA 1U6GB 1JM7B 3RTRB 4YATA 4S3OC 3I2DA 4L58A 1MM2A 4AVXA 3NG2A 4R8PK 4W4UA 4B86C 2L75A 1G25A 3ZVYA 2F6JA 1WEPA 3LQJA 1X4IA 5AITA 4ZQLA 2KREA 2LXPC 2AN6A 5LKZA 5TABA 2YURA 4LKAA 1XWHA 4ZDTA 2LGGA 3HTKC 3L1ZB 3LRQA 4V3LC 2CT2A 2VJEA 2CSYA 4I7DA 4I7BA 2ECIA 3N9MA 4AP4A 5C11A 4S3OB 2K17A 1VYXA 2MD8C 3N9LA 1WEMA 2H0DB 2CSZA 2L43A 1WFKA 2L0BA 2RI7A 5KH9A 3ZVZB 1WILA 4F52B 4I7CA 1K2FA 2YYRA 2OXQC 5KH3A 3SOXA 1WIMA 4BHWA 4WZ3B 2MA6A 1LDJB 2G45A 4UP5A 5C13A 3O36A 2F6NA 2MNZA 3ZTGA 1Z2QA 2RSDA 3KV5A 4FJCA 2Y43A 2MT5A 5FB1A 3L1XA 4AYCA 5B75A 5D1MB 4MVTA 4TKPB 1WEEA 3HCSA 4L7XA 1LDKC 1FBVA 2VJFB 4P5OB 1BORA 3QZVA 4X3GA 1X4JA 2EODA 4QF3A 3ASLA 5FB0A 5LCWB 3FL2A 5B76A 3V43A 1Z6UA 2YSJA 3U5OA 2CKLB 2FUIA 3GV4A 2E6SA 3T7LA 3SOWA 1T1HA 2LGVA 5H9MA 1CHCA 2KWNA 5D1LB 3KQIA 3N9OA 4B7YC 1V87A 3C5KA 3LQHA 2KWJA 3O33A 2DX8A 3O37A 3O70A 3U5NA 3HCUA 2KGGA 4YABA 4YBMA 4N3WA 2VPBA 1WEQA 3KV6A 2YU4A 1WEVA 4A49A 1JM7A 2FSAA 5B79A 2K16A 4R7EA 4YAXA 2E6RA 2JMJA 2ECVA 5LKUA 2FUUA 4FO9A 5FERA 2VPGA 5G04B 4R2YA 2LN0A 2JMIA 3MHSA 1FP0A 4LLBA 4UI9B 4WZ2A 1ZBDB 3N9QA 5JG6A 1HYJA 5G05B 1HYIA 2L80A 1E4UA 2VP7A 3T6RA 4GNFA 3C6WA 3ZNIA 4ZUXU 2MUMA 2M6MA 2JRJA 5DINA 2ZETC 4QF2A 3O7AA 4V3KC
chains in the Genus database with same CATH superfamily
2CONA 4FIPA 2E61A 4YBTA 2KE1A 3O35A 4PTBA 5TDWA 5TRBA 2F42A 5SVIA 3GL6A 1JOCA 5SVXA 2YSMA 2M13A 2H0DA 2CRRA 2YREA 5KH7A 1F62A 1VD4A 4MSXA 2LQ6A 3DWDA 3N9NA 5J3XA 2LXHC 1WEUA 2B0OE 2MIQA 5B77A 2XOZA 4GB0A 2JMDA 2YHOA 2YT5A 2LDRA 4Q6FA 2ECJA 3SHBA 3LVQE 4A4CA 2XOCA 2XOYA 5EYAF 2KIZA 2CRWA 2LGLA 5FEYA 2KFTA 2KGIA 1Z60A 2M1RA 3SUBA 5LKTA 4BBQA 3Q1DA 4YADA 2YHNA 3ZYQA 3ZPVE 3U5MA 3VK6A 2KWOA 2QJ0A 2KR4A 3RPGC 2C2VS 2YUCA 2MNYA 3PHDA 2M85A 2MD7B 2EA6A 2EGPA 5AIUA 5D1KB 2VJFA 1X4UA 3LQIA 1VFYA 3LJUX 4IC3A 2IDAA 1WE9A 3KNVA 2VJEB 4GNDA 2LRIC 3MHHA 4CCGX 2Y1NA 2HDPA 1WENA 2ECNA 4C9ZA 2VPEA 2CKLA 4CA1A 2VPDA 3L11A 5TBNA 5H1UA 1DVPA 4LK9A 3DDTA 3FANA 4UP0A 2HYED 1DCQA 3O34A 2VNFA 2PNXA 3M99A 1IYMA 1WEWA 1MM3A 5G0FA 3RPGB 2L5UA 4A0CD 2K1JA 3M63A 4YC9A 2YQMA 2XB1A 2K4DA 2G6QA 5TDRA 3HCTA 1WESA 4NN2A 2LV9A 2BAYA 2ECGA 4A4BA 2LAUA 2KWKA 5LKXA 3PURA 5I3LA 2OWAA 4AYCB 4Z0RA 5B78A 3N9PA 4O64A 5DKAA 4OGEA 2KYUA 3EB6A 4WZ0A 5B8DA 2YVRA 2P57A 2MA5A 4LJNA 4XI1A 4GNGA 2KU3A 3T9KA 3M7KA 3U5PA 4GNEA 4IC2A 5H1TA 2QIZA 1RMDA 4FK5A 2QICA 2Y1MA 2YQLA 2C2LA 2UZGA 3PUQA 2ECWA 3M62A 2DJAA 4PPEA 2XEUA 4H9DA 2JUNA 2D8SA 3DQVR 3SOUA 2LGKA 5H1VA 2ECTA 3FM8C 3IHPA 2JM3A 4YBSA 3LVRE 3EB5A 4WA6A 4N4FA 3DPLR 2YW8A 1MBMA 1N87A 3ZPV1 2I50A 2M3HA 2PUYA 2RR4A 2G43A 2NAAA 4AUQB 1WGMA 4LADB 1WEOA 5K3QA 1U6GB 1JM7B 2IQJA 3RTRB 4YATA 4S3OC 2MKEA 3I2DA 4L58A 1MM2A 4AVXA 3NG2A 4R8PK 4W4UA 4B86C 2L75A 1G25A 3ZVYA 2F6JA 1WEPA 3LQJA 1X4IA 5AITA 4ZQLA 2KREA 2LXPC 2AN6A 2DSMA 5LKZA 5TABA 2CSVA 2YURA 4LKAA 1XWHA 4ZDTA 2LGGA 3HTKC 3L1ZB 3LRQA 4V3LC 2CT2A 2VJEA 2CSYA 4I7DA 4I7BA 2D8UA 2ECIA 3N9MA 3H7HA 4AP4A 5C11A 4S3OB 2K17A 1VYXA 3FEHA 5SVIB 3LDYA 2MD8C 3N9LA 1WEMA 2H0DB 2CSZA 2L43A 5SVYA 1WFKA 2L0BA 2RI7A 5KH9A 3ZVZB 1WILA 4F52B 4I7CA 1K2FA 2YYRA 2OXQC 5KH3A 3SOXA 1WIMA 4BHWA 4WZ3B 2MA6A 1LDJB 2G45A 4UP5A 5C13A 3PLWA 3FAOA 3O36A 2F6NA 2MNZA 3ZTGA 1Z2QA 2RSDA 4FJCA 3KV5A 2Y43A 4F1PA 2MT5A 5FB1A 3L1XA 4AYCA 5B75A 3KDEC 5D1MB 4MVTA 4TKPB 3FJUB 2FD4A 1WEEA 3HCSA 4L7XA 1LDKC 1FBVA 4OGCA 2VJFB 4P5OB 1BORA 3QZVA 4X3GA 1X4JA 2EODA 4QF3A 3ASLA 5FB0A 5LCWB 3FL2A 5B76A 3V43A 1Z6UA 2YSJA 3U5OA 2CKLB 2FUIA 2EGMA 3GV4A 2E6SA 3T7LA 3SOWA 1T1HA 2LGVA 5H9MA 1CHCA 2KWNA 5D1LB 3KQIA 3N9OA 2FFWA 4B7YC 1V87A 4QQ4A 3C5KA 3LQHA 2KWJA 3O33A 2DX8A 3O37A 3O70A 3U5NA 2XP0A 3HCUA 2KGGA 4YABA 4YBMA 4N3WA 2VPBA 1WEQA 3KV6A 3O47A 3JUEA 2KKXA 2YU4A 1WEVA 4A49A 1JM7A 2FSAA 5B79A 2K16A 4R7EA 4YAXA 2E6RA 2JMJA 2ECVA 5LKUA 2FUUA 4FO9A 2L7PA 5FERA 2VPGA 5G04B 4R2YA 2KKYA 2LN0A 2JMIA 4O62A 3MHSA 1FP0A 4Z0OA 4LLBA 4UI9B 4WZ2A 1ZBDB 3N9QA 5JG6A 1HYJA 3MDBC 5G05B 1HYIA 2L80A 1E4UA 2VP7A 3T6RA 4GNFA 3E2DA 3C6WA 3ZNIA 4ZUXU 2MUMA 2M6MA 2JRJA 2EXUA 5DINA 2ZETC 4QF2A 3O7AA 4V3KC
chains in the Genus database with same CATH topology
4FIPA 4YBTA 2KE1A 3O35A 4PTBA 5TDWA 5TRBA 2F42A 3GL6A 1JOCA 2YSMA 2H0DA 2YREA 5KH7A 1F62A 1VD4A 4MSXA 2LQ6A 3N9NA 5J3XA 2LXHC 1WEUA 2MIQA 5B77A 4GB0A 2JMDA 2YHOA 2YT5A 2LDRA 4Q6FA 2ECJA 3SHBA 4A4CA 5EYAF 2KIZA 2LGLA 5FEYA 2KFTA 2KGIA 1Z60A 2M1RA 5LKTA 4BBQA 4YADA 2YHNA 3ZYQA 3ZPVE 3U5MA 3VK6A 2KWOA 2QJ0A 2KR4A 3RPGC 2C2VS 2YUCA 2MNYA 3PHDA 2M85A 2MD7B 2EA6A 2EGPA 5AIUA 5D1KB 2VJFA 1X4UA 3LQIA 1VFYA 4IC3A 2IDAA 1WE9A 3KNVA 2VJEB 4GNDA 2LRIC 3MHHA 4CCGX 2Y1NA 2HDPA 1WENA 2ECNA 4C9ZA 2VPEA 2CKLA 4CA1A 2VPDA 3L11A 5TBNA 5H1UA 1DVPA 4LK9A 4UP0A 2HYED 3O34A 2VNFA 2PNXA 3M99A 1IYMA 1WEWA 1MM3A 5G0FA 3RPGB 2L5UA 4A0CD 2K1JA 3M63A 4YC9A 2YQMA 2XB1A 2K4DA 2G6QA 5TDRA 3HCTA 1WESA 4NN2A 2LV9A 2BAYA 2ECGA 4A4BA 2KWKA 5LKXA 3PURA 5I3LA 4AYCB 5B78A 3N9PA 4O64A 5DKAA 5B8DA 2KYUA 3EB6A 4WZ0A 2MA5A 4LJNA 4XI1A 4GNGA 2KU3A 3U5PA 4GNEA 4IC2A 5H1TA 2QIZA 1RMDA 4FK5A 2QICA 2Y1MA 2YQLA 2C2LA 2UZGA 3PUQA 2ECWA 3M62A 4PPEA 2XEUA 2D8SA 3DQVR 3SOUA 2LGKA 5H1VA 2ECTA 3IHPA 4YBSA 3EB5A 4WA6A 4N4FA 3DPLR 2YW8A 1N87A 3ZPV1 2I50A 2M3HA 2PUYA 2G43A 2NAAA 4AUQB 1WGMA 4LADB 1WEOA 1U6GB 1JM7B 3RTRB 4YATA 4S3OC 3I2DA 4L58A 1MM2A 4AVXA 3NG2A 4R8PK 4W4UA 4B86C 2L75A 1G25A 3ZVYA 2F6JA 1WEPA 3LQJA 1X4IA 5AITA 4ZQLA 2KREA 2LXPC 2AN6A 5LKZA 5TABA 2YURA 4LKAA 1XWHA 4ZDTA 2LGGA 3HTKC 3L1ZB 3LRQA 4V3LC 2CT2A 2VJEA 2CSYA 4I7DA 4I7BA 2ECIA 3N9MA 4AP4A 5C11A 4S3OB 2K17A 1VYXA 2MD8C 3N9LA 1WEMA 2H0DB 2CSZA 2L43A 1WFKA 2L0BA 2RI7A 5KH9A 3ZVZB 1WILA 4F52B 4I7CA 1K2FA 2YYRA 2OXQC 5KH3A 3SOXA 1WIMA 4BHWA 4WZ3B 2MA6A 1LDJB 2G45A 4UP5A 5C13A 3O36A 2F6NA 2MNZA 3ZTGA 1Z2QA 2RSDA 3KV5A 4FJCA 2Y43A 2MT5A 5FB1A 3L1XA 4AYCA 5B75A 5D1MB 4MVTA 4TKPB 1WEEA 3HCSA 4L7XA 1LDKC 1FBVA 2VJFB 4P5OB 1BORA 3QZVA 4X3GA 1X4JA 2EODA 4QF3A 3ASLA 5FB0A 5LCWB 3FL2A 5B76A 3V43A 1Z6UA 2YSJA 3U5OA 2CKLB 2FUIA 3GV4A 2E6SA 3T7LA 3SOWA 1T1HA 2LGVA 5H9MA 1CHCA 2KWNA 5D1LB 3KQIA 3N9OA 4B7YC 1V87A 3C5KA 3LQHA 2KWJA 3O33A 2DX8A 3O37A 3O70A 3U5NA 3HCUA 2KGGA 4YABA 4YBMA 4N3WA 2VPBA 1WEQA 3KV6A 2YU4A 1WEVA 4A49A 1JM7A 2FSAA 5B79A 2K16A 4R7EA 4YAXA 2E6RA 2JMJA 2ECVA 5LKUA 2FUUA 4FO9A 5FERA 2VPGA 5G04B 4R2YA 2LN0A 2JMIA 3MHSA 1FP0A 4LLBA 4UI9B 4WZ2A 1ZBDB 3N9QA 5JG6A 1HYJA 5G05B 1HYIA 2L80A 1E4UA 2VP7A 3T6RA 4GNFA 3C6WA 3ZNIA 4ZUXU 2MUMA 2M6MA 2JRJA 5DINA 2ZETC 4QF2A 3O7AA 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIP A;  4YBT A;  2KE1 A;  3O35 A;  4PTB A;  5TDW A;  5TRB A;  2F42 A;  3GL6 A;  1JOC A;  2YSM A;  2H0D A;  2YRE A;  5KH7 A;  1F62 A;  1VD4 A;  4MSX A;  2LQ6 A;  3N9N A;  5J3X A;  2LXH C;  1WEU A;  2MIQ A;  5B77 A;  4GB0 A;  2JMD A;  2YHO A;  2YT5 A;  2LDR A;  4Q6F A;  2ECJ A;  3SHB A;  4A4C A;  5EYA F;  2KIZ A;  2LGL A;  5FEY A;  2KFT A;  2KGI A;  1Z60 A;  2M1R A;  5LKT A;  4BBQ A;  4YAD A;  2YHN A;  3ZYQ A;  3ZPV E;  3U5M A;  3VK6 A;  2KWO A;  2QJ0 A;  2KR4 A;  3RPG C;  2C2V S;  2YUC A;  2MNY A;  3PHD A;  2M85 A;  2MD7 B;  2EA6 A;  2EGP A;  5AIU A;  5D1K B;  2VJF A;  1X4U A;  3LQI A;  1VFY A;  4IC3 A;  2IDA A;  1WE9 A;  3KNV A;  2VJE B;  4GND A;  2LRI C;  3MHH A;  4CCG X;  2Y1N A;  2HDP A;  1WEN A;  2ECN A;  4C9Z A;  2VPE A;  2CKL A;  4CA1 A;  2VPD A;  3L11 A;  5TBN A;  5H1U A;  1DVP A;  4LK9 A;  4UP0 A;  2HYE D;  3O34 A;  2VNF A;  2PNX A;  3M99 A;  1IYM A;  1WEW A;  1MM3 A;  5G0F A;  3RPG B;  2L5U A;  4A0C D;  2K1J A;  3M63 A;  4YC9 A;  2YQM A;  2XB1 A;  2K4D A;  2G6Q A;  5TDR A;  3HCT A;  1WES A;  4NN2 A;  2LV9 A;  2BAY A;  2ECG A;  4A4B A;  2KWK A;  5LKX A;  3PUR A;  5I3L A;  4AYC B;  5B78 A;  3N9P A;  4O64 A;  5DKA A;  5B8D A;  2KYU A;  3EB6 A;  4WZ0 A;  2MA5 A;  4LJN A;  4XI1 A;  4GNG A;  2KU3 A;  3U5P A;  4GNE A;  4IC2 A;  5H1T A;  2QIZ A;  1RMD A;  4FK5 A;  2QIC A;  2Y1M A;  2YQL A;  2C2L A;  2UZG A;  3PUQ A;  2ECW A;  3M62 A;  4PPE A;  2XEU A;  2D8S A;  3DQV R;  3SOU A;  2LGK A;  5H1V A;  2ECT A;  3IHP A;  4YBS A;  3EB5 A;  4WA6 A;  4N4F A;  3DPL R;  2YW8 A;  1N87 A;  3ZPV 1;  2I50 A;  2M3H A;  2PUY A;  2G43 A;  2NAA A;  4AUQ B;  1WGM A;  4LAD B;  1WEO A;  1U6G B;  1JM7 B;  3RTR B;  4YAT A;  4S3O C;  3I2D A;  4L58 A;  1MM2 A;  4AVX A;  3NG2 A;  4R8P K;  4W4U A;  4B86 C;  2L75 A;  1G25 A;  3ZVY A;  2F6J A;  1WEP A;  3LQJ A;  1X4I A;  5AIT A;  4ZQL A;  2KRE A;  2LXP C;  2AN6 A;  5LKZ A;  5TAB A;  2YUR A;  4LKA A;  1XWH A;  4ZDT A;  2LGG A;  3HTK C;  3L1Z B;  3LRQ A;  4V3L C;  2CT2 A;  2VJE A;  2CSY A;  4I7D A;  4I7B A;  2ECI A;  3N9M A;  4AP4 A;  5C11 A;  4S3O B;  2K17 A;  1VYX A;  2MD8 C;  3N9L A;  1WEM A;  2H0D B;  2CSZ A;  2L43 A;  1WFK A;  2L0B A;  2RI7 A;  5KH9 A;  3ZVZ B;  1WIL A;  4F52 B;  4I7C A;  1K2F A;  2YYR A;  2OXQ C;  5KH3 A;  3SOX A;  1WIM A;  4BHW A;  4WZ3 B;  2MA6 A;  1LDJ B;  2G45 A;  4UP5 A;  5C13 A;  3O36 A;  2F6N A;  2MNZ A;  3ZTG A;  1Z2Q A;  2RSD A;  3KV5 A;  4FJC A;  2Y43 A;  2MT5 A;  5FB1 A;  3L1X A;  4AYC A;  5B75 A;  5D1M B;  4MVT A;  4TKP B;  1WEE A;  3HCS A;  4L7X A;  1LDK C;  1FBV A;  2VJF B;  4P5O B;  1BOR A;  3QZV A;  4X3G A;  1X4J A;  2EOD A;  4QF3 A;  3ASL A;  5FB0 A;  5LCW B;  3FL2 A;  5B76 A;  3V43 A;  1Z6U A;  2YSJ A;  3U5O A;  2CKL B;  2FUI A;  3GV4 A;  2E6S A;  3T7L A;  3SOW A;  1T1H A;  2LGV A;  5H9M A;  1CHC A;  2KWN A;  5D1L B;  3KQI A;  3N9O A;  4B7Y C;  1V87 A;  3C5K A;  3LQH A;  2KWJ A;  3O33 A;  2DX8 A;  3O37 A;  3O70 A;  3U5N A;  3HCU A;  2KGG A;  4YAB A;  4YBM A;  4N3W A;  2VPB A;  1WEQ A;  3KV6 A;  2YU4 A;  1WEV A;  4A49 A;  1JM7 A;  2FSA A;  5B79 A;  2K16 A;  4R7E A;  4YAX A;  2E6R A;  2JMJ A;  2ECV A;  5LKU A;  2FUU A;  4FO9 A;  5FER A;  2VPG A;  5G04 B;  4R2Y A;  2LN0 A;  2JMI A;  3MHS A;  1FP0 A;  4LLB A;  4UI9 B;  4WZ2 A;  1ZBD B;  3N9Q A;  5JG6 A;  1HYJ A;  5G05 B;  1HYI A;  2L80 A;  1E4U A;  2VP7 A;  3T6R A;  4GNF A;  3C6W A;  3ZNI A;  4ZUX U;  2MUM A;  2M6M A;  2JRJ A;  5DIN A;  2ZET C;  4QF2 A;  3O7A A;  4V3K C; 
#chains in the Genus database with same CATH topology
 2CON A;  4FIP A;  2E61 A;  4YBT A;  2KE1 A;  3O35 A;  4PTB A;  5TDW A;  5TRB A;  2F42 A;  5SVI A;  3GL6 A;  1JOC A;  5SVX A;  2YSM A;  2M13 A;  2H0D A;  2CRR A;  2YRE A;  5KH7 A;  1F62 A;  1VD4 A;  4MSX A;  2LQ6 A;  3DWD A;  3N9N A;  5J3X A;  2LXH C;  1WEU A;  2B0O E;  2MIQ A;  5B77 A;  2XOZ A;  4GB0 A;  2JMD A;  2YHO A;  2YT5 A;  2LDR A;  4Q6F A;  2ECJ A;  3SHB A;  3LVQ E;  4A4C A;  2XOC A;  2XOY A;  5EYA F;  2KIZ A;  2CRW A;  2LGL A;  5FEY A;  2KFT A;  2KGI A;  1Z60 A;  2M1R A;  3SUB A;  5LKT A;  4BBQ A;  3Q1D A;  4YAD A;  2YHN A;  3ZYQ A;  3ZPV E;  3U5M A;  3VK6 A;  2KWO A;  2QJ0 A;  2KR4 A;  3RPG C;  2C2V S;  2YUC A;  2MNY A;  3PHD A;  2M85 A;  2MD7 B;  2EA6 A;  2EGP A;  5AIU A;  5D1K B;  2VJF A;  1X4U A;  3LQI A;  1VFY A;  3LJU X;  4IC3 A;  2IDA A;  1WE9 A;  3KNV A;  2VJE B;  4GND A;  2LRI C;  3MHH A;  4CCG X;  2Y1N A;  2HDP A;  1WEN A;  2ECN A;  4C9Z A;  2VPE A;  2CKL A;  4CA1 A;  2VPD A;  3L11 A;  5TBN A;  5H1U A;  1DVP A;  4LK9 A;  3DDT A;  3FAN A;  4UP0 A;  2HYE D;  1DCQ A;  3O34 A;  2VNF A;  2PNX A;  3M99 A;  1IYM A;  1WEW A;  1MM3 A;  5G0F A;  3RPG B;  2L5U A;  4A0C D;  2K1J A;  3M63 A;  4YC9 A;  2YQM A;  2XB1 A;  2K4D A;  2G6Q A;  5TDR A;  3HCT A;  1WES A;  4NN2 A;  2LV9 A;  2BAY A;  2ECG A;  4A4B A;  2LAU A;  2KWK A;  5LKX A;  3PUR A;  5I3L A;  2OWA A;  4AYC B;  4Z0R A;  5B78 A;  3N9P A;  4O64 A;  5DKA A;  4OGE A;  2KYU A;  3EB6 A;  4WZ0 A;  5B8D A;  2YVR A;  2P57 A;  2MA5 A;  4LJN A;  4XI1 A;  4GNG A;  2KU3 A;  3T9K A;  3M7K A;  3U5P A;  4GNE A;  4IC2 A;  5H1T A;  2QIZ A;  1RMD A;  4FK5 A;  2QIC A;  2Y1M A;  2YQL A;  2C2L A;  2UZG A;  3PUQ A;  2ECW A;  3M62 A;  2DJA A;  4PPE A;  2XEU A;  4H9D A;  2JUN A;  2D8S A;  3DQV R;  3SOU A;  2LGK A;  5H1V A;  2ECT A;  3FM8 C;  3IHP A;  2JM3 A;  4YBS A;  3LVR E;  3EB5 A;  4WA6 A;  4N4F A;  3DPL R;  2YW8 A;  1MBM A;  1N87 A;  3ZPV 1;  2I50 A;  2M3H A;  2PUY A;  2RR4 A;  2G43 A;  2NAA A;  4AUQ B;  1WGM A;  4LAD B;  1WEO A;  5K3Q A;  1U6G B;  1JM7 B;  2IQJ A;  3RTR B;  4YAT A;  4S3O C;  2MKE A;  3I2D A;  4L58 A;  1MM2 A;  4AVX A;  3NG2 A;  4R8P K;  4W4U A;  4B86 C;  2L75 A;  1G25 A;  3ZVY A;  2F6J A;  1WEP A;  3LQJ A;  1X4I A;  5AIT A;  4ZQL A;  2KRE A;  2LXP C;  2AN6 A;  2DSM A;  5LKZ A;  5TAB A;  2CSV A;  2YUR A;  4LKA A;  1XWH A;  4ZDT A;  2LGG A;  3HTK C;  3L1Z B;  3LRQ A;  4V3L C;  2CT2 A;  2VJE A;  2CSY A;  4I7D A;  4I7B A;  2D8U A;  2ECI A;  3N9M A;  3H7H A;  4AP4 A;  5C11 A;  4S3O B;  2K17 A;  1VYX A;  3FEH A;  5SVI B;  3LDY A;  2MD8 C;  3N9L A;  1WEM A;  2H0D B;  2CSZ A;  2L43 A;  5SVY A;  1WFK A;  2L0B A;  2RI7 A;  5KH9 A;  3ZVZ B;  1WIL A;  4F52 B;  4I7C A;  1K2F A;  2YYR A;  2OXQ C;  5KH3 A;  3SOX A;  1WIM A;  4BHW A;  4WZ3 B;  2MA6 A;  1LDJ B;  2G45 A;  4UP5 A;  5C13 A;  3PLW A;  3FAO A;  3O36 A;  2F6N A;  2MNZ A;  3ZTG A;  1Z2Q A;  2RSD A;  4FJC A;  3KV5 A;  2Y43 A;  4F1P A;  2MT5 A;  5FB1 A;  3L1X A;  4AYC A;  5B75 A;  3KDE C;  5D1M B;  4MVT A;  4TKP B;  3FJU B;  2FD4 A;  1WEE A;  3HCS A;  4L7X A;  1LDK C;  1FBV A;  4OGC A;  2VJF B;  4P5O B;  1BOR A;  3QZV A;  4X3G A;  1X4J A;  2EOD A;  4QF3 A;  3ASL A;  5FB0 A;  5LCW B;  3FL2 A;  5B76 A;  3V43 A;  1Z6U A;  2YSJ A;  3U5O A;  2CKL B;  2FUI A;  2EGM A;  3GV4 A;  2E6S A;  3T7L A;  3SOW A;  1T1H A;  2LGV A;  5H9M A;  1CHC A;  2KWN A;  5D1L B;  3KQI A;  3N9O A;  2FFW A;  4B7Y C;  1V87 A;  4QQ4 A;  3C5K A;  3LQH A;  2KWJ A;  3O33 A;  2DX8 A;  3O37 A;  3O70 A;  3U5N A;  2XP0 A;  3HCU A;  2KGG A;  4YAB A;  4YBM A;  4N3W A;  2VPB A;  1WEQ A;  3KV6 A;  3O47 A;  3JUE A;  2KKX A;  2YU4 A;  1WEV A;  4A49 A;  1JM7 A;  2FSA A;  5B79 A;  2K16 A;  4R7E A;  4YAX A;  2E6R A;  2JMJ A;  2ECV A;  5LKU A;  2FUU A;  4FO9 A;  2L7P A;  5FER A;  2VPG A;  5G04 B;  4R2Y A;  2KKY A;  2LN0 A;  2JMI A;  4O62 A;  3MHS A;  1FP0 A;  4Z0O A;  4LLB A;  4UI9 B;  4WZ2 A;  1ZBD B;  3N9Q A;  5JG6 A;  1HYJ A;  3MDB C;  5G05 B;  1HYI A;  2L80 A;  1E4U A;  2VP7 A;  3T6R A;  4GNF A;  3E2D A;  3C6W A;  3ZNI A;  4ZUX U;  2MUM A;  2M6M A;  2JRJ A;  2EXU A;  5DIN A;  2ZET C;  4QF2 A;  3O7A A;  4V3K C; 
#chains in the Genus database with same CATH homology
 4FIP A;  4YBT A;  2KE1 A;  3O35 A;  4PTB A;  5TDW A;  5TRB A;  2F42 A;  3GL6 A;  1JOC A;  2YSM A;  2H0D A;  2YRE A;  5KH7 A;  1F62 A;  1VD4 A;  4MSX A;  2LQ6 A;  3N9N A;  5J3X A;  2LXH C;  1WEU A;  2MIQ A;  5B77 A;  4GB0 A;  2JMD A;  2YHO A;  2YT5 A;  2LDR A;  4Q6F A;  2ECJ A;  3SHB A;  4A4C A;  5EYA F;  2KIZ A;  2LGL A;  5FEY A;  2KFT A;  2KGI A;  1Z60 A;  2M1R A;  5LKT A;  4BBQ A;  4YAD A;  2YHN A;  3ZYQ A;  3ZPV E;  3U5M A;  3VK6 A;  2KWO A;  2QJ0 A;  2KR4 A;  3RPG C;  2C2V S;  2YUC A;  2MNY A;  3PHD A;  2M85 A;  2MD7 B;  2EA6 A;  2EGP A;  5AIU A;  5D1K B;  2VJF A;  1X4U A;  3LQI A;  1VFY A;  4IC3 A;  2IDA A;  1WE9 A;  3KNV A;  2VJE B;  4GND A;  2LRI C;  3MHH A;  4CCG X;  2Y1N A;  2HDP A;  1WEN A;  2ECN A;  4C9Z A;  2VPE A;  2CKL A;  4CA1 A;  2VPD A;  3L11 A;  5TBN A;  5H1U A;  1DVP A;  4LK9 A;  4UP0 A;  2HYE D;  3O34 A;  2VNF A;  2PNX A;  3M99 A;  1IYM A;  1WEW A;  1MM3 A;  5G0F A;  3RPG B;  2L5U A;  4A0C D;  2K1J A;  3M63 A;  4YC9 A;  2YQM A;  2XB1 A;  2K4D A;  2G6Q A;  5TDR A;  3HCT A;  1WES A;  4NN2 A;  2LV9 A;  2BAY A;  2ECG A;  4A4B A;  2KWK A;  5LKX A;  3PUR A;  5I3L A;  4AYC B;  5B78 A;  3N9P A;  4O64 A;  5DKA A;  5B8D A;  2KYU A;  3EB6 A;  4WZ0 A;  2MA5 A;  4LJN A;  4XI1 A;  4GNG A;  2KU3 A;  3U5P A;  4GNE A;  4IC2 A;  5H1T A;  2QIZ A;  1RMD A;  4FK5 A;  2QIC A;  2Y1M A;  2YQL A;  2C2L A;  2UZG A;  3PUQ A;  2ECW A;  3M62 A;  4PPE A;  2XEU A;  2D8S A;  3DQV R;  3SOU A;  2LGK A;  5H1V A;  2ECT A;  3IHP A;  4YBS A;  3EB5 A;  4WA6 A;  4N4F A;  3DPL R;  2YW8 A;  1N87 A;  3ZPV 1;  2I50 A;  2M3H A;  2PUY A;  2G43 A;  2NAA A;  4AUQ B;  1WGM A;  4LAD B;  1WEO A;  1U6G B;  1JM7 B;  3RTR B;  4YAT A;  4S3O C;  3I2D A;  4L58 A;  1MM2 A;  4AVX A;  3NG2 A;  4R8P K;  4W4U A;  4B86 C;  2L75 A;  1G25 A;  3ZVY A;  2F6J A;  1WEP A;  3LQJ A;  1X4I A;  5AIT A;  4ZQL A;  2KRE A;  2LXP C;  2AN6 A;  5LKZ A;  5TAB A;  2YUR A;  4LKA A;  1XWH A;  4ZDT A;  2LGG A;  3HTK C;  3L1Z B;  3LRQ A;  4V3L C;  2CT2 A;  2VJE A;  2CSY A;  4I7D A;  4I7B A;  2ECI A;  3N9M A;  4AP4 A;  5C11 A;  4S3O B;  2K17 A;  1VYX A;  2MD8 C;  3N9L A;  1WEM A;  2H0D B;  2CSZ A;  2L43 A;  1WFK A;  2L0B A;  2RI7 A;  5KH9 A;  3ZVZ B;  1WIL A;  4F52 B;  4I7C A;  1K2F A;  2YYR A;  2OXQ C;  5KH3 A;  3SOX A;  1WIM A;  4BHW A;  4WZ3 B;  2MA6 A;  1LDJ B;  2G45 A;  4UP5 A;  5C13 A;  3O36 A;  2F6N A;  2MNZ A;  3ZTG A;  1Z2Q A;  2RSD A;  3KV5 A;  4FJC A;  2Y43 A;  2MT5 A;  5FB1 A;  3L1X A;  4AYC A;  5B75 A;  5D1M B;  4MVT A;  4TKP B;  1WEE A;  3HCS A;  4L7X A;  1LDK C;  1FBV A;  2VJF B;  4P5O B;  1BOR A;  3QZV A;  4X3G A;  1X4J A;  2EOD A;  4QF3 A;  3ASL A;  5FB0 A;  5LCW B;  3FL2 A;  5B76 A;  3V43 A;  1Z6U A;  2YSJ A;  3U5O A;  2CKL B;  2FUI A;  3GV4 A;  2E6S A;  3T7L A;  3SOW A;  1T1H A;  2LGV A;  5H9M A;  1CHC A;  2KWN A;  5D1L B;  3KQI A;  3N9O A;  4B7Y C;  1V87 A;  3C5K A;  3LQH A;  2KWJ A;  3O33 A;  2DX8 A;  3O37 A;  3O70 A;  3U5N A;  3HCU A;  2KGG A;  4YAB A;  4YBM A;  4N3W A;  2VPB A;  1WEQ A;  3KV6 A;  2YU4 A;  1WEV A;  4A49 A;  1JM7 A;  2FSA A;  5B79 A;  2K16 A;  4R7E A;  4YAX A;  2E6R A;  2JMJ A;  2ECV A;  5LKU A;  2FUU A;  4FO9 A;  5FER A;  2VPG A;  5G04 B;  4R2Y A;  2LN0 A;  2JMI A;  3MHS A;  1FP0 A;  4LLB A;  4UI9 B;  4WZ2 A;  1ZBD B;  3N9Q A;  5JG6 A;  1HYJ A;  5G05 B;  1HYI A;  2L80 A;  1E4U A;  2VP7 A;  3T6R A;  4GNF A;  3C6W A;  3ZNI A;  4ZUX U;  2MUM A;  2M6M A;  2JRJ A;  5DIN A;  2ZET C;  4QF2 A;  3O7A A;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...