2C2VS

Crystal structure of the chip-ubc13-uev1a complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Ubiquitin-conjugating enzyme E2 N
total genus 15
structure length 74
sequence length 74
chains with identical sequence T, U, V
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2vS00
2PNXA 2E6RA 1BORA 2LGLA 3LQJA 3M63A 4AYCA 3ZNIA 2VJEA 4UP5A 4N3WA 5KH7A 5G0FA 2VPDA 2Y43A 2D8SA 4N4FA 1WIMA 3O34A 5DKAA 5G04B 2K16A 4YAXA 2CSYA 1JM7B 2EODA 4YBMA 5DINA 4AYCB 3ASLA 4YBTA 3DQVR 2YU4A 4CCGX 1V87A 2ECIA 3U5PA 1X4UA 1WGMA 2ECJA 2MD7B 4LADB 4C9ZA 1FBVA 2H0DB 5D1MB 3KNVA 4I7DA 1F62A 1VFYA 3PURA 1E4UA 2KIZA 1IYMA 4XI1A 2MA6A 4V3LC 4GNFA 1X4IA 2YSMA 2RI7A 4PTBA 4UI9B 1HYIA 2LGGA 3PHDA 4CA1A 3HCUA 2ECWA 4W4UA 2ECNA 2YYRA 4UP0A 4MVTA 3DPLR 4I7CA 1Z6UA 3I2DA 2PUYA 2KREA 5FEYA 3O70A 4FJCA 5B79A 4R2YA 2KWKA 2L80A 2DX8A 3RTRB 2KGGA 1WEUA 2KYUA 3HCTA 4IC2A 5FB1A 3GV4A 2LDRA 1LDJB 2LGVA 3U5NA 5B8DA 2NAAA 2CT2A 4L7XA 1VYXA 5C11A 3VK6A 3L1XA 2JRJA 3M62A 1G25A 1U6GB 2LN0A 3ZVYA 2K17A 2BAYA 2VJFB 3N9QA 5LKTA 2EGPA 2Y1NA 2KGIA 2VPBA 4FO9A 5TABA 2CSZA 4LJNA 2YUCA 2M1RA 3T7LA 3U5OA 5D1KB 4WA6A 2KWNA 5LCWB 2HDPA 3ZYQA 3L11A 2ECTA 4FK5A 2KE1A 4TKPB 3RPGB 5LKZA 5B76A 2KR4A 2ECGA 5H9MA 2M85A 3ZPVE 3SOXA 2E6SA 1Z2QA 3SHBA 2F42A 5KH9A 2VNFA 2L5UA 3N9MA 5AIUA 2HYED 1ZBDB 2VJFA 1K2FA 4LKAA 1XWHA 2K1JA 2LV9A 2L43A 2G6QA 4YBSA 1WEMA 4S3OB 2JMIA 4PPEA 2JMJA 2MNZA 1WEOA 4YATA 5TDWA 2ECVA 4A0CD 4IC3A 2MD8C 3NG2A 2F6NA 3T6RA 4GNEA 3M99A 4Q6FA 1WESA 3ZTGA 1Z60A 2ZETC 4MSXA 4BHWA 1MM2A 3O7AA 3QZVA 2QICA 5G05B 1HYJA 5KH3A 4R8PK 2KWJA 2XB1A 2CKLB 2L0BA 3SOWA 2M3HA 3V43A 5B77A 3N9NA 1RMDA 3O36A 5C13A 5EYAF 1WE9A 3O35A 2MT5A 4YABA 5H1TA 4P5OB 2FSAA 3HTKC 4AVXA 5AITA 2IDAA 2I50A 1WEWA 4LLBA 3N9LA 2OXQC 2QJ0A 2LXPC 3RPGC 4ZDTA 4YC9A 4B7YC 2MIQA 1N87A 1T1HA 4X3GA 4AP4A 4B86C 2MUMA 2VPEA 3FL2A 4YADA 5JG6A 3O37A 4GNGA 3LQIA 3U5MA 4WZ0A 1CHCA 5J3XA 3L1ZB 2CKLA 2F6JA 1WEVA 2H0DA 2VP7A 2EA6A 2L75A 1FP0A 4WZ2A 5H1VA 5B75A 5LKUA 2YHOA 2XEUA 2LRIC 4S3OC 4A4BA 1WILA 2VPGA 3KV6A 2YW8A 3ZPV1 2LGKA 3N9PA 1JOCA 1VD4A 2YREA 2VJEB 5H1UA 2FUUA 3MHSA 2K4DA 2MA5A 3O33A 5B78A 2AN6A 2Y1MA 5LKXA 2LQ6A 4A49A 4L58A 1JM7A 4V3KC 5FB0A 2YQMA 1WFKA 2G45A 1MM3A 2YURA 2C2VS 2M6MA 3MHHA 4LK9A 2YHNA 3C5KA 4WZ3B 3EB5A 1LDKC 2YSJA 3LRQA 3LQHA 4I7BA 1DVPA 2LXHC 4QF2A 3ZVZB 1WENA 4QF3A 4GNDA 2MNYA 4AUQB 1X4JA 3N9OA 5D1LB 2KU3A 2UZGA 4R7EA 4ZUXU 2KWOA 2KFTA 2QIZA 5TDRA 4ZQLA 2RSDA 1WEPA 2YQLA 3HCSA 4BBQA 1WEEA 5TBNA 4GB0A 4NN2A 2FUIA 3GL6A 4F52B 5TRBA 3PUQA 5I3LA 4FIPA 1WEQA 4A4CA 3KQIA 3C6WA 5FERA 2JMDA 3KV5A 3SOUA 2YT5A 3EB6A 2G43A 3IHPA 2C2LA 4O64A
chains in the Genus database with same CATH superfamily
2PNXA 2E6RA 1BORA 2LGLA 3LQJA 2XOZA 3M63A 4AYCA 2FD4A 3ZNIA 2VJEA 4UP5A 4N3WA 5KH7A 5G0FA 2VPDA 2Y43A 2D8SA 2IQJA 3DDTA 4N4FA 1WIMA 3O34A 5DKAA 5G04B 2K16A 4YAXA 2CSYA 1JM7B 2EODA 4YBMA 5DINA 4AYCB 3ASLA 4YBTA 3DQVR 2YU4A 4CCGX 1V87A 2ECIA 3U5PA 1X4UA 1WGMA 4O62A 2ECJA 2MD7B 4LADB 4C9ZA 1FBVA 2H0DB 5D1MB 5SVIB 3KNVA 4I7DA 1F62A 1VFYA 4H9DA 3PURA 1E4UA 2KIZA 1IYMA 4XI1A 2MA6A 4V3LC 3LVRE 4GNFA 2M13A 1X4IA 2YSMA 3FANA 5SVIA 2RI7A 4PTBA 4UI9B 1HYIA 2LGGA 3MDBC 3PHDA 4CA1A 3HCUA 3SUBA 2ECWA 2OWAA 4W4UA 2ECNA 2YYRA 4UP0A 4MVTA 3DPLR 4I7CA 1Z6UA 2CRRA 3I2DA 3KDEC 2PUYA 2KREA 5FEYA 3O70A 4QQ4A 4FJCA 5B79A 3T9KA 4R2YA 2KWKA 2L80A 3DWDA 2DX8A 2EGMA 3RTRB 2KGGA 3H7HA 1WEUA 2KYUA 3HCTA 4IC2A 5FB1A 3GV4A 2LDRA 1LDJB 2LGVA 3U5NA 5B8DA 2NAAA 2CT2A 3FM8C 4L7XA 1VYXA 5C11A 3VK6A 3L1XA 2JRJA 3M62A 1G25A 1U6GB 1DCQA 2LN0A 3ZVYA 2K17A 2BAYA 2VJFB 3N9QA 5LKTA 2EGPA 2Y1NA 2KGIA 2VPBA 4FO9A 5TABA 2CSZA 4LJNA 2YUCA 2M1RA 3T7LA 3U5OA 3FEHA 5D1KB 4WA6A 2KWNA 5LCWB 2HDPA 3ZYQA 3L11A 2ECTA 4FK5A 2KE1A 4TKPB 3RPGB 5LKZA 5B76A 2KR4A 3FAOA 2ECGA 5H9MA 2M85A 3ZPVE 3M7KA 3SOXA 2E6SA 1Z2QA 3SHBA 2F42A 5KH9A 2VNFA 2L5UA 3N9MA 5AIUA 2L7PA 2JUNA 2HYED 1ZBDB 1MBMA 1K2FA 2VJFA 4LKAA 1XWHA 2K1JA 2LV9A 2L43A 4OGEA 2E61A 2G6QA 4YBSA 1WEMA 4S3OB 2JMIA 4PPEA 2JMJA 2MNZA 1WEOA 4YATA 5TDWA 2ECVA 2FFWA 4IC3A 4A0CD 2MD8C 3NG2A 2F6NA 2XP0A 3T6RA 2XOYA 4GNEA 3M99A 4Q6FA 2JM3A 2KKXA 1WESA 3ZTGA 1Z60A 2ZETC 4MSXA 4BHWA 1MM2A 3O7AA 3QZVA 2QICA 5G05B 1HYJA 5KH3A 4R8PK 2KWJA 2XB1A 2CKLB 2L0BA 3SOWA 2DJAA 2M3HA 3V43A 5B77A 3N9NA 1RMDA 3O36A 3E2DA 2EXUA 5C13A 5EYAF 1WE9A 3O35A 2D8UA 2B0OE 2MT5A 4YABA 5H1TA 4P5OB 2FSAA 3HTKC 4AVXA 5AITA 2IDAA 2RR4A 2I50A 1WEWA 4LLBA 3N9LA 2OXQC 2QJ0A 2LXPC 3RPGC 4ZDTA 4YC9A 4B7YC 2MIQA 1N87A 1T1HA 4X3GA 4AP4A 4B86C 2MUMA 2VPEA 3FL2A 4YADA 5JG6A 3O37A 5SVXA 4GNGA 3LQIA 3U5MA 4WZ0A 1CHCA 5J3XA 4F1PA 3L1ZB 2CKLA 2F6JA 1WEVA 4OGCA 2CSVA 2H0DA 2VP7A 2EA6A 2L75A 1FP0A 4WZ2A 5H1VA 5B75A 5LKUA 4Z0OA 2YHOA 2XEUA 2XOCA 2LRIC 4S3OC 4A4BA 1WILA 5K3QA 2CRWA 3FJUB 2VPGA 3KV6A 2YW8A 3ZPV1 2LGKA 3N9PA 1JOCA 1VD4A 2YREA 2VJEB 5H1UA 2DSMA 2MKEA 2YVRA 2FUUA 3MHSA 2K4DA 2MA5A 3O33A 5B78A 2AN6A 2Y1MA 5LKXA 2LQ6A 4A49A 4L58A 1JM7A 4V3KC 5SVYA 2CONA 5FB0A 2YQMA 1WFKA 2G45A 1MM3A 2YURA 2C2VS 2M6MA 3LJUX 3MHHA 4LK9A 2YHNA 3C5KA 4WZ3B 3EB5A 2LAUA 1LDKC 2YSJA 3LVQE 3LRQA 3LQHA 4I7BA 1DVPA 2LXHC 4QF2A 3ZVZB 1WENA 3PLWA 4GNDA 4QF3A 2MNYA 4Z0RA 4AUQB 1X4JA 3N9OA 3JUEA 5D1LB 2KU3A 2UZGA 4R7EA 4ZUXU 2KWOA 2KFTA 2P57A 2QIZA 5TDRA 4ZQLA 2RSDA 1WEPA 2YQLA 3HCSA 2KKYA 4BBQA 1WEEA 5TBNA 4GB0A 4NN2A 2FUIA 3GL6A 4F52B 5TRBA 3PUQA 3Q1DA 5I3LA 4FIPA 1WEQA 4A4CA 3KQIA 3C6WA 5FERA 2JMDA 3KV5A 3SOUA 2YT5A 3EB6A 3O47A 3LDYA 2G43A 3IHPA 2C2LA 4O64A
chains in the Genus database with same CATH topology
2PNXA 2E6RA 1BORA 2LGLA 3LQJA 3M63A 4AYCA 3ZNIA 2VJEA 4UP5A 4N3WA 5KH7A 5G0FA 2VPDA 2Y43A 2D8SA 4N4FA 1WIMA 3O34A 5DKAA 5G04B 2K16A 4YAXA 2CSYA 1JM7B 2EODA 4YBMA 5DINA 4AYCB 3ASLA 4YBTA 3DQVR 2YU4A 4CCGX 1V87A 2ECIA 3U5PA 1X4UA 1WGMA 2ECJA 2MD7B 4LADB 4C9ZA 1FBVA 2H0DB 5D1MB 3KNVA 4I7DA 1F62A 1VFYA 3PURA 1E4UA 2KIZA 1IYMA 4XI1A 2MA6A 4V3LC 4GNFA 1X4IA 2YSMA 2RI7A 4PTBA 4UI9B 1HYIA 2LGGA 3PHDA 4CA1A 3HCUA 2ECWA 4W4UA 2ECNA 2YYRA 4UP0A 4MVTA 3DPLR 4I7CA 1Z6UA 3I2DA 2PUYA 2KREA 5FEYA 3O70A 4FJCA 5B79A 4R2YA 2KWKA 2L80A 2DX8A 3RTRB 2KGGA 1WEUA 2KYUA 3HCTA 4IC2A 5FB1A 3GV4A 2LDRA 1LDJB 2LGVA 3U5NA 5B8DA 2NAAA 2CT2A 4L7XA 1VYXA 5C11A 3VK6A 3L1XA 2JRJA 3M62A 1G25A 1U6GB 2LN0A 3ZVYA 2K17A 2BAYA 2VJFB 3N9QA 5LKTA 2EGPA 2Y1NA 2KGIA 2VPBA 4FO9A 5TABA 2CSZA 4LJNA 2YUCA 2M1RA 3T7LA 3U5OA 5D1KB 4WA6A 2KWNA 5LCWB 2HDPA 3ZYQA 3L11A 2ECTA 4FK5A 2KE1A 4TKPB 3RPGB 5LKZA 5B76A 2KR4A 2ECGA 5H9MA 2M85A 3ZPVE 3SOXA 2E6SA 1Z2QA 3SHBA 2F42A 5KH9A 2VNFA 2L5UA 3N9MA 5AIUA 2HYED 1ZBDB 2VJFA 1K2FA 4LKAA 1XWHA 2K1JA 2LV9A 2L43A 2G6QA 4YBSA 1WEMA 4S3OB 2JMIA 4PPEA 2JMJA 2MNZA 1WEOA 4YATA 5TDWA 2ECVA 4A0CD 4IC3A 2MD8C 3NG2A 2F6NA 3T6RA 4GNEA 3M99A 4Q6FA 1WESA 3ZTGA 1Z60A 2ZETC 4MSXA 4BHWA 1MM2A 3O7AA 3QZVA 2QICA 5G05B 1HYJA 5KH3A 4R8PK 2KWJA 2XB1A 2CKLB 2L0BA 3SOWA 2M3HA 3V43A 5B77A 3N9NA 1RMDA 3O36A 5C13A 5EYAF 1WE9A 3O35A 2MT5A 4YABA 5H1TA 4P5OB 2FSAA 3HTKC 4AVXA 5AITA 2IDAA 2I50A 1WEWA 4LLBA 3N9LA 2OXQC 2QJ0A 2LXPC 3RPGC 4ZDTA 4YC9A 4B7YC 2MIQA 1N87A 1T1HA 4X3GA 4AP4A 4B86C 2MUMA 2VPEA 3FL2A 4YADA 5JG6A 3O37A 4GNGA 3LQIA 3U5MA 4WZ0A 1CHCA 5J3XA 3L1ZB 2CKLA 2F6JA 1WEVA 2H0DA 2VP7A 2EA6A 2L75A 1FP0A 4WZ2A 5H1VA 5B75A 5LKUA 2YHOA 2XEUA 2LRIC 4S3OC 4A4BA 1WILA 2VPGA 3KV6A 2YW8A 3ZPV1 2LGKA 3N9PA 1JOCA 1VD4A 2YREA 2VJEB 5H1UA 2FUUA 3MHSA 2K4DA 2MA5A 3O33A 5B78A 2AN6A 2Y1MA 5LKXA 2LQ6A 4A49A 4L58A 1JM7A 4V3KC 5FB0A 2YQMA 1WFKA 2G45A 1MM3A 2YURA 2C2VS 2M6MA 3MHHA 4LK9A 2YHNA 3C5KA 4WZ3B 3EB5A 1LDKC 2YSJA 3LRQA 3LQHA 4I7BA 1DVPA 2LXHC 4QF2A 3ZVZB 1WENA 4QF3A 4GNDA 2MNYA 4AUQB 1X4JA 3N9OA 5D1LB 2KU3A 2UZGA 4R7EA 4ZUXU 2KWOA 2KFTA 2QIZA 5TDRA 4ZQLA 2RSDA 1WEPA 2YQLA 3HCSA 4BBQA 1WEEA 5TBNA 4GB0A 4NN2A 2FUIA 3GL6A 4F52B 5TRBA 3PUQA 5I3LA 4FIPA 1WEQA 4A4CA 3KQIA 3C6WA 5FERA 2JMDA 3KV5A 3SOUA 2YT5A 3EB6A 2G43A 3IHPA 2C2LA 4O64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNX A;  2E6R A;  1BOR A;  2LGL A;  3LQJ A;  3M63 A;  4AYC A;  3ZNI A;  2VJE A;  4UP5 A;  4N3W A;  5KH7 A;  5G0F A;  2VPD A;  2Y43 A;  2D8S A;  4N4F A;  1WIM A;  3O34 A;  5DKA A;  5G04 B;  2K16 A;  4YAX A;  2CSY A;  1JM7 B;  2EOD A;  4YBM A;  5DIN A;  4AYC B;  3ASL A;  4YBT A;  3DQV R;  2YU4 A;  4CCG X;  1V87 A;  2ECI A;  3U5P A;  1X4U A;  1WGM A;  2ECJ A;  2MD7 B;  4LAD B;  4C9Z A;  1FBV A;  2H0D B;  5D1M B;  3KNV A;  4I7D A;  1F62 A;  1VFY A;  3PUR A;  1E4U A;  2KIZ A;  1IYM A;  4XI1 A;  2MA6 A;  4V3L C;  4GNF A;  1X4I A;  2YSM A;  2RI7 A;  4PTB A;  4UI9 B;  1HYI A;  2LGG A;  3PHD A;  4CA1 A;  3HCU A;  2ECW A;  4W4U A;  2ECN A;  2YYR A;  4UP0 A;  4MVT A;  3DPL R;  4I7C A;  1Z6U A;  3I2D A;  2PUY A;  2KRE A;  5FEY A;  3O70 A;  4FJC A;  5B79 A;  4R2Y A;  2KWK A;  2L80 A;  2DX8 A;  3RTR B;  2KGG A;  1WEU A;  2KYU A;  3HCT A;  4IC2 A;  5FB1 A;  3GV4 A;  2LDR A;  1LDJ B;  2LGV A;  3U5N A;  5B8D A;  2NAA A;  2CT2 A;  4L7X A;  1VYX A;  5C11 A;  3VK6 A;  3L1X A;  2JRJ A;  3M62 A;  1G25 A;  1U6G B;  2LN0 A;  3ZVY A;  2K17 A;  2BAY A;  2VJF B;  3N9Q A;  5LKT A;  2EGP A;  2Y1N A;  2KGI A;  2VPB A;  4FO9 A;  5TAB A;  2CSZ A;  4LJN A;  2YUC A;  2M1R A;  3T7L A;  3U5O A;  5D1K B;  4WA6 A;  2KWN A;  5LCW B;  2HDP A;  3ZYQ A;  3L11 A;  2ECT A;  4FK5 A;  2KE1 A;  4TKP B;  3RPG B;  5LKZ A;  5B76 A;  2KR4 A;  2ECG A;  5H9M A;  2M85 A;  3ZPV E;  3SOX A;  2E6S A;  1Z2Q A;  3SHB A;  2F42 A;  5KH9 A;  2VNF A;  2L5U A;  3N9M A;  5AIU A;  2HYE D;  1ZBD B;  2VJF A;  1K2F A;  4LKA A;  1XWH A;  2K1J A;  2LV9 A;  2L43 A;  2G6Q A;  4YBS A;  1WEM A;  4S3O B;  2JMI A;  4PPE A;  2JMJ A;  2MNZ A;  1WEO A;  4YAT A;  5TDW A;  2ECV A;  4A0C D;  4IC3 A;  2MD8 C;  3NG2 A;  2F6N A;  3T6R A;  4GNE A;  3M99 A;  4Q6F A;  1WES A;  3ZTG A;  1Z60 A;  2ZET C;  4MSX A;  4BHW A;  1MM2 A;  3O7A A;  3QZV A;  2QIC A;  5G05 B;  1HYJ A;  5KH3 A;  4R8P K;  2KWJ A;  2XB1 A;  2CKL B;  2L0B A;  3SOW A;  2M3H A;  3V43 A;  5B77 A;  3N9N A;  1RMD A;  3O36 A;  5C13 A;  5EYA F;  1WE9 A;  3O35 A;  2MT5 A;  4YAB A;  5H1T A;  4P5O B;  2FSA A;  3HTK C;  4AVX A;  5AIT A;  2IDA A;  2I50 A;  1WEW A;  4LLB A;  3N9L A;  2OXQ C;  2QJ0 A;  2LXP C;  3RPG C;  4ZDT A;  4YC9 A;  4B7Y C;  2MIQ A;  1N87 A;  1T1H A;  4X3G A;  4AP4 A;  4B86 C;  2MUM A;  2VPE A;  3FL2 A;  4YAD A;  5JG6 A;  3O37 A;  4GNG A;  3LQI A;  3U5M A;  4WZ0 A;  1CHC A;  5J3X A;  3L1Z B;  2CKL A;  2F6J A;  1WEV A;  2H0D A;  2VP7 A;  2EA6 A;  2L75 A;  1FP0 A;  4WZ2 A;  5H1V A;  5B75 A;  5LKU A;  2YHO A;  2XEU A;  2LRI C;  4S3O C;  4A4B A;  1WIL A;  2VPG A;  3KV6 A;  2YW8 A;  3ZPV 1;  2LGK A;  3N9P A;  1JOC A;  1VD4 A;  2YRE A;  2VJE B;  5H1U A;  2FUU A;  3MHS A;  2K4D A;  2MA5 A;  3O33 A;  5B78 A;  2AN6 A;  2Y1M A;  5LKX A;  2LQ6 A;  4A49 A;  4L58 A;  1JM7 A;  4V3K C;  5FB0 A;  2YQM A;  1WFK A;  2G45 A;  1MM3 A;  2YUR A;  2C2V S;  2M6M A;  3MHH A;  4LK9 A;  2YHN A;  3C5K A;  4WZ3 B;  3EB5 A;  1LDK C;  2YSJ A;  3LRQ A;  3LQH A;  4I7B A;  1DVP A;  2LXH C;  4QF2 A;  3ZVZ B;  1WEN A;  4QF3 A;  4GND A;  2MNY A;  4AUQ B;  1X4J A;  3N9O A;  5D1L B;  2KU3 A;  2UZG A;  4R7E A;  4ZUX U;  2KWO A;  2KFT A;  2QIZ A;  5TDR A;  4ZQL A;  2RSD A;  1WEP A;  2YQL A;  3HCS A;  4BBQ A;  1WEE A;  5TBN A;  4GB0 A;  4NN2 A;  2FUI A;  3GL6 A;  4F52 B;  5TRB A;  3PUQ A;  5I3L A;  4FIP A;  1WEQ A;  4A4C A;  3KQI A;  3C6W A;  5FER A;  2JMD A;  3KV5 A;  3SOU A;  2YT5 A;  3EB6 A;  2G43 A;  3IHP A;  2C2L A;  4O64 A; 
#chains in the Genus database with same CATH topology
 2PNX A;  2E6R A;  1BOR A;  2LGL A;  3LQJ A;  2XOZ A;  3M63 A;  4AYC A;  2FD4 A;  3ZNI A;  2VJE A;  4UP5 A;  4N3W A;  5KH7 A;  5G0F A;  2VPD A;  2Y43 A;  2D8S A;  2IQJ A;  3DDT A;  4N4F A;  1WIM A;  3O34 A;  5DKA A;  5G04 B;  2K16 A;  4YAX A;  2CSY A;  1JM7 B;  2EOD A;  4YBM A;  5DIN A;  4AYC B;  3ASL A;  4YBT A;  3DQV R;  2YU4 A;  4CCG X;  1V87 A;  2ECI A;  3U5P A;  1X4U A;  1WGM A;  4O62 A;  2ECJ A;  2MD7 B;  4LAD B;  4C9Z A;  1FBV A;  2H0D B;  5D1M B;  5SVI B;  3KNV A;  4I7D A;  1F62 A;  1VFY A;  4H9D A;  3PUR A;  1E4U A;  2KIZ A;  1IYM A;  4XI1 A;  2MA6 A;  4V3L C;  3LVR E;  4GNF A;  2M13 A;  1X4I A;  2YSM A;  3FAN A;  5SVI A;  2RI7 A;  4PTB A;  4UI9 B;  1HYI A;  2LGG A;  3MDB C;  3PHD A;  4CA1 A;  3HCU A;  3SUB A;  2ECW A;  2OWA A;  4W4U A;  2ECN A;  2YYR A;  4UP0 A;  4MVT A;  3DPL R;  4I7C A;  1Z6U A;  2CRR A;  3I2D A;  3KDE C;  2PUY A;  2KRE A;  5FEY A;  3O70 A;  4QQ4 A;  4FJC A;  5B79 A;  3T9K A;  4R2Y A;  2KWK A;  2L80 A;  3DWD A;  2DX8 A;  2EGM A;  3RTR B;  2KGG A;  3H7H A;  1WEU A;  2KYU A;  3HCT A;  4IC2 A;  5FB1 A;  3GV4 A;  2LDR A;  1LDJ B;  2LGV A;  3U5N A;  5B8D A;  2NAA A;  2CT2 A;  3FM8 C;  4L7X A;  1VYX A;  5C11 A;  3VK6 A;  3L1X A;  2JRJ A;  3M62 A;  1G25 A;  1U6G B;  1DCQ A;  2LN0 A;  3ZVY A;  2K17 A;  2BAY A;  2VJF B;  3N9Q A;  5LKT A;  2EGP A;  2Y1N A;  2KGI A;  2VPB A;  4FO9 A;  5TAB A;  2CSZ A;  4LJN A;  2YUC A;  2M1R A;  3T7L A;  3U5O A;  3FEH A;  5D1K B;  4WA6 A;  2KWN A;  5LCW B;  2HDP A;  3ZYQ A;  3L11 A;  2ECT A;  4FK5 A;  2KE1 A;  4TKP B;  3RPG B;  5LKZ A;  5B76 A;  2KR4 A;  3FAO A;  2ECG A;  5H9M A;  2M85 A;  3ZPV E;  3M7K A;  3SOX A;  2E6S A;  1Z2Q A;  3SHB A;  2F42 A;  5KH9 A;  2VNF A;  2L5U A;  3N9M A;  5AIU A;  2L7P A;  2JUN A;  2HYE D;  1ZBD B;  1MBM A;  1K2F A;  2VJF A;  4LKA A;  1XWH A;  2K1J A;  2LV9 A;  2L43 A;  4OGE A;  2E61 A;  2G6Q A;  4YBS A;  1WEM A;  4S3O B;  2JMI A;  4PPE A;  2JMJ A;  2MNZ A;  1WEO A;  4YAT A;  5TDW A;  2ECV A;  2FFW A;  4IC3 A;  4A0C D;  2MD8 C;  3NG2 A;  2F6N A;  2XP0 A;  3T6R A;  2XOY A;  4GNE A;  3M99 A;  4Q6F A;  2JM3 A;  2KKX A;  1WES A;  3ZTG A;  1Z60 A;  2ZET C;  4MSX A;  4BHW A;  1MM2 A;  3O7A A;  3QZV A;  2QIC A;  5G05 B;  1HYJ A;  5KH3 A;  4R8P K;  2KWJ A;  2XB1 A;  2CKL B;  2L0B A;  3SOW A;  2DJA A;  2M3H A;  3V43 A;  5B77 A;  3N9N A;  1RMD A;  3O36 A;  3E2D A;  2EXU A;  5C13 A;  5EYA F;  1WE9 A;  3O35 A;  2D8U A;  2B0O E;  2MT5 A;  4YAB A;  5H1T A;  4P5O B;  2FSA A;  3HTK C;  4AVX A;  5AIT A;  2IDA A;  2RR4 A;  2I50 A;  1WEW A;  4LLB A;  3N9L A;  2OXQ C;  2QJ0 A;  2LXP C;  3RPG C;  4ZDT A;  4YC9 A;  4B7Y C;  2MIQ A;  1N87 A;  1T1H A;  4X3G A;  4AP4 A;  4B86 C;  2MUM A;  2VPE A;  3FL2 A;  4YAD A;  5JG6 A;  3O37 A;  5SVX A;  4GNG A;  3LQI A;  3U5M A;  4WZ0 A;  1CHC A;  5J3X A;  4F1P A;  3L1Z B;  2CKL A;  2F6J A;  1WEV A;  4OGC A;  2CSV A;  2H0D A;  2VP7 A;  2EA6 A;  2L75 A;  1FP0 A;  4WZ2 A;  5H1V A;  5B75 A;  5LKU A;  4Z0O A;  2YHO A;  2XEU A;  2XOC A;  2LRI C;  4S3O C;  4A4B A;  1WIL A;  5K3Q A;  2CRW A;  3FJU B;  2VPG A;  3KV6 A;  2YW8 A;  3ZPV 1;  2LGK A;  3N9P A;  1JOC A;  1VD4 A;  2YRE A;  2VJE B;  5H1U A;  2DSM A;  2MKE A;  2YVR A;  2FUU A;  3MHS A;  2K4D A;  2MA5 A;  3O33 A;  5B78 A;  2AN6 A;  2Y1M A;  5LKX A;  2LQ6 A;  4A49 A;  4L58 A;  1JM7 A;  4V3K C;  5SVY A;  2CON A;  5FB0 A;  2YQM A;  1WFK A;  2G45 A;  1MM3 A;  2YUR A;  2C2V S;  2M6M A;  3LJU X;  3MHH A;  4LK9 A;  2YHN A;  3C5K A;  4WZ3 B;  3EB5 A;  2LAU A;  1LDK C;  2YSJ A;  3LVQ E;  3LRQ A;  3LQH A;  4I7B A;  1DVP A;  2LXH C;  4QF2 A;  3ZVZ B;  1WEN A;  3PLW A;  4GND A;  4QF3 A;  2MNY A;  4Z0R A;  4AUQ B;  1X4J A;  3N9O A;  3JUE A;  5D1L B;  2KU3 A;  2UZG A;  4R7E A;  4ZUX U;  2KWO A;  2KFT A;  2P57 A;  2QIZ A;  5TDR A;  4ZQL A;  2RSD A;  1WEP A;  2YQL A;  3HCS A;  2KKY A;  4BBQ A;  1WEE A;  5TBN A;  4GB0 A;  4NN2 A;  2FUI A;  3GL6 A;  4F52 B;  5TRB A;  3PUQ A;  3Q1D A;  5I3L A;  4FIP A;  1WEQ A;  4A4C A;  3KQI A;  3C6W A;  5FER A;  2JMD A;  3KV5 A;  3SOU A;  2YT5 A;  3EB6 A;  3O47 A;  3LDY A;  2G43 A;  3IHP A;  2C2L A;  4O64 A; 
#chains in the Genus database with same CATH homology
 2PNX A;  2E6R A;  1BOR A;  2LGL A;  3LQJ A;  3M63 A;  4AYC A;  3ZNI A;  2VJE A;  4UP5 A;  4N3W A;  5KH7 A;  5G0F A;  2VPD A;  2Y43 A;  2D8S A;  4N4F A;  1WIM A;  3O34 A;  5DKA A;  5G04 B;  2K16 A;  4YAX A;  2CSY A;  1JM7 B;  2EOD A;  4YBM A;  5DIN A;  4AYC B;  3ASL A;  4YBT A;  3DQV R;  2YU4 A;  4CCG X;  1V87 A;  2ECI A;  3U5P A;  1X4U A;  1WGM A;  2ECJ A;  2MD7 B;  4LAD B;  4C9Z A;  1FBV A;  2H0D B;  5D1M B;  3KNV A;  4I7D A;  1F62 A;  1VFY A;  3PUR A;  1E4U A;  2KIZ A;  1IYM A;  4XI1 A;  2MA6 A;  4V3L C;  4GNF A;  1X4I A;  2YSM A;  2RI7 A;  4PTB A;  4UI9 B;  1HYI A;  2LGG A;  3PHD A;  4CA1 A;  3HCU A;  2ECW A;  4W4U A;  2ECN A;  2YYR A;  4UP0 A;  4MVT A;  3DPL R;  4I7C A;  1Z6U A;  3I2D A;  2PUY A;  2KRE A;  5FEY A;  3O70 A;  4FJC A;  5B79 A;  4R2Y A;  2KWK A;  2L80 A;  2DX8 A;  3RTR B;  2KGG A;  1WEU A;  2KYU A;  3HCT A;  4IC2 A;  5FB1 A;  3GV4 A;  2LDR A;  1LDJ B;  2LGV A;  3U5N A;  5B8D A;  2NAA A;  2CT2 A;  4L7X A;  1VYX A;  5C11 A;  3VK6 A;  3L1X A;  2JRJ A;  3M62 A;  1G25 A;  1U6G B;  2LN0 A;  3ZVY A;  2K17 A;  2BAY A;  2VJF B;  3N9Q A;  5LKT A;  2EGP A;  2Y1N A;  2KGI A;  2VPB A;  4FO9 A;  5TAB A;  2CSZ A;  4LJN A;  2YUC A;  2M1R A;  3T7L A;  3U5O A;  5D1K B;  4WA6 A;  2KWN A;  5LCW B;  2HDP A;  3ZYQ A;  3L11 A;  2ECT A;  4FK5 A;  2KE1 A;  4TKP B;  3RPG B;  5LKZ A;  5B76 A;  2KR4 A;  2ECG A;  5H9M A;  2M85 A;  3ZPV E;  3SOX A;  2E6S A;  1Z2Q A;  3SHB A;  2F42 A;  5KH9 A;  2VNF A;  2L5U A;  3N9M A;  5AIU A;  2HYE D;  1ZBD B;  2VJF A;  1K2F A;  4LKA A;  1XWH A;  2K1J A;  2LV9 A;  2L43 A;  2G6Q A;  4YBS A;  1WEM A;  4S3O B;  2JMI A;  4PPE A;  2JMJ A;  2MNZ A;  1WEO A;  4YAT A;  5TDW A;  2ECV A;  4A0C D;  4IC3 A;  2MD8 C;  3NG2 A;  2F6N A;  3T6R A;  4GNE A;  3M99 A;  4Q6F A;  1WES A;  3ZTG A;  1Z60 A;  2ZET C;  4MSX A;  4BHW A;  1MM2 A;  3O7A A;  3QZV A;  2QIC A;  5G05 B;  1HYJ A;  5KH3 A;  4R8P K;  2KWJ A;  2XB1 A;  2CKL B;  2L0B A;  3SOW A;  2M3H A;  3V43 A;  5B77 A;  3N9N A;  1RMD A;  3O36 A;  5C13 A;  5EYA F;  1WE9 A;  3O35 A;  2MT5 A;  4YAB A;  5H1T A;  4P5O B;  2FSA A;  3HTK C;  4AVX A;  5AIT A;  2IDA A;  2I50 A;  1WEW A;  4LLB A;  3N9L A;  2OXQ C;  2QJ0 A;  2LXP C;  3RPG C;  4ZDT A;  4YC9 A;  4B7Y C;  2MIQ A;  1N87 A;  1T1H A;  4X3G A;  4AP4 A;  4B86 C;  2MUM A;  2VPE A;  3FL2 A;  4YAD A;  5JG6 A;  3O37 A;  4GNG A;  3LQI A;  3U5M A;  4WZ0 A;  1CHC A;  5J3X A;  3L1Z B;  2CKL A;  2F6J A;  1WEV A;  2H0D A;  2VP7 A;  2EA6 A;  2L75 A;  1FP0 A;  4WZ2 A;  5H1V A;  5B75 A;  5LKU A;  2YHO A;  2XEU A;  2LRI C;  4S3O C;  4A4B A;  1WIL A;  2VPG A;  3KV6 A;  2YW8 A;  3ZPV 1;  2LGK A;  3N9P A;  1JOC A;  1VD4 A;  2YRE A;  2VJE B;  5H1U A;  2FUU A;  3MHS A;  2K4D A;  2MA5 A;  3O33 A;  5B78 A;  2AN6 A;  2Y1M A;  5LKX A;  2LQ6 A;  4A49 A;  4L58 A;  1JM7 A;  4V3K C;  5FB0 A;  2YQM A;  1WFK A;  2G45 A;  1MM3 A;  2YUR A;  2C2V S;  2M6M A;  3MHH A;  4LK9 A;  2YHN A;  3C5K A;  4WZ3 B;  3EB5 A;  1LDK C;  2YSJ A;  3LRQ A;  3LQH A;  4I7B A;  1DVP A;  2LXH C;  4QF2 A;  3ZVZ B;  1WEN A;  4QF3 A;  4GND A;  2MNY A;  4AUQ B;  1X4J A;  3N9O A;  5D1L B;  2KU3 A;  2UZG A;  4R7E A;  4ZUX U;  2KWO A;  2KFT A;  2QIZ A;  5TDR A;  4ZQL A;  2RSD A;  1WEP A;  2YQL A;  3HCS A;  4BBQ A;  1WEE A;  5TBN A;  4GB0 A;  4NN2 A;  2FUI A;  3GL6 A;  4F52 B;  5TRB A;  3PUQ A;  5I3L A;  4FIP A;  1WEQ A;  4A4C A;  3KQI A;  3C6W A;  5FER A;  2JMD A;  3KV5 A;  3SOU A;  2YT5 A;  3EB6 A;  2G43 A;  3IHP A;  2C2L A;  4O64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...