2C2VS

Crystal structure of the chip-ubc13-uev1a complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 N
publication title Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 15
structure length 74
sequence length 74
chains with identical sequence T, U, V
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2vS00
2CSYA 5FERA 2M85A 2FUUA 2VPGA 2FSAA 1FP0A 2LGVA 3RPGC 2CT2A 5G04B 1U6GB 2L0BA 2E6SA 3N9MA 3KV5A 5H1VA 4C9ZA 3T6RA 4R7EA 4L58A 2YSJA 3GL6A 4YC9A 3PURA 2ECJA 1VFYA 4NN2A 1WEUA 5C13A 3HTKC 4AVXA 2G6QA 2DX8A 2YUCA 4UP0A 4UP5A 4FIPA 2L43A 4WZ0A 1V87A 4I7CA 2VJFB 2ECVA 2KWKA 4FK5A 4P5OB 3I2DA 4S3OC 2LRIC 2EGPA 2KFTA 2UZGA 2MNZA 1JOCA 1WEPA 2MUMA 4WZ2A 3U5PA 1MM3A 1WEVA 4V3LC 4B7YC 4PTBA 4YBMA 2NAAA 3MHHA 2MA5A 2YYRA 2YURA 5H9MA 2JMDA 2KYUA 2XEUA 3M63A 3VK6A 5C11A 2OXQC 4N4FA 4W4UA 3KNVA 1LDKC 3N9NA 3RTRB 4F52B 1WENA 3QZVA 5B78A 2MA6A 4GB0A 4AYCB 4LADB 2FUIA 3HCSA 1T1HA 5EYAF 4QF3A 1N87A 3RPGB 4YATA 5D1MB 5TDWA 2VP7A 2F6JA 4YAXA 2JRJA 4XI1A 4ZUXU 3DPLR 2KE1A 5TDRA 5G05B 2G43A 2ZETC 2YHNA 5KH9A 4LK9A 2KWJA 1HYIA 5LKTA 3FL2A 4ZDTA 3EB6A 5B76A 4IC3A 4N3WA 1CHCA 4MSXA 1IYMA 5JG6A 1Z2QA 3ZPV1 2G45A 2ECIA 4GNFA 2LQ6A 5B77A 2ECGA 4ZQLA 2CSZA 3M99A 3O70A 2RI7A 5KH3A 2PNXA 1MM2A 4YADA 5FB1A 4BHWA 3O35A 2MT5A 2ECNA 2IDAA 3L1XA 4TKPB 1WFKA 1WEQA 3N9LA 5AITA 3C5KA 4FJCA 2L80A 2XB1A 3ZTGA 3N9QA 4YBTA 1F62A 2KIZA 2K1JA 3EB5A 4YBSA 2VJEB 1VYXA 1DVPA 2L75A 2YQLA 5LKZA 5DKAA 2CKLA 4A4BA 4CA1A 3LQHA 2E6RA 2YHOA 3KQIA 1WEMA 2K17A 4Q6FA 2KWNA 4V3KC 3O33A 3DQVR 3ZYQA 2EODA 4GNDA 1WEEA 1X4JA 3N9OA 3MHSA 4B86C 2QJ0A 2LGGA 2D8SA 2H0DA 2KR4A 2RSDA 1JM7A 2YQMA 2ECTA 2LXPC 1VD4A 3ZNIA 2YU4A 2MD8C 2M3HA 4WA6A 2LGKA 3M62A 3N9PA 1G25A 2C2LA 3SOXA 1WESA 2F6NA 3PHDA 4I7BA 5AIUA 4L7XA 2KGIA 3ASLA 2KREA 5FB0A 2LN0A 2LXHC 2PUYA 2VNFA 4R2YA 3PUQA 2YREA 3ZPVE 2QIZA 5DINA 2JMJA 4AP4A 3SOUA 4A4CA 3U5NA 5LKUA 1E4UA 2C2VS 5TABA 3KV6A 4BBQA 4O64A 3T7LA 2LV9A 3GV4A 2KU3A 3NG2A 1RMDA 3U5OA 5B79A 4LJNA 5H1TA 2VPDA 5H1UA 5TRBA 2VPBA 5FEYA 3L11A 2VJFA 4S3OB 3HCTA 1Z6UA 2BAYA 5D1KB 3SOWA 2L5UA 2EA6A 3LRQA 3ZVZB 4R8PK 4GNGA 4I7DA 5I3LA 2YT5A 4UI9B 1WGMA 3O37A 4FO9A 3L1ZB 3C6WA 3U5MA 3HCUA 4QF2A 2QICA 3LQJA 4CCGX 1XWHA 2KGGA 4A49A 1Z60A 1LDJB 2Y1NA 2HYED 5D1LB 4IC2A 3IHPA 3ZVYA 2F42A 3SHBA 4AYCA 4PPEA 2MD7B 2Y43A 4MVTA 2I50A 1HYJA 1FBVA 1BORA 5TBNA 1WEWA 5G0FA 2M6MA 4AUQB 2CKLB 2JMIA 5LCWB 4GNEA 1ZBDB 2MIQA 5J3XA 2AN6A 5KH7A 1X4IA 3V43A 4X3GA 4LLBA 5LKXA 1WIMA 1WE9A 2LDRA 4WZ3B 2YW8A 1X4UA 3O34A 4A0CD 2K16A 1WEOA 4YABA 3LQIA 2Y1MA 2H0DB 2ECWA 1K2FA 5B75A 1JM7B 2MNYA 2HDPA 2VPEA 3O7AA 2YSMA 2LGLA 1WILA 2VJEA 5B8DA 4LKAA 2K4DA 2M1RA 3O36A 2KWOA
chains in the Genus database with same CATH superfamily
2CSYA 5FERA 2M85A 2CONA 2FUUA 2VPGA 2FSAA 1FP0A 2LGVA 3RPGC 2CT2A 5G04B 1U6GB 2L0BA 2YVRA 2E6SA 3N9MA 3KV5A 5H1VA 3E2DA 4C9ZA 3T6RA 4R7EA 4L58A 2YSJA 3GL6A 2EXUA 4YC9A 3PURA 2ECJA 1VFYA 3LVRE 4NN2A 3LJUX 1WEUA 5C13A 3HTKC 5SVYA 4AVXA 2G6QA 2DX8A 2KKYA 2XP0A 2YUCA 4UP0A 4UP5A 4FIPA 2L43A 4WZ0A 1V87A 4I7CA 4H9DA 2VJFB 4Z0OA 2ECVA 2KWKA 4FK5A 3SUBA 4P5OB 3I2DA 4S3OC 2LRIC 2EGPA 2KFTA 2UZGA 2MNZA 1JOCA 1WEPA 2MUMA 4WZ2A 3U5PA 1MM3A 1WEVA 4V3LC 4B7YC 4PTBA 4YBMA 2NAAA 3MHHA 2MA5A 2YYRA 2YURA 5H9MA 3JUEA 2JMDA 2KYUA 2XEUA 3FAOA 3M63A 3O47A 3VK6A 3M7KA 5C11A 2OXQC 4N4FA 4W4UA 3FJUB 3KNVA 1LDKC 3N9NA 3RTRB 4F52B 1WENA 3QZVA 5B78A 2MA6A 2CRRA 4GB0A 4AYCB 4LADB 2FUIA 3HCSA 1T1HA 5EYAF 4QF3A 1N87A 3RPGB 4YATA 5D1MB 5TDWA 2VP7A 2DJAA 2F6JA 4YAXA 2JRJA 4XI1A 4ZUXU 3DPLR 2KE1A 5TDRA 5G05B 2G43A 2ZETC 2YHNA 5KH9A 4LK9A 2KWJA 1HYIA 5LKTA 3FL2A 4ZDTA 2CRWA 3EB6A 5B76A 4IC3A 4N3WA 1CHCA 4MSXA 5SVIB 1IYMA 3FANA 2DSMA 2RR4A 2XOZA 5JG6A 1Z2QA 2L7PA 3ZPV1 2G45A 2ECIA 4GNFA 2LQ6A 5B77A 2ECGA 4ZQLA 2IQJA 2CSZA 3M99A 3O70A 2RI7A 5KH3A 2PNXA 1MM2A 4YADA 5FB1A 4BHWA 3O35A 1MBMA 2MT5A 2ECNA 3FM8C 2IDAA 3L1XA 4TKPB 1WFKA 3DDTA 1WEQA 3N9LA 5AITA 3C5KA 4FJCA 2L80A 2XB1A 3ZTGA 3N9QA 2LAUA 4YBTA 1F62A 2KIZA 2K1JA 3FEHA 3EB5A 3LDYA 4YBSA 2VJEB 1VYXA 1DVPA 2L75A 2YQLA 5LKZA 1DCQA 5DKAA 2CKLA 4A4BA 4CA1A 3LQHA 2E6RA 2YHOA 3KQIA 1WEMA 2K17A 4Q6FA 2KWNA 4V3KC 4QQ4A 3O33A 2FD4A 3DQVR 3ZYQA 2EODA 4GNDA 3LVQE 1WEEA 1X4JA 3N9OA 3MHSA 4O62A 4B86C 2QJ0A 2LGGA 2D8SA 2H0DA 2KR4A 2RSDA 1JM7A 2YQMA 3KDEC 3PLWA 2ECTA 2LXPC 1VD4A 3ZNIA 2YU4A 2MD8C 2M3HA 4WA6A 2LGKA 3M62A 3N9PA 1G25A 2C2LA 3SOXA 1WESA 2F6NA 3PHDA 4I7BA 2JUNA 5AIUA 4L7XA 2KGIA 3ASLA 2KREA 5FB0A 2LN0A 2LXHC 2PUYA 2VNFA 4R2YA 3PUQA 2YREA 3ZPVE 2QIZA 5DINA 2JMJA 4AP4A 5K3QA 3SOUA 4A4CA 3U5NA 5LKUA 1E4UA 2C2VS 5TABA 3KV6A 4BBQA 4O64A 3T7LA 2LV9A 3GV4A 2KU3A 3NG2A 4OGEA 1RMDA 3U5OA 5B79A 4LJNA 5H1TA 2VPDA 5H1UA 5TRBA 2VPBA 5FEYA 3L11A 2M13A 2VJFA 3Q1DA 4S3OB 3HCTA 1Z6UA 2BAYA 5D1KB 3SOWA 2XOCA 2L5UA 4OGCA 2EA6A 3DWDA 3LRQA 2EGMA 3ZVZB 4R8PK 4GNGA 4I7DA 5I3LA 2YT5A 5SVXA 4UI9B 1WGMA 3O37A 4FO9A 3L1ZB 2CSVA 4Z0RA 3C6WA 3U5MA 3HCUA 4QF2A 2JM3A 2QICA 3LQJA 4CCGX 1XWHA 2KGGA 4A49A 1Z60A 2OWAA 4F1PA 1LDJB 2Y1NA 2HYED 5D1LB 4IC2A 3IHPA 3ZVYA 2B0OE 2F42A 3SHBA 4AYCA 4PPEA 2MD7B 2D8UA 2Y43A 4MVTA 2I50A 1HYJA 1FBVA 1BORA 5TBNA 1WEWA 5G0FA 2M6MA 4AUQB 2CKLB 2JMIA 5LCWB 4GNEA 1ZBDB 2MKEA 2P57A 2MIQA 2KKXA 5J3XA 2AN6A 5KH7A 1X4IA 3V43A 5SVIA 4X3GA 2XOYA 4LLBA 2E61A 3T9KA 5LKXA 1WIMA 1WE9A 2LDRA 4WZ3B 3MDBC 2YW8A 1X4UA 3O34A 4A0CD 2K16A 1WEOA 4YABA 3LQIA 2Y1MA 2H0DB 2ECWA 1K2FA 5B75A 3H7HA 2FFWA 1JM7B 2MNYA 2HDPA 2VPEA 3O7AA 2YSMA 2LGLA 1WILA 2VJEA 5B8DA 4LKAA 2K4DA 2M1RA 3O36A 2KWOA
chains in the Genus database with same CATH topology
2CSYA 5FERA 2M85A 2FUUA 2VPGA 2FSAA 1FP0A 2LGVA 3RPGC 2CT2A 5G04B 1U6GB 2L0BA 2E6SA 3N9MA 3KV5A 5H1VA 4C9ZA 3T6RA 4R7EA 4L58A 2YSJA 3GL6A 4YC9A 3PURA 2ECJA 1VFYA 4NN2A 1WEUA 5C13A 3HTKC 4AVXA 2G6QA 2DX8A 2YUCA 4UP0A 4UP5A 4FIPA 2L43A 4WZ0A 1V87A 4I7CA 2VJFB 2ECVA 2KWKA 4FK5A 4P5OB 3I2DA 4S3OC 2LRIC 2EGPA 2KFTA 2UZGA 2MNZA 1JOCA 1WEPA 2MUMA 4WZ2A 3U5PA 1MM3A 1WEVA 4V3LC 4B7YC 4PTBA 4YBMA 2NAAA 3MHHA 2MA5A 2YYRA 2YURA 5H9MA 2JMDA 2KYUA 2XEUA 3M63A 3VK6A 5C11A 2OXQC 4N4FA 4W4UA 3KNVA 1LDKC 3N9NA 3RTRB 4F52B 1WENA 3QZVA 5B78A 2MA6A 4GB0A 4AYCB 4LADB 2FUIA 3HCSA 1T1HA 5EYAF 4QF3A 1N87A 3RPGB 4YATA 5D1MB 5TDWA 2VP7A 2F6JA 4YAXA 2JRJA 4XI1A 4ZUXU 3DPLR 2KE1A 5TDRA 5G05B 2G43A 2ZETC 2YHNA 5KH9A 4LK9A 2KWJA 1HYIA 5LKTA 3FL2A 4ZDTA 3EB6A 5B76A 4IC3A 4N3WA 1CHCA 4MSXA 1IYMA 5JG6A 1Z2QA 3ZPV1 2G45A 2ECIA 4GNFA 2LQ6A 5B77A 2ECGA 4ZQLA 2CSZA 3M99A 3O70A 2RI7A 5KH3A 2PNXA 1MM2A 4YADA 5FB1A 4BHWA 3O35A 2MT5A 2ECNA 2IDAA 3L1XA 4TKPB 1WFKA 1WEQA 3N9LA 5AITA 3C5KA 4FJCA 2L80A 2XB1A 3ZTGA 3N9QA 4YBTA 1F62A 2KIZA 2K1JA 3EB5A 4YBSA 2VJEB 1VYXA 1DVPA 2L75A 2YQLA 5LKZA 5DKAA 2CKLA 4A4BA 4CA1A 3LQHA 2E6RA 2YHOA 3KQIA 1WEMA 2K17A 4Q6FA 2KWNA 4V3KC 3O33A 3DQVR 3ZYQA 2EODA 4GNDA 1WEEA 1X4JA 3N9OA 3MHSA 4B86C 2QJ0A 2LGGA 2D8SA 2H0DA 2KR4A 2RSDA 1JM7A 2YQMA 2ECTA 2LXPC 1VD4A 3ZNIA 2YU4A 2MD8C 2M3HA 4WA6A 2LGKA 3M62A 3N9PA 1G25A 2C2LA 3SOXA 1WESA 2F6NA 3PHDA 4I7BA 5AIUA 4L7XA 2KGIA 3ASLA 2KREA 5FB0A 2LN0A 2LXHC 2PUYA 2VNFA 4R2YA 3PUQA 2YREA 3ZPVE 2QIZA 5DINA 2JMJA 4AP4A 3SOUA 4A4CA 3U5NA 5LKUA 1E4UA 2C2VS 5TABA 3KV6A 4BBQA 4O64A 3T7LA 2LV9A 3GV4A 2KU3A 3NG2A 1RMDA 3U5OA 5B79A 4LJNA 5H1TA 2VPDA 5H1UA 5TRBA 2VPBA 5FEYA 3L11A 2VJFA 4S3OB 3HCTA 1Z6UA 2BAYA 5D1KB 3SOWA 2L5UA 2EA6A 3LRQA 3ZVZB 4R8PK 4GNGA 4I7DA 5I3LA 2YT5A 4UI9B 1WGMA 3O37A 4FO9A 3L1ZB 3C6WA 3U5MA 3HCUA 4QF2A 2QICA 3LQJA 4CCGX 1XWHA 2KGGA 4A49A 1Z60A 1LDJB 2Y1NA 2HYED 5D1LB 4IC2A 3IHPA 3ZVYA 2F42A 3SHBA 4AYCA 4PPEA 2MD7B 2Y43A 4MVTA 2I50A 1HYJA 1FBVA 1BORA 5TBNA 1WEWA 5G0FA 2M6MA 4AUQB 2CKLB 2JMIA 5LCWB 4GNEA 1ZBDB 2MIQA 5J3XA 2AN6A 5KH7A 1X4IA 3V43A 4X3GA 4LLBA 5LKXA 1WIMA 1WE9A 2LDRA 4WZ3B 2YW8A 1X4UA 3O34A 4A0CD 2K16A 1WEOA 4YABA 3LQIA 2Y1MA 2H0DB 2ECWA 1K2FA 5B75A 1JM7B 2MNYA 2HDPA 2VPEA 3O7AA 2YSMA 2LGLA 1WILA 2VJEA 5B8DA 4LKAA 2K4DA 2M1RA 3O36A 2KWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSY A;  5FER A;  2M85 A;  2FUU A;  2VPG A;  2FSA A;  1FP0 A;  2LGV A;  3RPG C;  2CT2 A;  5G04 B;  1U6G B;  2L0B A;  2E6S A;  3N9M A;  3KV5 A;  5H1V A;  4C9Z A;  3T6R A;  4R7E A;  4L58 A;  2YSJ A;  3GL6 A;  4YC9 A;  3PUR A;  2ECJ A;  1VFY A;  4NN2 A;  1WEU A;  5C13 A;  3HTK C;  4AVX A;  2G6Q A;  2DX8 A;  2YUC A;  4UP0 A;  4UP5 A;  4FIP A;  2L43 A;  4WZ0 A;  1V87 A;  4I7C A;  2VJF B;  2ECV A;  2KWK A;  4FK5 A;  4P5O B;  3I2D A;  4S3O C;  2LRI C;  2EGP A;  2KFT A;  2UZG A;  2MNZ A;  1JOC A;  1WEP A;  2MUM A;  4WZ2 A;  3U5P A;  1MM3 A;  1WEV A;  4V3L C;  4B7Y C;  4PTB A;  4YBM A;  2NAA A;  3MHH A;  2MA5 A;  2YYR A;  2YUR A;  5H9M A;  2JMD A;  2KYU A;  2XEU A;  3M63 A;  3VK6 A;  5C11 A;  2OXQ C;  4N4F A;  4W4U A;  3KNV A;  1LDK C;  3N9N A;  3RTR B;  4F52 B;  1WEN A;  3QZV A;  5B78 A;  2MA6 A;  4GB0 A;  4AYC B;  4LAD B;  2FUI A;  3HCS A;  1T1H A;  5EYA F;  4QF3 A;  1N87 A;  3RPG B;  4YAT A;  5D1M B;  5TDW A;  2VP7 A;  2F6J A;  4YAX A;  2JRJ A;  4XI1 A;  4ZUX U;  3DPL R;  2KE1 A;  5TDR A;  5G05 B;  2G43 A;  2ZET C;  2YHN A;  5KH9 A;  4LK9 A;  2KWJ A;  1HYI A;  5LKT A;  3FL2 A;  4ZDT A;  3EB6 A;  5B76 A;  4IC3 A;  4N3W A;  1CHC A;  4MSX A;  1IYM A;  5JG6 A;  1Z2Q A;  3ZPV 1;  2G45 A;  2ECI A;  4GNF A;  2LQ6 A;  5B77 A;  2ECG A;  4ZQL A;  2CSZ A;  3M99 A;  3O70 A;  2RI7 A;  5KH3 A;  2PNX A;  1MM2 A;  4YAD A;  5FB1 A;  4BHW A;  3O35 A;  2MT5 A;  2ECN A;  2IDA A;  3L1X A;  4TKP B;  1WFK A;  1WEQ A;  3N9L A;  5AIT A;  3C5K A;  4FJC A;  2L80 A;  2XB1 A;  3ZTG A;  3N9Q A;  4YBT A;  1F62 A;  2KIZ A;  2K1J A;  3EB5 A;  4YBS A;  2VJE B;  1VYX A;  1DVP A;  2L75 A;  2YQL A;  5LKZ A;  5DKA A;  2CKL A;  4A4B A;  4CA1 A;  3LQH A;  2E6R A;  2YHO A;  3KQI A;  1WEM A;  2K17 A;  4Q6F A;  2KWN A;  4V3K C;  3O33 A;  3DQV R;  3ZYQ A;  2EOD A;  4GND A;  1WEE A;  1X4J A;  3N9O A;  3MHS A;  4B86 C;  2QJ0 A;  2LGG A;  2D8S A;  2H0D A;  2KR4 A;  2RSD A;  1JM7 A;  2YQM A;  2ECT A;  2LXP C;  1VD4 A;  3ZNI A;  2YU4 A;  2MD8 C;  2M3H A;  4WA6 A;  2LGK A;  3M62 A;  3N9P A;  1G25 A;  2C2L A;  3SOX A;  1WES A;  2F6N A;  3PHD A;  4I7B A;  5AIU A;  4L7X A;  2KGI A;  3ASL A;  2KRE A;  5FB0 A;  2LN0 A;  2LXH C;  2PUY A;  2VNF A;  4R2Y A;  3PUQ A;  2YRE A;  3ZPV E;  2QIZ A;  5DIN A;  2JMJ A;  4AP4 A;  3SOU A;  4A4C A;  3U5N A;  5LKU A;  1E4U A;  2C2V S;  5TAB A;  3KV6 A;  4BBQ A;  4O64 A;  3T7L A;  2LV9 A;  3GV4 A;  2KU3 A;  3NG2 A;  1RMD A;  3U5O A;  5B79 A;  4LJN A;  5H1T A;  2VPD A;  5H1U A;  5TRB A;  2VPB A;  5FEY A;  3L11 A;  2VJF A;  4S3O B;  3HCT A;  1Z6U A;  2BAY A;  5D1K B;  3SOW A;  2L5U A;  2EA6 A;  3LRQ A;  3ZVZ B;  4R8P K;  4GNG A;  4I7D A;  5I3L A;  2YT5 A;  4UI9 B;  1WGM A;  3O37 A;  4FO9 A;  3L1Z B;  3C6W A;  3U5M A;  3HCU A;  4QF2 A;  2QIC A;  3LQJ A;  4CCG X;  1XWH A;  2KGG A;  4A49 A;  1Z60 A;  1LDJ B;  2Y1N A;  2HYE D;  5D1L B;  4IC2 A;  3IHP A;  3ZVY A;  2F42 A;  3SHB A;  4AYC A;  4PPE A;  2MD7 B;  2Y43 A;  4MVT A;  2I50 A;  1HYJ A;  1FBV A;  1BOR A;  5TBN A;  1WEW A;  5G0F A;  2M6M A;  4AUQ B;  2CKL B;  2JMI A;  5LCW B;  4GNE A;  1ZBD B;  2MIQ A;  5J3X A;  2AN6 A;  5KH7 A;  1X4I A;  3V43 A;  4X3G A;  4LLB A;  5LKX A;  1WIM A;  1WE9 A;  2LDR A;  4WZ3 B;  2YW8 A;  1X4U A;  3O34 A;  4A0C D;  2K16 A;  1WEO A;  4YAB A;  3LQI A;  2Y1M A;  2H0D B;  2ECW A;  1K2F A;  5B75 A;  1JM7 B;  2MNY A;  2HDP A;  2VPE A;  3O7A A;  2YSM A;  2LGL A;  1WIL A;  2VJE A;  5B8D A;  4LKA A;  2K4D A;  2M1R A;  3O36 A;  2KWO A; 
#chains in the Genus database with same CATH topology
 2CSY A;  5FER A;  2M85 A;  2CON A;  2FUU A;  2VPG A;  2FSA A;  1FP0 A;  2LGV A;  3RPG C;  2CT2 A;  5G04 B;  1U6G B;  2L0B A;  2YVR A;  2E6S A;  3N9M A;  3KV5 A;  5H1V A;  3E2D A;  4C9Z A;  3T6R A;  4R7E A;  4L58 A;  2YSJ A;  3GL6 A;  2EXU A;  4YC9 A;  3PUR A;  2ECJ A;  1VFY A;  3LVR E;  4NN2 A;  3LJU X;  1WEU A;  5C13 A;  3HTK C;  5SVY A;  4AVX A;  2G6Q A;  2DX8 A;  2KKY A;  2XP0 A;  2YUC A;  4UP0 A;  4UP5 A;  4FIP A;  2L43 A;  4WZ0 A;  1V87 A;  4I7C A;  4H9D A;  2VJF B;  4Z0O A;  2ECV A;  2KWK A;  4FK5 A;  3SUB A;  4P5O B;  3I2D A;  4S3O C;  2LRI C;  2EGP A;  2KFT A;  2UZG A;  2MNZ A;  1JOC A;  1WEP A;  2MUM A;  4WZ2 A;  3U5P A;  1MM3 A;  1WEV A;  4V3L C;  4B7Y C;  4PTB A;  4YBM A;  2NAA A;  3MHH A;  2MA5 A;  2YYR A;  2YUR A;  5H9M A;  3JUE A;  2JMD A;  2KYU A;  2XEU A;  3FAO A;  3M63 A;  3O47 A;  3VK6 A;  3M7K A;  5C11 A;  2OXQ C;  4N4F A;  4W4U A;  3FJU B;  3KNV A;  1LDK C;  3N9N A;  3RTR B;  4F52 B;  1WEN A;  3QZV A;  5B78 A;  2MA6 A;  2CRR A;  4GB0 A;  4AYC B;  4LAD B;  2FUI A;  3HCS A;  1T1H A;  5EYA F;  4QF3 A;  1N87 A;  3RPG B;  4YAT A;  5D1M B;  5TDW A;  2VP7 A;  2DJA A;  2F6J A;  4YAX A;  2JRJ A;  4XI1 A;  4ZUX U;  3DPL R;  2KE1 A;  5TDR A;  5G05 B;  2G43 A;  2ZET C;  2YHN A;  5KH9 A;  4LK9 A;  2KWJ A;  1HYI A;  5LKT A;  3FL2 A;  4ZDT A;  2CRW A;  3EB6 A;  5B76 A;  4IC3 A;  4N3W A;  1CHC A;  4MSX A;  5SVI B;  1IYM A;  3FAN A;  2DSM A;  2RR4 A;  2XOZ A;  5JG6 A;  1Z2Q A;  2L7P A;  3ZPV 1;  2G45 A;  2ECI A;  4GNF A;  2LQ6 A;  5B77 A;  2ECG A;  4ZQL A;  2IQJ A;  2CSZ A;  3M99 A;  3O70 A;  2RI7 A;  5KH3 A;  2PNX A;  1MM2 A;  4YAD A;  5FB1 A;  4BHW A;  3O35 A;  1MBM A;  2MT5 A;  2ECN A;  3FM8 C;  2IDA A;  3L1X A;  4TKP B;  1WFK A;  3DDT A;  1WEQ A;  3N9L A;  5AIT A;  3C5K A;  4FJC A;  2L80 A;  2XB1 A;  3ZTG A;  3N9Q A;  2LAU A;  4YBT A;  1F62 A;  2KIZ A;  2K1J A;  3FEH A;  3EB5 A;  3LDY A;  4YBS A;  2VJE B;  1VYX A;  1DVP A;  2L75 A;  2YQL A;  5LKZ A;  1DCQ A;  5DKA A;  2CKL A;  4A4B A;  4CA1 A;  3LQH A;  2E6R A;  2YHO A;  3KQI A;  1WEM A;  2K17 A;  4Q6F A;  2KWN A;  4V3K C;  4QQ4 A;  3O33 A;  2FD4 A;  3DQV R;  3ZYQ A;  2EOD A;  4GND A;  3LVQ E;  1WEE A;  1X4J A;  3N9O A;  3MHS A;  4O62 A;  4B86 C;  2QJ0 A;  2LGG A;  2D8S A;  2H0D A;  2KR4 A;  2RSD A;  1JM7 A;  2YQM A;  3KDE C;  3PLW A;  2ECT A;  2LXP C;  1VD4 A;  3ZNI A;  2YU4 A;  2MD8 C;  2M3H A;  4WA6 A;  2LGK A;  3M62 A;  3N9P A;  1G25 A;  2C2L A;  3SOX A;  1WES A;  2F6N A;  3PHD A;  4I7B A;  2JUN A;  5AIU A;  4L7X A;  2KGI A;  3ASL A;  2KRE A;  5FB0 A;  2LN0 A;  2LXH C;  2PUY A;  2VNF A;  4R2Y A;  3PUQ A;  2YRE A;  3ZPV E;  2QIZ A;  5DIN A;  2JMJ A;  4AP4 A;  5K3Q A;  3SOU A;  4A4C A;  3U5N A;  5LKU A;  1E4U A;  2C2V S;  5TAB A;  3KV6 A;  4BBQ A;  4O64 A;  3T7L A;  2LV9 A;  3GV4 A;  2KU3 A;  3NG2 A;  4OGE A;  1RMD A;  3U5O A;  5B79 A;  4LJN A;  5H1T A;  2VPD A;  5H1U A;  5TRB A;  2VPB A;  5FEY A;  3L11 A;  2M13 A;  2VJF A;  3Q1D A;  4S3O B;  3HCT A;  1Z6U A;  2BAY A;  5D1K B;  3SOW A;  2XOC A;  2L5U A;  4OGC A;  2EA6 A;  3DWD A;  3LRQ A;  2EGM A;  3ZVZ B;  4R8P K;  4GNG A;  4I7D A;  5I3L A;  2YT5 A;  5SVX A;  4UI9 B;  1WGM A;  3O37 A;  4FO9 A;  3L1Z B;  2CSV A;  4Z0R A;  3C6W A;  3U5M A;  3HCU A;  4QF2 A;  2JM3 A;  2QIC A;  3LQJ A;  4CCG X;  1XWH A;  2KGG A;  4A49 A;  1Z60 A;  2OWA A;  4F1P A;  1LDJ B;  2Y1N A;  2HYE D;  5D1L B;  4IC2 A;  3IHP A;  3ZVY A;  2B0O E;  2F42 A;  3SHB A;  4AYC A;  4PPE A;  2MD7 B;  2D8U A;  2Y43 A;  4MVT A;  2I50 A;  1HYJ A;  1FBV A;  1BOR A;  5TBN A;  1WEW A;  5G0F A;  2M6M A;  4AUQ B;  2CKL B;  2JMI A;  5LCW B;  4GNE A;  1ZBD B;  2MKE A;  2P57 A;  2MIQ A;  2KKX A;  5J3X A;  2AN6 A;  5KH7 A;  1X4I A;  3V43 A;  5SVI A;  4X3G A;  2XOY A;  4LLB A;  2E61 A;  3T9K A;  5LKX A;  1WIM A;  1WE9 A;  2LDR A;  4WZ3 B;  3MDB C;  2YW8 A;  1X4U A;  3O34 A;  4A0C D;  2K16 A;  1WEO A;  4YAB A;  3LQI A;  2Y1M A;  2H0D B;  2ECW A;  1K2F A;  5B75 A;  3H7H A;  2FFW A;  1JM7 B;  2MNY A;  2HDP A;  2VPE A;  3O7A A;  2YSM A;  2LGL A;  1WIL A;  2VJE A;  5B8D A;  4LKA A;  2K4D A;  2M1R A;  3O36 A;  2KWO A; 
#chains in the Genus database with same CATH homology
 2CSY A;  5FER A;  2M85 A;  2FUU A;  2VPG A;  2FSA A;  1FP0 A;  2LGV A;  3RPG C;  2CT2 A;  5G04 B;  1U6G B;  2L0B A;  2E6S A;  3N9M A;  3KV5 A;  5H1V A;  4C9Z A;  3T6R A;  4R7E A;  4L58 A;  2YSJ A;  3GL6 A;  4YC9 A;  3PUR A;  2ECJ A;  1VFY A;  4NN2 A;  1WEU A;  5C13 A;  3HTK C;  4AVX A;  2G6Q A;  2DX8 A;  2YUC A;  4UP0 A;  4UP5 A;  4FIP A;  2L43 A;  4WZ0 A;  1V87 A;  4I7C A;  2VJF B;  2ECV A;  2KWK A;  4FK5 A;  4P5O B;  3I2D A;  4S3O C;  2LRI C;  2EGP A;  2KFT A;  2UZG A;  2MNZ A;  1JOC A;  1WEP A;  2MUM A;  4WZ2 A;  3U5P A;  1MM3 A;  1WEV A;  4V3L C;  4B7Y C;  4PTB A;  4YBM A;  2NAA A;  3MHH A;  2MA5 A;  2YYR A;  2YUR A;  5H9M A;  2JMD A;  2KYU A;  2XEU A;  3M63 A;  3VK6 A;  5C11 A;  2OXQ C;  4N4F A;  4W4U A;  3KNV A;  1LDK C;  3N9N A;  3RTR B;  4F52 B;  1WEN A;  3QZV A;  5B78 A;  2MA6 A;  4GB0 A;  4AYC B;  4LAD B;  2FUI A;  3HCS A;  1T1H A;  5EYA F;  4QF3 A;  1N87 A;  3RPG B;  4YAT A;  5D1M B;  5TDW A;  2VP7 A;  2F6J A;  4YAX A;  2JRJ A;  4XI1 A;  4ZUX U;  3DPL R;  2KE1 A;  5TDR A;  5G05 B;  2G43 A;  2ZET C;  2YHN A;  5KH9 A;  4LK9 A;  2KWJ A;  1HYI A;  5LKT A;  3FL2 A;  4ZDT A;  3EB6 A;  5B76 A;  4IC3 A;  4N3W A;  1CHC A;  4MSX A;  1IYM A;  5JG6 A;  1Z2Q A;  3ZPV 1;  2G45 A;  2ECI A;  4GNF A;  2LQ6 A;  5B77 A;  2ECG A;  4ZQL A;  2CSZ A;  3M99 A;  3O70 A;  2RI7 A;  5KH3 A;  2PNX A;  1MM2 A;  4YAD A;  5FB1 A;  4BHW A;  3O35 A;  2MT5 A;  2ECN A;  2IDA A;  3L1X A;  4TKP B;  1WFK A;  1WEQ A;  3N9L A;  5AIT A;  3C5K A;  4FJC A;  2L80 A;  2XB1 A;  3ZTG A;  3N9Q A;  4YBT A;  1F62 A;  2KIZ A;  2K1J A;  3EB5 A;  4YBS A;  2VJE B;  1VYX A;  1DVP A;  2L75 A;  2YQL A;  5LKZ A;  5DKA A;  2CKL A;  4A4B A;  4CA1 A;  3LQH A;  2E6R A;  2YHO A;  3KQI A;  1WEM A;  2K17 A;  4Q6F A;  2KWN A;  4V3K C;  3O33 A;  3DQV R;  3ZYQ A;  2EOD A;  4GND A;  1WEE A;  1X4J A;  3N9O A;  3MHS A;  4B86 C;  2QJ0 A;  2LGG A;  2D8S A;  2H0D A;  2KR4 A;  2RSD A;  1JM7 A;  2YQM A;  2ECT A;  2LXP C;  1VD4 A;  3ZNI A;  2YU4 A;  2MD8 C;  2M3H A;  4WA6 A;  2LGK A;  3M62 A;  3N9P A;  1G25 A;  2C2L A;  3SOX A;  1WES A;  2F6N A;  3PHD A;  4I7B A;  5AIU A;  4L7X A;  2KGI A;  3ASL A;  2KRE A;  5FB0 A;  2LN0 A;  2LXH C;  2PUY A;  2VNF A;  4R2Y A;  3PUQ A;  2YRE A;  3ZPV E;  2QIZ A;  5DIN A;  2JMJ A;  4AP4 A;  3SOU A;  4A4C A;  3U5N A;  5LKU A;  1E4U A;  2C2V S;  5TAB A;  3KV6 A;  4BBQ A;  4O64 A;  3T7L A;  2LV9 A;  3GV4 A;  2KU3 A;  3NG2 A;  1RMD A;  3U5O A;  5B79 A;  4LJN A;  5H1T A;  2VPD A;  5H1U A;  5TRB A;  2VPB A;  5FEY A;  3L11 A;  2VJF A;  4S3O B;  3HCT A;  1Z6U A;  2BAY A;  5D1K B;  3SOW A;  2L5U A;  2EA6 A;  3LRQ A;  3ZVZ B;  4R8P K;  4GNG A;  4I7D A;  5I3L A;  2YT5 A;  4UI9 B;  1WGM A;  3O37 A;  4FO9 A;  3L1Z B;  3C6W A;  3U5M A;  3HCU A;  4QF2 A;  2QIC A;  3LQJ A;  4CCG X;  1XWH A;  2KGG A;  4A49 A;  1Z60 A;  1LDJ B;  2Y1N A;  2HYE D;  5D1L B;  4IC2 A;  3IHP A;  3ZVY A;  2F42 A;  3SHB A;  4AYC A;  4PPE A;  2MD7 B;  2Y43 A;  4MVT A;  2I50 A;  1HYJ A;  1FBV A;  1BOR A;  5TBN A;  1WEW A;  5G0F A;  2M6M A;  4AUQ B;  2CKL B;  2JMI A;  5LCW B;  4GNE A;  1ZBD B;  2MIQ A;  5J3X A;  2AN6 A;  5KH7 A;  1X4I A;  3V43 A;  4X3G A;  4LLB A;  5LKX A;  1WIM A;  1WE9 A;  2LDR A;  4WZ3 B;  2YW8 A;  1X4U A;  3O34 A;  4A0C D;  2K16 A;  1WEO A;  4YAB A;  3LQI A;  2Y1M A;  2H0D B;  2ECW A;  1K2F A;  5B75 A;  1JM7 B;  2MNY A;  2HDP A;  2VPE A;  3O7A A;  2YSM A;  2LGL A;  1WIL A;  2VJE A;  5B8D A;  4LKA A;  2K4D A;  2M1R A;  3O36 A;  2KWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...