2LGLA

Nmr structure of the uhrf1 phd domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 8
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lglA00
1DVPA 2BAYA 1WEOA 2QIZA 2YW8A 2NAAA 3IHPA 2KGGA 5FB0A 1JM7B 2MA6A 4P5OB 3L1ZB 1CHCA 4V3LC 1LDJB 2MD8C 2VJEB 4GNDA 2E6SA 2VNFA 5AITA 4R2YA 2KWNA 3O33A 4YATA 2M3HA 4CCGX 2KU3A 2IDAA 2CSZA 4UP5A 3FL2A 5H1TA 1WEMA 3PURA 1Z6UA 3O36A 5KH7A 2QICA 1WGMA 5LKXA 3L1XA 3I2DA 2L43A 4WA6A 2ECVA 2VJEA 2H0DB 4PPEA 2FSAA 4F52B 2L75A 1VD4A 4YAXA 1E4UA 1HYIA 4BHWA 4LKAA 2G43A 3M63A 2G45A 3N9PA 1U6GB 1Z2QA 2YREA 4XI1A 4ZUXU 2LGLA 5TDRA 2H0DA 2K1JA 1JOCA 2G6QA 1X4IA 3O37A 2CKLB 4GB0A 4R8PK 3T7LA 4IC2A 3ASLA 3LQIA 1FBVA 4AVXA 4FO9A 4QF2A 4ZQLA 1WEUA 2ECWA 2MIQA 2ECNA 3U5NA 1ZBDB 1N87A 3N9OA 2M6MA 5AIUA 4WZ2A 2EODA 3KV6A 2VPEA 2YSMA 5H9MA 1BORA 4N3WA 2VPBA 4LK9A 3QZVA 5B8DA 3VK6A 2CKLA 4B7YC 1WEPA 2XEUA 4S3OB 3U5MA 1XWHA 3EB5A 1F62A 2YU4A 2LRIC 2D8SA 2LGGA 3ZYQA 2ECIA 4LLBA 2KR4A 3SOWA 2ECTA 4YBMA 4A49A 2JMIA 1Z60A 4AYCB 2CSYA 2YHOA 5FEYA 5TBNA 2LGKA 4X3GA 4AUQB 1WENA 2F6NA 4B86C 1JM7A 3O35A 3HCSA 2MNZA 3ZVYA 2K4DA 4MVTA 2VJFB 2L5UA 4UI9B 3SOUA 4L58A 2KWOA 4CA1A 3NG2A 3N9NA 2LDRA 1T1HA 2AN6A 5LKZA 2KFTA 4AYCA 5B77A 3U5OA 4N4FA 4BBQA 4I7DA 3DQVR 3L11A 2YSJA 1WEWA 3KQIA 2PUYA 5LKUA 3RTRB 2YURA 2HYED 2VJFA 2F6JA 2MD7B 2HDPA 2QJ0A 4A4CA 5G04B 5TRBA 3MHHA 3RPGC 2ECJA 5KH9A 3KV5A 4L7XA 3N9MA 2CT2A 4WZ0A 2LGVA 1IYMA 1WFKA 3O7AA 1V87A 1WEEA 2Y43A 4C9ZA 3SOXA 1WIMA 1MM2A 5LCWB 3ZPVE 3LQJA 3DPLR 4V3KC 3ZTGA 4FJCA 4GNGA 2KWKA 4YBSA 4TKPB 2YQMA 3U5PA 4FK5A 3EB6A 3V43A 2KIZA 2YT5A 5DKAA 2DX8A 3PUQA 2F42A 3ZPV1 2JMJA 2M85A 5H1VA 1RMDA 2KYUA 4R7EA 2LQ6A 2EGPA 4GNEA 2Y1NA 4I7CA 3O70A 4NN2A 1WE9A 4A4BA 5C11A 2L80A 4YADA 3MHSA 2VPDA 1G25A 2JRJA 2MT5A 2ZETC 2C2VS 5TDWA 3M99A 3KNVA 2L0BA 5J3XA 2FUIA 5FB1A 2VPGA 5TABA 3N9LA 1WESA 4UP0A 1VFYA 4W4UA 4LJNA 1X4UA 3ZVZB 3O34A 3LQHA 3HTKC 2C2LA 2Y1MA 5G0FA 3ZNIA 3HCUA 1WEQA 1MM3A 5D1MB 2I50A 2RSDA 2YYRA 4YBTA 2UZGA 5B75A 2LXPC 4AP4A 4WZ3B 4I7BA 3N9QA 5DINA 5B78A 1LDKC 2MNYA 1FP0A 2JMDA 2KGIA 4MSXA 5D1KB 4LADB 3C5KA 4ZDTA 4O64A 3T6RA 5H1UA 3LRQA 5JG6A 3RPGB 1X4JA 2OXQC 2XB1A 3HCTA 5G05B 3C6WA 2LN0A 4GNFA 5B76A 4Q6FA 3PHDA 5I3LA 2VP7A 2EA6A 4A0CD 4YABA 2LV9A 1K2FA 2K17A 2YQLA 4QF3A 5C13A 5KH3A 5FERA 4IC3A 1WEVA 2E6RA 5D1LB 4FIPA 2RI7A 1VYXA 2KE1A 2LXHC 2PNXA 3SHBA 2ECGA 2MA5A 5LKTA 2KWJA 1WILA 4PTBA 2FUUA 5B79A 4S3OC 4YC9A 1HYJA 2YHNA 2M1RA 2MUMA 3GV4A 5EYAF 3GL6A 2KREA 2K16A 3M62A 2YUCA
chains in the Genus database with same CATH superfamily
1DVPA 2BAYA 1WEOA 2QIZA 2YW8A 2NAAA 3IHPA 2KGGA 5FB0A 1JM7B 2MA6A 4P5OB 3L1ZB 1CHCA 4V3LC 3O47A 1LDJB 2XOYA 2MD8C 2VJEB 4GNDA 2E6SA 2VNFA 5AITA 4R2YA 2KWNA 3O33A 4YATA 2M3HA 4CCGX 2KU3A 2IDAA 2CSZA 4UP5A 3FL2A 2XP0A 5H1TA 1WEMA 3PURA 1Z6UA 2EXUA 3O36A 2KKXA 5KH7A 2QICA 3FJUB 1WGMA 5LKXA 3L1XA 3I2DA 2DJAA 2XOZA 2L43A 4WA6A 2ECVA 2L7PA 2VJEA 4O62A 2H0DB 4PPEA 3KDEC 3E2DA 2P57A 2FSAA 4F52B 2L75A 1VD4A 4YAXA 1E4UA 1HYIA 4BHWA 4LKAA 3SUBA 2G43A 3M63A 2G45A 3N9PA 1U6GB 2JM3A 1Z2QA 2YREA 4XI1A 4ZUXU 2LGLA 2MKEA 5TDRA 2H0DA 2K1JA 1JOCA 2G6QA 1X4IA 3O37A 2CKLB 4GB0A 4R8PK 3T7LA 4IC2A 3ASLA 3LQIA 1FBVA 4AVXA 4FO9A 4QF2A 4ZQLA 1WEUA 2RR4A 2ECWA 2MIQA 2ECNA 3U5NA 1ZBDB 1N87A 3N9OA 2M6MA 2B0OE 5AIUA 4WZ2A 2EODA 3KV6A 3Q1DA 2VPEA 2YSMA 5H9MA 1BORA 4N3WA 2VPBA 4LK9A 3QZVA 5B8DA 3VK6A 2CKLA 4B7YC 1WEPA 2DSMA 2XEUA 4S3OB 3U5MA 1XWHA 3EB5A 1F62A 2YU4A 2LRIC 1DCQA 2D8SA 2LGGA 3ZYQA 2ECIA 4LLBA 3PLWA 2KR4A 3SOWA 2ECTA 4YBMA 4A49A 2JMIA 1Z60A 4AYCB 2JUNA 2CSYA 2YHOA 3FANA 4OGCA 5FEYA 5TBNA 2LGKA 4X3GA 4AUQB 1WENA 2F6NA 3MDBC 4B86C 1JM7A 3O35A 3HCSA 2OWAA 2MNZA 3LJUX 3ZVYA 2FD4A 2K4DA 4MVTA 4OGEA 2VJFB 2L5UA 4UI9B 3SOUA 4L58A 2KWOA 4CA1A 3NG2A 3N9NA 2LDRA 1T1HA 2AN6A 5LKZA 2KFTA 4AYCA 5B77A 3U5OA 4N4FA 4BBQA 4I7DA 3DQVR 3L11A 2YSJA 1WEWA 3KQIA 2PUYA 5LKUA 2K16A 2YURA 3RTRB 2HYED 2VJFA 3H7HA 2F6JA 2MD7B 2HDPA 1MBMA 2QJ0A 4A4CA 5G04B 5TRBA 3MHHA 3RPGC 2ECJA 5KH9A 3KV5A 4L7XA 3N9MA 4H9DA 2CT2A 4WZ0A 2LGVA 1IYMA 1WFKA 3O7AA 1V87A 1WEEA 2Y43A 4C9ZA 3SOXA 1WIMA 1MM2A 5LCWB 3ZPVE 3LQJA 3DPLR 4V3KC 3ZTGA 5SVIB 4FJCA 3DDTA 4GNGA 3T9KA 2KWKA 4YBSA 4TKPB 2YQMA 3U5PA 4FK5A 3DWDA 3EB6A 3V43A 2KIZA 2XOCA 2YT5A 5DKAA 2DX8A 3FAOA 3PUQA 2F42A 3ZPV1 2JMJA 2M85A 5H1VA 1RMDA 2KYUA 4R7EA 2LQ6A 2EGPA 5SVIA 4F1PA 3LVRE 4GNEA 2Y1NA 4I7CA 3O70A 4NN2A 1WE9A 4A4BA 5C11A 2L80A 4YADA 3MHSA 2VPDA 1G25A 2JRJA 2MT5A 2ZETC 2C2VS 3FEHA 5TDWA 5SVXA 2CRRA 3M99A 3KNVA 2L0BA 5J3XA 2FUIA 5FB1A 2VPGA 5TABA 3N9LA 1WESA 4UP0A 1VFYA 2IQJA 4W4UA 3LDYA 4LJNA 1X4UA 3ZVZB 2EGMA 2LAUA 3FM8C 3O34A 3LQHA 3HTKC 2C2LA 2Y1MA 5G0FA 3ZNIA 3HCUA 1WEQA 1MM3A 5D1MB 2I50A 2RSDA 2YYRA 2CONA 4YBTA 2UZGA 5B75A 2LXPC 4AP4A 4WZ3B 4I7BA 4QQ4A 3N9QA 5DINA 3LVQE 5B78A 1LDKC 2MNYA 1FP0A 2FFWA 2JMDA 2KGIA 4MSXA 5D1KB 2E61A 4LADB 3C5KA 4ZDTA 4O64A 3T6RA 5H1UA 3LRQA 4Z0OA 5JG6A 3RPGB 1X4JA 2OXQC 2D8UA 2XB1A 3HCTA 2CSVA 5G05B 3C6WA 2LN0A 4GNFA 5B76A 4Q6FA 3PHDA 3M7KA 2M13A 5I3LA 2VP7A 2EA6A 4A0CD 5SVYA 4YABA 2LV9A 1K2FA 2K17A 2YQLA 3JUEA 4QF3A 5C13A 5KH3A 5FERA 4IC3A 1WEVA 2E6RA 5D1LB 4FIPA 2YVRA 2RI7A 1VYXA 2KE1A 2LXHC 2PNXA 3SHBA 2ECGA 2MA5A 4Z0RA 2CRWA 5LKTA 2KWJA 1WILA 4PTBA 2FUUA 5K3QA 5B79A 4S3OC 4YC9A 1HYJA 2YHNA 2M1RA 2MUMA 3GV4A 5EYAF 3GL6A 2KREA 2KKYA 3M62A 2YUCA
chains in the Genus database with same CATH topology
1DVPA 2BAYA 1WEOA 2QIZA 2YW8A 2NAAA 3IHPA 2KGGA 5FB0A 1JM7B 2MA6A 4P5OB 3L1ZB 1CHCA 4V3LC 1LDJB 2MD8C 2VJEB 4GNDA 2E6SA 2VNFA 5AITA 4R2YA 2KWNA 3O33A 4YATA 2M3HA 4CCGX 2KU3A 2IDAA 2CSZA 4UP5A 3FL2A 5H1TA 1WEMA 3PURA 1Z6UA 3O36A 5KH7A 2QICA 1WGMA 5LKXA 3L1XA 3I2DA 2L43A 4WA6A 2ECVA 2VJEA 2H0DB 4PPEA 2FSAA 4F52B 2L75A 1VD4A 4YAXA 1E4UA 1HYIA 4BHWA 4LKAA 2G43A 3M63A 2G45A 3N9PA 1U6GB 1Z2QA 2YREA 4XI1A 4ZUXU 2LGLA 5TDRA 2H0DA 2K1JA 1JOCA 2G6QA 1X4IA 3O37A 2CKLB 4GB0A 4R8PK 3T7LA 4IC2A 3ASLA 3LQIA 1FBVA 4AVXA 4FO9A 4QF2A 4ZQLA 1WEUA 2ECWA 2MIQA 2ECNA 3U5NA 1ZBDB 1N87A 3N9OA 2M6MA 5AIUA 4WZ2A 2EODA 3KV6A 2VPEA 2YSMA 5H9MA 1BORA 4N3WA 2VPBA 4LK9A 3QZVA 5B8DA 3VK6A 2CKLA 4B7YC 1WEPA 2XEUA 4S3OB 3U5MA 1XWHA 3EB5A 1F62A 2YU4A 2LRIC 2D8SA 2LGGA 3ZYQA 2ECIA 4LLBA 2KR4A 3SOWA 2ECTA 4YBMA 4A49A 2JMIA 1Z60A 4AYCB 2CSYA 2YHOA 5FEYA 5TBNA 2LGKA 4X3GA 4AUQB 1WENA 2F6NA 4B86C 1JM7A 3O35A 3HCSA 2MNZA 3ZVYA 2K4DA 4MVTA 2VJFB 2L5UA 4UI9B 3SOUA 4L58A 2KWOA 4CA1A 3NG2A 3N9NA 2LDRA 1T1HA 2AN6A 5LKZA 2KFTA 4AYCA 5B77A 3U5OA 4N4FA 4BBQA 4I7DA 3DQVR 3L11A 2YSJA 1WEWA 3KQIA 2PUYA 5LKUA 3RTRB 2YURA 2HYED 2VJFA 2F6JA 2MD7B 2HDPA 2QJ0A 4A4CA 5G04B 5TRBA 3MHHA 3RPGC 2ECJA 5KH9A 3KV5A 4L7XA 3N9MA 2CT2A 4WZ0A 2LGVA 1IYMA 1WFKA 3O7AA 1V87A 1WEEA 2Y43A 4C9ZA 3SOXA 1WIMA 1MM2A 5LCWB 3ZPVE 3LQJA 3DPLR 4V3KC 3ZTGA 4FJCA 4GNGA 2KWKA 4YBSA 4TKPB 2YQMA 3U5PA 4FK5A 3EB6A 3V43A 2KIZA 2YT5A 5DKAA 2DX8A 3PUQA 2F42A 3ZPV1 2JMJA 2M85A 5H1VA 1RMDA 2KYUA 4R7EA 2LQ6A 2EGPA 4GNEA 2Y1NA 4I7CA 3O70A 4NN2A 1WE9A 4A4BA 5C11A 2L80A 4YADA 3MHSA 2VPDA 1G25A 2JRJA 2MT5A 2ZETC 2C2VS 5TDWA 3M99A 3KNVA 2L0BA 5J3XA 2FUIA 5FB1A 2VPGA 5TABA 3N9LA 1WESA 4UP0A 1VFYA 4W4UA 4LJNA 1X4UA 3ZVZB 3O34A 3LQHA 3HTKC 2C2LA 2Y1MA 5G0FA 3ZNIA 3HCUA 1WEQA 1MM3A 5D1MB 2I50A 2RSDA 2YYRA 4YBTA 2UZGA 5B75A 2LXPC 4AP4A 4WZ3B 4I7BA 3N9QA 5DINA 5B78A 1LDKC 2MNYA 1FP0A 2JMDA 2KGIA 4MSXA 5D1KB 4LADB 3C5KA 4ZDTA 4O64A 3T6RA 5H1UA 3LRQA 5JG6A 3RPGB 1X4JA 2OXQC 2XB1A 3HCTA 5G05B 3C6WA 2LN0A 4GNFA 5B76A 4Q6FA 3PHDA 5I3LA 2VP7A 2EA6A 4A0CD 4YABA 2LV9A 1K2FA 2K17A 2YQLA 4QF3A 5C13A 5KH3A 5FERA 4IC3A 1WEVA 2E6RA 5D1LB 4FIPA 2RI7A 1VYXA 2KE1A 2LXHC 2PNXA 3SHBA 2ECGA 2MA5A 5LKTA 2KWJA 1WILA 4PTBA 2FUUA 5B79A 4S3OC 4YC9A 1HYJA 2YHNA 2M1RA 2MUMA 3GV4A 5EYAF 3GL6A 2KREA 2K16A 3M62A 2YUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVP A;  2BAY A;  1WEO A;  2QIZ A;  2YW8 A;  2NAA A;  3IHP A;  2KGG A;  5FB0 A;  1JM7 B;  2MA6 A;  4P5O B;  3L1Z B;  1CHC A;  4V3L C;  1LDJ B;  2MD8 C;  2VJE B;  4GND A;  2E6S A;  2VNF A;  5AIT A;  4R2Y A;  2KWN A;  3O33 A;  4YAT A;  2M3H A;  4CCG X;  2KU3 A;  2IDA A;  2CSZ A;  4UP5 A;  3FL2 A;  5H1T A;  1WEM A;  3PUR A;  1Z6U A;  3O36 A;  5KH7 A;  2QIC A;  1WGM A;  5LKX A;  3L1X A;  3I2D A;  2L43 A;  4WA6 A;  2ECV A;  2VJE A;  2H0D B;  4PPE A;  2FSA A;  4F52 B;  2L75 A;  1VD4 A;  4YAX A;  1E4U A;  1HYI A;  4BHW A;  4LKA A;  2G43 A;  3M63 A;  2G45 A;  3N9P A;  1U6G B;  1Z2Q A;  2YRE A;  4XI1 A;  4ZUX U;  2LGL A;  5TDR A;  2H0D A;  2K1J A;  1JOC A;  2G6Q A;  1X4I A;  3O37 A;  2CKL B;  4GB0 A;  4R8P K;  3T7L A;  4IC2 A;  3ASL A;  3LQI A;  1FBV A;  4AVX A;  4FO9 A;  4QF2 A;  4ZQL A;  1WEU A;  2ECW A;  2MIQ A;  2ECN A;  3U5N A;  1ZBD B;  1N87 A;  3N9O A;  2M6M A;  5AIU A;  4WZ2 A;  2EOD A;  3KV6 A;  2VPE A;  2YSM A;  5H9M A;  1BOR A;  4N3W A;  2VPB A;  4LK9 A;  3QZV A;  5B8D A;  3VK6 A;  2CKL A;  4B7Y C;  1WEP A;  2XEU A;  4S3O B;  3U5M A;  1XWH A;  3EB5 A;  1F62 A;  2YU4 A;  2LRI C;  2D8S A;  2LGG A;  3ZYQ A;  2ECI A;  4LLB A;  2KR4 A;  3SOW A;  2ECT A;  4YBM A;  4A49 A;  2JMI A;  1Z60 A;  4AYC B;  2CSY A;  2YHO A;  5FEY A;  5TBN A;  2LGK A;  4X3G A;  4AUQ B;  1WEN A;  2F6N A;  4B86 C;  1JM7 A;  3O35 A;  3HCS A;  2MNZ A;  3ZVY A;  2K4D A;  4MVT A;  2VJF B;  2L5U A;  4UI9 B;  3SOU A;  4L58 A;  2KWO A;  4CA1 A;  3NG2 A;  3N9N A;  2LDR A;  1T1H A;  2AN6 A;  5LKZ A;  2KFT A;  4AYC A;  5B77 A;  3U5O A;  4N4F A;  4BBQ A;  4I7D A;  3DQV R;  3L11 A;  2YSJ A;  1WEW A;  3KQI A;  2PUY A;  5LKU A;  3RTR B;  2YUR A;  2HYE D;  2VJF A;  2F6J A;  2MD7 B;  2HDP A;  2QJ0 A;  4A4C A;  5G04 B;  5TRB A;  3MHH A;  3RPG C;  2ECJ A;  5KH9 A;  3KV5 A;  4L7X A;  3N9M A;  2CT2 A;  4WZ0 A;  2LGV A;  1IYM A;  1WFK A;  3O7A A;  1V87 A;  1WEE A;  2Y43 A;  4C9Z A;  3SOX A;  1WIM A;  1MM2 A;  5LCW B;  3ZPV E;  3LQJ A;  3DPL R;  4V3K C;  3ZTG A;  4FJC A;  4GNG A;  2KWK A;  4YBS A;  4TKP B;  2YQM A;  3U5P A;  4FK5 A;  3EB6 A;  3V43 A;  2KIZ A;  2YT5 A;  5DKA A;  2DX8 A;  3PUQ A;  2F42 A;  3ZPV 1;  2JMJ A;  2M85 A;  5H1V A;  1RMD A;  2KYU A;  4R7E A;  2LQ6 A;  2EGP A;  4GNE A;  2Y1N A;  4I7C A;  3O70 A;  4NN2 A;  1WE9 A;  4A4B A;  5C11 A;  2L80 A;  4YAD A;  3MHS A;  2VPD A;  1G25 A;  2JRJ A;  2MT5 A;  2ZET C;  2C2V S;  5TDW A;  3M99 A;  3KNV A;  2L0B A;  5J3X A;  2FUI A;  5FB1 A;  2VPG A;  5TAB A;  3N9L A;  1WES A;  4UP0 A;  1VFY A;  4W4U A;  4LJN A;  1X4U A;  3ZVZ B;  3O34 A;  3LQH A;  3HTK C;  2C2L A;  2Y1M A;  5G0F A;  3ZNI A;  3HCU A;  1WEQ A;  1MM3 A;  5D1M B;  2I50 A;  2RSD A;  2YYR A;  4YBT A;  2UZG A;  5B75 A;  2LXP C;  4AP4 A;  4WZ3 B;  4I7B A;  3N9Q A;  5DIN A;  5B78 A;  1LDK C;  2MNY A;  1FP0 A;  2JMD A;  2KGI A;  4MSX A;  5D1K B;  4LAD B;  3C5K A;  4ZDT A;  4O64 A;  3T6R A;  5H1U A;  3LRQ A;  5JG6 A;  3RPG B;  1X4J A;  2OXQ C;  2XB1 A;  3HCT A;  5G05 B;  3C6W A;  2LN0 A;  4GNF A;  5B76 A;  4Q6F A;  3PHD A;  5I3L A;  2VP7 A;  2EA6 A;  4A0C D;  4YAB A;  2LV9 A;  1K2F A;  2K17 A;  2YQL A;  4QF3 A;  5C13 A;  5KH3 A;  5FER A;  4IC3 A;  1WEV A;  2E6R A;  5D1L B;  4FIP A;  2RI7 A;  1VYX A;  2KE1 A;  2LXH C;  2PNX A;  3SHB A;  2ECG A;  2MA5 A;  5LKT A;  2KWJ A;  1WIL A;  4PTB A;  2FUU A;  5B79 A;  4S3O C;  4YC9 A;  1HYJ A;  2YHN A;  2M1R A;  2MUM A;  3GV4 A;  5EYA F;  3GL6 A;  2KRE A;  2K16 A;  3M62 A;  2YUC A; 
#chains in the Genus database with same CATH topology
 1DVP A;  2BAY A;  1WEO A;  2QIZ A;  2YW8 A;  2NAA A;  3IHP A;  2KGG A;  5FB0 A;  1JM7 B;  2MA6 A;  4P5O B;  3L1Z B;  1CHC A;  4V3L C;  3O47 A;  1LDJ B;  2XOY A;  2MD8 C;  2VJE B;  4GND A;  2E6S A;  2VNF A;  5AIT A;  4R2Y A;  2KWN A;  3O33 A;  4YAT A;  2M3H A;  4CCG X;  2KU3 A;  2IDA A;  2CSZ A;  4UP5 A;  3FL2 A;  2XP0 A;  5H1T A;  1WEM A;  3PUR A;  1Z6U A;  2EXU A;  3O36 A;  2KKX A;  5KH7 A;  2QIC A;  3FJU B;  1WGM A;  5LKX A;  3L1X A;  3I2D A;  2DJA A;  2XOZ A;  2L43 A;  4WA6 A;  2ECV A;  2L7P A;  2VJE A;  4O62 A;  2H0D B;  4PPE A;  3KDE C;  3E2D A;  2P57 A;  2FSA A;  4F52 B;  2L75 A;  1VD4 A;  4YAX A;  1E4U A;  1HYI A;  4BHW A;  4LKA A;  3SUB A;  2G43 A;  3M63 A;  2G45 A;  3N9P A;  1U6G B;  2JM3 A;  1Z2Q A;  2YRE A;  4XI1 A;  4ZUX U;  2LGL A;  2MKE A;  5TDR A;  2H0D A;  2K1J A;  1JOC A;  2G6Q A;  1X4I A;  3O37 A;  2CKL B;  4GB0 A;  4R8P K;  3T7L A;  4IC2 A;  3ASL A;  3LQI A;  1FBV A;  4AVX A;  4FO9 A;  4QF2 A;  4ZQL A;  1WEU A;  2RR4 A;  2ECW A;  2MIQ A;  2ECN A;  3U5N A;  1ZBD B;  1N87 A;  3N9O A;  2M6M A;  2B0O E;  5AIU A;  4WZ2 A;  2EOD A;  3KV6 A;  3Q1D A;  2VPE A;  2YSM A;  5H9M A;  1BOR A;  4N3W A;  2VPB A;  4LK9 A;  3QZV A;  5B8D A;  3VK6 A;  2CKL A;  4B7Y C;  1WEP A;  2DSM A;  2XEU A;  4S3O B;  3U5M A;  1XWH A;  3EB5 A;  1F62 A;  2YU4 A;  2LRI C;  1DCQ A;  2D8S A;  2LGG A;  3ZYQ A;  2ECI A;  4LLB A;  3PLW A;  2KR4 A;  3SOW A;  2ECT A;  4YBM A;  4A49 A;  2JMI A;  1Z60 A;  4AYC B;  2JUN A;  2CSY A;  2YHO A;  3FAN A;  4OGC A;  5FEY A;  5TBN A;  2LGK A;  4X3G A;  4AUQ B;  1WEN A;  2F6N A;  3MDB C;  4B86 C;  1JM7 A;  3O35 A;  3HCS A;  2OWA A;  2MNZ A;  3LJU X;  3ZVY A;  2FD4 A;  2K4D A;  4MVT A;  4OGE A;  2VJF B;  2L5U A;  4UI9 B;  3SOU A;  4L58 A;  2KWO A;  4CA1 A;  3NG2 A;  3N9N A;  2LDR A;  1T1H A;  2AN6 A;  5LKZ A;  2KFT A;  4AYC A;  5B77 A;  3U5O A;  4N4F A;  4BBQ A;  4I7D A;  3DQV R;  3L11 A;  2YSJ A;  1WEW A;  3KQI A;  2PUY A;  5LKU A;  2K16 A;  2YUR A;  3RTR B;  2HYE D;  2VJF A;  3H7H A;  2F6J A;  2MD7 B;  2HDP A;  1MBM A;  2QJ0 A;  4A4C A;  5G04 B;  5TRB A;  3MHH A;  3RPG C;  2ECJ A;  5KH9 A;  3KV5 A;  4L7X A;  3N9M A;  4H9D A;  2CT2 A;  4WZ0 A;  2LGV A;  1IYM A;  1WFK A;  3O7A A;  1V87 A;  1WEE A;  2Y43 A;  4C9Z A;  3SOX A;  1WIM A;  1MM2 A;  5LCW B;  3ZPV E;  3LQJ A;  3DPL R;  4V3K C;  3ZTG A;  5SVI B;  4FJC A;  3DDT A;  4GNG A;  3T9K A;  2KWK A;  4YBS A;  4TKP B;  2YQM A;  3U5P A;  4FK5 A;  3DWD A;  3EB6 A;  3V43 A;  2KIZ A;  2XOC A;  2YT5 A;  5DKA A;  2DX8 A;  3FAO A;  3PUQ A;  2F42 A;  3ZPV 1;  2JMJ A;  2M85 A;  5H1V A;  1RMD A;  2KYU A;  4R7E A;  2LQ6 A;  2EGP A;  5SVI A;  4F1P A;  3LVR E;  4GNE A;  2Y1N A;  4I7C A;  3O70 A;  4NN2 A;  1WE9 A;  4A4B A;  5C11 A;  2L80 A;  4YAD A;  3MHS A;  2VPD A;  1G25 A;  2JRJ A;  2MT5 A;  2ZET C;  2C2V S;  3FEH A;  5TDW A;  5SVX A;  2CRR A;  3M99 A;  3KNV A;  2L0B A;  5J3X A;  2FUI A;  5FB1 A;  2VPG A;  5TAB A;  3N9L A;  1WES A;  4UP0 A;  1VFY A;  2IQJ A;  4W4U A;  3LDY A;  4LJN A;  1X4U A;  3ZVZ B;  2EGM A;  2LAU A;  3FM8 C;  3O34 A;  3LQH A;  3HTK C;  2C2L A;  2Y1M A;  5G0F A;  3ZNI A;  3HCU A;  1WEQ A;  1MM3 A;  5D1M B;  2I50 A;  2RSD A;  2YYR A;  2CON A;  4YBT A;  2UZG A;  5B75 A;  2LXP C;  4AP4 A;  4WZ3 B;  4I7B A;  4QQ4 A;  3N9Q A;  5DIN A;  3LVQ E;  5B78 A;  1LDK C;  2MNY A;  1FP0 A;  2FFW A;  2JMD A;  2KGI A;  4MSX A;  5D1K B;  2E61 A;  4LAD B;  3C5K A;  4ZDT A;  4O64 A;  3T6R A;  5H1U A;  3LRQ A;  4Z0O A;  5JG6 A;  3RPG B;  1X4J A;  2OXQ C;  2D8U A;  2XB1 A;  3HCT A;  2CSV A;  5G05 B;  3C6W A;  2LN0 A;  4GNF A;  5B76 A;  4Q6F A;  3PHD A;  3M7K A;  2M13 A;  5I3L A;  2VP7 A;  2EA6 A;  4A0C D;  5SVY A;  4YAB A;  2LV9 A;  1K2F A;  2K17 A;  2YQL A;  3JUE A;  4QF3 A;  5C13 A;  5KH3 A;  5FER A;  4IC3 A;  1WEV A;  2E6R A;  5D1L B;  4FIP A;  2YVR A;  2RI7 A;  1VYX A;  2KE1 A;  2LXH C;  2PNX A;  3SHB A;  2ECG A;  2MA5 A;  4Z0R A;  2CRW A;  5LKT A;  2KWJ A;  1WIL A;  4PTB A;  2FUU A;  5K3Q A;  5B79 A;  4S3O C;  4YC9 A;  1HYJ A;  2YHN A;  2M1R A;  2MUM A;  3GV4 A;  5EYA F;  3GL6 A;  2KRE A;  2KKY A;  3M62 A;  2YUC A; 
#chains in the Genus database with same CATH homology
 1DVP A;  2BAY A;  1WEO A;  2QIZ A;  2YW8 A;  2NAA A;  3IHP A;  2KGG A;  5FB0 A;  1JM7 B;  2MA6 A;  4P5O B;  3L1Z B;  1CHC A;  4V3L C;  1LDJ B;  2MD8 C;  2VJE B;  4GND A;  2E6S A;  2VNF A;  5AIT A;  4R2Y A;  2KWN A;  3O33 A;  4YAT A;  2M3H A;  4CCG X;  2KU3 A;  2IDA A;  2CSZ A;  4UP5 A;  3FL2 A;  5H1T A;  1WEM A;  3PUR A;  1Z6U A;  3O36 A;  5KH7 A;  2QIC A;  1WGM A;  5LKX A;  3L1X A;  3I2D A;  2L43 A;  4WA6 A;  2ECV A;  2VJE A;  2H0D B;  4PPE A;  2FSA A;  4F52 B;  2L75 A;  1VD4 A;  4YAX A;  1E4U A;  1HYI A;  4BHW A;  4LKA A;  2G43 A;  3M63 A;  2G45 A;  3N9P A;  1U6G B;  1Z2Q A;  2YRE A;  4XI1 A;  4ZUX U;  2LGL A;  5TDR A;  2H0D A;  2K1J A;  1JOC A;  2G6Q A;  1X4I A;  3O37 A;  2CKL B;  4GB0 A;  4R8P K;  3T7L A;  4IC2 A;  3ASL A;  3LQI A;  1FBV A;  4AVX A;  4FO9 A;  4QF2 A;  4ZQL A;  1WEU A;  2ECW A;  2MIQ A;  2ECN A;  3U5N A;  1ZBD B;  1N87 A;  3N9O A;  2M6M A;  5AIU A;  4WZ2 A;  2EOD A;  3KV6 A;  2VPE A;  2YSM A;  5H9M A;  1BOR A;  4N3W A;  2VPB A;  4LK9 A;  3QZV A;  5B8D A;  3VK6 A;  2CKL A;  4B7Y C;  1WEP A;  2XEU A;  4S3O B;  3U5M A;  1XWH A;  3EB5 A;  1F62 A;  2YU4 A;  2LRI C;  2D8S A;  2LGG A;  3ZYQ A;  2ECI A;  4LLB A;  2KR4 A;  3SOW A;  2ECT A;  4YBM A;  4A49 A;  2JMI A;  1Z60 A;  4AYC B;  2CSY A;  2YHO A;  5FEY A;  5TBN A;  2LGK A;  4X3G A;  4AUQ B;  1WEN A;  2F6N A;  4B86 C;  1JM7 A;  3O35 A;  3HCS A;  2MNZ A;  3ZVY A;  2K4D A;  4MVT A;  2VJF B;  2L5U A;  4UI9 B;  3SOU A;  4L58 A;  2KWO A;  4CA1 A;  3NG2 A;  3N9N A;  2LDR A;  1T1H A;  2AN6 A;  5LKZ A;  2KFT A;  4AYC A;  5B77 A;  3U5O A;  4N4F A;  4BBQ A;  4I7D A;  3DQV R;  3L11 A;  2YSJ A;  1WEW A;  3KQI A;  2PUY A;  5LKU A;  3RTR B;  2YUR A;  2HYE D;  2VJF A;  2F6J A;  2MD7 B;  2HDP A;  2QJ0 A;  4A4C A;  5G04 B;  5TRB A;  3MHH A;  3RPG C;  2ECJ A;  5KH9 A;  3KV5 A;  4L7X A;  3N9M A;  2CT2 A;  4WZ0 A;  2LGV A;  1IYM A;  1WFK A;  3O7A A;  1V87 A;  1WEE A;  2Y43 A;  4C9Z A;  3SOX A;  1WIM A;  1MM2 A;  5LCW B;  3ZPV E;  3LQJ A;  3DPL R;  4V3K C;  3ZTG A;  4FJC A;  4GNG A;  2KWK A;  4YBS A;  4TKP B;  2YQM A;  3U5P A;  4FK5 A;  3EB6 A;  3V43 A;  2KIZ A;  2YT5 A;  5DKA A;  2DX8 A;  3PUQ A;  2F42 A;  3ZPV 1;  2JMJ A;  2M85 A;  5H1V A;  1RMD A;  2KYU A;  4R7E A;  2LQ6 A;  2EGP A;  4GNE A;  2Y1N A;  4I7C A;  3O70 A;  4NN2 A;  1WE9 A;  4A4B A;  5C11 A;  2L80 A;  4YAD A;  3MHS A;  2VPD A;  1G25 A;  2JRJ A;  2MT5 A;  2ZET C;  2C2V S;  5TDW A;  3M99 A;  3KNV A;  2L0B A;  5J3X A;  2FUI A;  5FB1 A;  2VPG A;  5TAB A;  3N9L A;  1WES A;  4UP0 A;  1VFY A;  4W4U A;  4LJN A;  1X4U A;  3ZVZ B;  3O34 A;  3LQH A;  3HTK C;  2C2L A;  2Y1M A;  5G0F A;  3ZNI A;  3HCU A;  1WEQ A;  1MM3 A;  5D1M B;  2I50 A;  2RSD A;  2YYR A;  4YBT A;  2UZG A;  5B75 A;  2LXP C;  4AP4 A;  4WZ3 B;  4I7B A;  3N9Q A;  5DIN A;  5B78 A;  1LDK C;  2MNY A;  1FP0 A;  2JMD A;  2KGI A;  4MSX A;  5D1K B;  4LAD B;  3C5K A;  4ZDT A;  4O64 A;  3T6R A;  5H1U A;  3LRQ A;  5JG6 A;  3RPG B;  1X4J A;  2OXQ C;  2XB1 A;  3HCT A;  5G05 B;  3C6W A;  2LN0 A;  4GNF A;  5B76 A;  4Q6F A;  3PHD A;  5I3L A;  2VP7 A;  2EA6 A;  4A0C D;  4YAB A;  2LV9 A;  1K2F A;  2K17 A;  2YQL A;  4QF3 A;  5C13 A;  5KH3 A;  5FER A;  4IC3 A;  1WEV A;  2E6R A;  5D1L B;  4FIP A;  2RI7 A;  1VYX A;  2KE1 A;  2LXH C;  2PNX A;  3SHB A;  2ECG A;  2MA5 A;  5LKT A;  2KWJ A;  1WIL A;  4PTB A;  2FUU A;  5B79 A;  4S3O C;  4YC9 A;  1HYJ A;  2YHN A;  2M1R A;  2MUM A;  3GV4 A;  5EYA F;  3GL6 A;  2KRE A;  2K16 A;  3M62 A;  2YUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...