2C2VS

Crystal structure of the chip-ubc13-uev1a complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Ubiquitin-conjugating enzyme E2 N
total genus 15
structure length 74
sequence length 74
chains with identical sequence T, U, V
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2vS00
3PHDA 2L75A 5AITA 4IC3A 2HYED 4AYCA 2YT5A 2ECVA 2LV9A 1E4UA 2PNXA 4AYCB 2ECNA 2EA6A 2LQ6A 2YW8A 5B79A 2G6QA 4F52B 4GNFA 2XB1A 4YBSA 4V3LC 5H1TA 2M3HA 2KWKA 1WENA 2QIZA 2ZETC 1RMDA 3O7AA 1WGMA 3QZVA 2KYUA 2E6RA 2Y1MA 2QICA 4ZUXU 1WEQA 4YBMA 2K1JA 3MHSA 5KH9A 4LADB 2FSAA 4LKAA 3O37A 2E6SA 3N9QA 3KNVA 2VJFB 2VP7A 2YSJA 3C6WA 2YU4A 1LDJB 4C9ZA 3PUQA 3M99A 4Q6FA 4GNEA 4W4UA 3L1XA 1K2FA 5D1MB 3ZVZB 3O33A 4N3WA 5D1LB 3T6RA 4QF3A 2ECWA 5C11A 3T7LA 3HCSA 2LN0A 5JG6A 4R7EA 2LGVA 4YABA 2C2VS 4IC2A 2K16A 4PPEA 2MD8C 2I50A 2QJ0A 1WEVA 1Z2QA 3SOUA 3L11A 2LGGA 2DX8A 3LQJA 1WIMA 4FO9A 2MNZA 4A4CA 3U5MA 2NAAA 5TABA 4UP5A 2Y1NA 3ZYQA 2YYRA 4CA1A 1Z6UA 1T1HA 3EB6A 2ECTA 2KU3A 2XEUA 1WFKA 2YUCA 3KV5A 2KGGA 2KGIA 2G45A 4ZDTA 3GL6A 2VPBA 5FEYA 4V3KC 5TBNA 2F6JA 3N9NA 1LDKC 2D8SA 4GB0A 1WEUA 2VJFA 1FP0A 2CKLB 2ECJA 4MSXA 4N4FA 4PTBA 5B78A 3ZPV1 1BORA 2LDRA 2YQMA 2JRJA 4WZ2A 5J3XA 1VFYA 4GNGA 1U6GB 2CSZA 1WEEA 2F42A 3MHHA 2F6NA 2KWNA 3LQHA 3DPLR 1CHCA 3SOWA 5D1KB 2YREA 2MNYA 3ZPVE 2LGKA 2MD7B 1WE9A 2KFTA 2G43A 4UP0A 3RPGC 2UZGA 4L58A 1IYMA 3GV4A 2LXHC 3VK6A 4A0CD 3HCTA 4A49A 1X4JA 3LRQA 1ZBDB 3O36A 3I2DA 2CKLA 1JOCA 2LXPC 3IHPA 5G0FA 1WEMA 3KV6A 2M6MA 4NN2A 3C5KA 5LKUA 2FUIA 3U5PA 5FB1A 3M63A 4O64A 5TDRA 4WA6A 5KH7A 5H1UA 1G25A 2M85A 5G05B 2BAYA 1N87A 2IDAA 2YQLA 2CT2A 5EYAF 2MA6A 2KE1A 3PURA 2ECIA 2VJEB 4QF2A 2LGLA 4R2YA 2L43A 4YATA 4BBQA 4I7DA 2AN6A 5FB0A 3KQIA 2ECGA 3HTKC 4YC9A 3FL2A 2YHOA 2RI7A 4LJNA 2K4DA 4B7YC 2VPDA 4I7BA 3U5NA 4R8PK 2H0DB 1XWHA 2VJEA 5AIUA 1F62A 4WZ0A 3RTRB 5LCWB 4BHWA 1DVPA 4AUQB 1Z60A 3EB5A 4LLBA 3O35A 5TRBA 4P5OB 3N9LA 3SHBA 2YSMA 4FJCA 2KIZA 4S3OC 2LRIC 4FIPA 3N9MA 2VNFA 4YBTA 1X4IA 2OXQC 2YHNA 2HDPA 2Y43A 4GNDA 3LQIA 3O70A 1JM7B 2VPGA 3U5OA 3NG2A 2MUMA 3ZTGA 5FERA 1VD4A 3V43A 4FK5A 4LK9A 5DKAA 2C2LA 2MT5A 2JMDA 2KREA 2KWOA 4S3OB 2L80A 2L5UA 1HYJA 3ZNIA 4AP4A 3DQVR 5H9MA 5C13A 1MM3A 3SOXA 5B75A 1VYXA 5LKTA 2MIQA 2K17A 5LKXA 2RSDA 5DINA 4WZ3B 4YADA 2KR4A 1WILA 1X4UA 2PUYA 3N9PA 2CSYA 4X3GA 4CCGX 5B76A 3N9OA 1WESA 3HCUA 2FUUA 4TKPB 3M62A 4A4BA 5B8DA 1WEPA 4MVTA 2EGPA 2H0DA 5G04B 1WEOA 4ZQLA 2JMJA 2MA5A 2JMIA 2M1RA 4L7XA 1HYIA 2YURA 3ZVYA 3L1ZB 2EODA 1FBVA 2L0BA 3RPGB 2VPEA 4YAXA 4I7CA 3O34A 5I3LA 3ASLA 1V87A 4B86C 1WEWA 5B77A 4AVXA 1MM2A 5TDWA 5LKZA 2KWJA 4XI1A 5KH3A 5H1VA 4UI9B 1JM7A
chains in the Genus database with same CATH superfamily
3PHDA 2L75A 5AITA 4IC3A 2HYED 4AYCA 2YT5A 2ECVA 2MKEA 2LV9A 1E4UA 3FANA 2PNXA 4AYCB 2ECNA 2CSVA 2E61A 2EA6A 2LQ6A 2YW8A 5B79A 2G6QA 3LVRE 2JUNA 2M13A 4F52B 4GNFA 2XB1A 4YBSA 4V3LC 5H1TA 2M3HA 2KWKA 1WENA 2QIZA 2ZETC 1RMDA 2RR4A 2YVRA 3O7AA 1WGMA 3QZVA 2KYUA 2E6RA 2Y1MA 4H9DA 4OGEA 5SVYA 2QICA 4ZUXU 3KDEC 1WEQA 2IQJA 4YBMA 2K1JA 3MHSA 5KH9A 4O62A 3SUBA 4LADB 2FSAA 4LKAA 3O37A 2E6SA 3N9QA 2XOCA 3KNVA 3T9KA 2VJFB 2VP7A 2YSJA 3C6WA 2YU4A 1LDJB 4C9ZA 3PUQA 3M99A 4Q6FA 4GNEA 4W4UA 3L1XA 1K2FA 5D1MB 3ZVZB 3O33A 5K3QA 2FFWA 4N3WA 5D1LB 3T6RA 4QF3A 2ECWA 5C11A 3T7LA 3HCSA 4Z0RA 2LN0A 1MBMA 5JG6A 4R7EA 2LGVA 4YABA 2C2VS 4IC2A 2K16A 4PPEA 2MD8C 2I50A 2QJ0A 1WEVA 1Z2QA 3SOUA 3L11A 2LGGA 2DX8A 3LQJA 1WIMA 3M7KA 2DSMA 4FO9A 3PLWA 2MNZA 4A4CA 3U5MA 2NAAA 5TABA 2EGMA 4UP5A 2Y1NA 3ZYQA 2YYRA 4CA1A 1Z6UA 3LDYA 1T1HA 3EB6A 3Q1DA 2ECTA 2XP0A 2KU3A 2XEUA 1WFKA 2YUCA 3KV5A 2KGGA 2KGIA 2G45A 4ZDTA 3GL6A 2VPBA 5FEYA 4V3KC 5TBNA 2F6JA 3H7HA 3N9NA 1LDKC 2D8SA 2B0OE 4GB0A 1WEUA 2VJFA 1FP0A 2DJAA 2CKLB 2ECJA 4MSXA 4N4FA 4PTBA 5B78A 2D8UA 3ZPV1 1BORA 2LDRA 2YQMA 2JRJA 5SVIB 4WZ2A 2L7PA 5J3XA 5SVIA 1VFYA 4GNGA 1U6GB 2CSZA 1WEEA 2F42A 3MDBC 3MHHA 2F6NA 2KWNA 3LQHA 3DPLR 1CHCA 3SOWA 5D1KB 2YREA 2MNYA 3ZPVE 2LGKA 2MD7B 1WE9A 2KFTA 2G43A 4UP0A 3RPGC 2UZGA 4L58A 1IYMA 3GV4A 2LXHC 3VK6A 4A0CD 3HCTA 4A49A 1X4JA 3LRQA 1ZBDB 3O36A 2KKXA 3I2DA 2CKLA 1JOCA 2LXPC 3IHPA 5G0FA 1WEMA 3KV6A 2M6MA 4NN2A 3C5KA 5LKUA 2FUIA 3U5PA 5FB1A 3M63A 3LVQE 4O64A 5TDRA 4WA6A 5KH7A 5H1UA 1G25A 2M85A 3O47A 5G05B 2BAYA 1N87A 2IDAA 2YQLA 2CT2A 5EYAF 2MA6A 2KE1A 3PURA 2OWAA 3E2DA 2ECIA 2P57A 2VJEB 4QF2A 2LGLA 4R2YA 2L43A 4YATA 4BBQA 4I7DA 2AN6A 5FB0A 3DDTA 3LJUX 3KQIA 2XOZA 2ECGA 3HTKC 4YC9A 3FL2A 2YHOA 2RI7A 4LJNA 2K4DA 4B7YC 2LAUA 1DCQA 2VPDA 4I7BA 3U5NA 2EXUA 4R8PK 2H0DB 1XWHA 2VJEA 5AIUA 1F62A 4WZ0A 3RTRB 3FJUB 5LCWB 4BHWA 1DVPA 3FAOA 4AUQB 1Z60A 3EB5A 4LLBA 3O35A 5TRBA 4P5OB 3N9LA 2JM3A 3SHBA 2YSMA 3FM8C 4FJCA 2KIZA 3JUEA 4Z0OA 4S3OC 2LRIC 4FIPA 3N9MA 2VNFA 4YBTA 1X4IA 2OXQC 2YHNA 2HDPA 2Y43A 2KKYA 4GNDA 3LQIA 3O70A 1JM7B 2VPGA 3U5OA 2CRWA 3NG2A 2MUMA 3ZTGA 5FERA 1VD4A 3V43A 4FK5A 2CONA 4F1PA 4LK9A 5DKAA 2C2LA 2MT5A 2JMDA 2KREA 2KWOA 4S3OB 2L80A 2L5UA 1HYJA 3ZNIA 4AP4A 3DQVR 5H9MA 5C13A 1MM3A 3SOXA 4QQ4A 5SVXA 5B75A 1VYXA 5LKTA 2MIQA 2K17A 5LKXA 2RSDA 3FEHA 5DINA 4WZ3B 4YADA 2KR4A 1WILA 1X4UA 2PUYA 3N9PA 2CSYA 4X3GA 4CCGX 5B76A 3N9OA 1WESA 3HCUA 2FUUA 4TKPB 3M62A 4A4BA 5B8DA 1WEPA 4MVTA 2EGPA 2H0DA 5G04B 1WEOA 4ZQLA 2JMJA 2MA5A 2JMIA 2M1RA 4L7XA 1HYIA 2YURA 3ZVYA 3L1ZB 2EODA 1FBVA 2L0BA 3RPGB 2VPEA 4YAXA 4I7CA 3O34A 5I3LA 2FD4A 3ASLA 4OGCA 1V87A 4B86C 1WEWA 5B77A 2CRRA 4AVXA 2XOYA 1MM2A 5TDWA 5LKZA 2KWJA 4XI1A 5KH3A 5H1VA 3DWDA 4UI9B 1JM7A
chains in the Genus database with same CATH topology
3PHDA 2L75A 5AITA 4IC3A 2HYED 4AYCA 2YT5A 2ECVA 2LV9A 1E4UA 2PNXA 4AYCB 2ECNA 2EA6A 2LQ6A 2YW8A 5B79A 2G6QA 4F52B 4GNFA 2XB1A 4YBSA 4V3LC 5H1TA 2M3HA 2KWKA 1WENA 2QIZA 2ZETC 1RMDA 3O7AA 1WGMA 3QZVA 2KYUA 2E6RA 2Y1MA 2QICA 4ZUXU 1WEQA 4YBMA 2K1JA 3MHSA 5KH9A 4LADB 2FSAA 4LKAA 3O37A 2E6SA 3N9QA 3KNVA 2VJFB 2VP7A 2YSJA 3C6WA 2YU4A 1LDJB 4C9ZA 3PUQA 3M99A 4Q6FA 4GNEA 4W4UA 3L1XA 1K2FA 5D1MB 3ZVZB 3O33A 4N3WA 5D1LB 3T6RA 4QF3A 2ECWA 5C11A 3T7LA 3HCSA 2LN0A 5JG6A 4R7EA 2LGVA 4YABA 2C2VS 4IC2A 2K16A 4PPEA 2MD8C 2I50A 2QJ0A 1WEVA 1Z2QA 3SOUA 3L11A 2LGGA 2DX8A 3LQJA 1WIMA 4FO9A 2MNZA 4A4CA 3U5MA 2NAAA 5TABA 4UP5A 2Y1NA 3ZYQA 2YYRA 4CA1A 1Z6UA 1T1HA 3EB6A 2ECTA 2KU3A 2XEUA 1WFKA 2YUCA 3KV5A 2KGGA 2KGIA 2G45A 4ZDTA 3GL6A 2VPBA 5FEYA 4V3KC 5TBNA 2F6JA 3N9NA 1LDKC 2D8SA 4GB0A 1WEUA 2VJFA 1FP0A 2CKLB 2ECJA 4MSXA 4N4FA 4PTBA 5B78A 3ZPV1 1BORA 2LDRA 2YQMA 2JRJA 4WZ2A 5J3XA 1VFYA 4GNGA 1U6GB 2CSZA 1WEEA 2F42A 3MHHA 2F6NA 2KWNA 3LQHA 3DPLR 1CHCA 3SOWA 5D1KB 2YREA 2MNYA 3ZPVE 2LGKA 2MD7B 1WE9A 2KFTA 2G43A 4UP0A 3RPGC 2UZGA 4L58A 1IYMA 3GV4A 2LXHC 3VK6A 4A0CD 3HCTA 4A49A 1X4JA 3LRQA 1ZBDB 3O36A 3I2DA 2CKLA 1JOCA 2LXPC 3IHPA 5G0FA 1WEMA 3KV6A 2M6MA 4NN2A 3C5KA 5LKUA 2FUIA 3U5PA 5FB1A 3M63A 4O64A 5TDRA 4WA6A 5KH7A 5H1UA 1G25A 2M85A 5G05B 2BAYA 1N87A 2IDAA 2YQLA 2CT2A 5EYAF 2MA6A 2KE1A 3PURA 2ECIA 2VJEB 4QF2A 2LGLA 4R2YA 2L43A 4YATA 4BBQA 4I7DA 2AN6A 5FB0A 3KQIA 2ECGA 3HTKC 4YC9A 3FL2A 2YHOA 2RI7A 4LJNA 2K4DA 4B7YC 2VPDA 4I7BA 3U5NA 4R8PK 2H0DB 1XWHA 2VJEA 5AIUA 1F62A 4WZ0A 3RTRB 5LCWB 4BHWA 1DVPA 4AUQB 1Z60A 3EB5A 4LLBA 3O35A 5TRBA 4P5OB 3N9LA 3SHBA 2YSMA 4FJCA 2KIZA 4S3OC 2LRIC 4FIPA 3N9MA 2VNFA 4YBTA 1X4IA 2OXQC 2YHNA 2HDPA 2Y43A 4GNDA 3LQIA 3O70A 1JM7B 2VPGA 3U5OA 3NG2A 2MUMA 3ZTGA 5FERA 1VD4A 3V43A 4FK5A 4LK9A 5DKAA 2C2LA 2MT5A 2JMDA 2KREA 2KWOA 4S3OB 2L80A 2L5UA 1HYJA 3ZNIA 4AP4A 3DQVR 5H9MA 5C13A 1MM3A 3SOXA 5B75A 1VYXA 5LKTA 2MIQA 2K17A 5LKXA 2RSDA 5DINA 4WZ3B 4YADA 2KR4A 1WILA 1X4UA 2PUYA 3N9PA 2CSYA 4X3GA 4CCGX 5B76A 3N9OA 1WESA 3HCUA 2FUUA 4TKPB 3M62A 4A4BA 5B8DA 1WEPA 4MVTA 2EGPA 2H0DA 5G04B 1WEOA 4ZQLA 2JMJA 2MA5A 2JMIA 2M1RA 4L7XA 1HYIA 2YURA 3ZVYA 3L1ZB 2EODA 1FBVA 2L0BA 3RPGB 2VPEA 4YAXA 4I7CA 3O34A 5I3LA 3ASLA 1V87A 4B86C 1WEWA 5B77A 4AVXA 1MM2A 5TDWA 5LKZA 2KWJA 4XI1A 5KH3A 5H1VA 4UI9B 1JM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHD A;  2L75 A;  5AIT A;  4IC3 A;  2HYE D;  4AYC A;  2YT5 A;  2ECV A;  2LV9 A;  1E4U A;  2PNX A;  4AYC B;  2ECN A;  2EA6 A;  2LQ6 A;  2YW8 A;  5B79 A;  2G6Q A;  4F52 B;  4GNF A;  2XB1 A;  4YBS A;  4V3L C;  5H1T A;  2M3H A;  2KWK A;  1WEN A;  2QIZ A;  2ZET C;  1RMD A;  3O7A A;  1WGM A;  3QZV A;  2KYU A;  2E6R A;  2Y1M A;  2QIC A;  4ZUX U;  1WEQ A;  4YBM A;  2K1J A;  3MHS A;  5KH9 A;  4LAD B;  2FSA A;  4LKA A;  3O37 A;  2E6S A;  3N9Q A;  3KNV A;  2VJF B;  2VP7 A;  2YSJ A;  3C6W A;  2YU4 A;  1LDJ B;  4C9Z A;  3PUQ A;  3M99 A;  4Q6F A;  4GNE A;  4W4U A;  3L1X A;  1K2F A;  5D1M B;  3ZVZ B;  3O33 A;  4N3W A;  5D1L B;  3T6R A;  4QF3 A;  2ECW A;  5C11 A;  3T7L A;  3HCS A;  2LN0 A;  5JG6 A;  4R7E A;  2LGV A;  4YAB A;  2C2V S;  4IC2 A;  2K16 A;  4PPE A;  2MD8 C;  2I50 A;  2QJ0 A;  1WEV A;  1Z2Q A;  3SOU A;  3L11 A;  2LGG A;  2DX8 A;  3LQJ A;  1WIM A;  4FO9 A;  2MNZ A;  4A4C A;  3U5M A;  2NAA A;  5TAB A;  4UP5 A;  2Y1N A;  3ZYQ A;  2YYR A;  4CA1 A;  1Z6U A;  1T1H A;  3EB6 A;  2ECT A;  2KU3 A;  2XEU A;  1WFK A;  2YUC A;  3KV5 A;  2KGG A;  2KGI A;  2G45 A;  4ZDT A;  3GL6 A;  2VPB A;  5FEY A;  4V3K C;  5TBN A;  2F6J A;  3N9N A;  1LDK C;  2D8S A;  4GB0 A;  1WEU A;  2VJF A;  1FP0 A;  2CKL B;  2ECJ A;  4MSX A;  4N4F A;  4PTB A;  5B78 A;  3ZPV 1;  1BOR A;  2LDR A;  2YQM A;  2JRJ A;  4WZ2 A;  5J3X A;  1VFY A;  4GNG A;  1U6G B;  2CSZ A;  1WEE A;  2F42 A;  3MHH A;  2F6N A;  2KWN A;  3LQH A;  3DPL R;  1CHC A;  3SOW A;  5D1K B;  2YRE A;  2MNY A;  3ZPV E;  2LGK A;  2MD7 B;  1WE9 A;  2KFT A;  2G43 A;  4UP0 A;  3RPG C;  2UZG A;  4L58 A;  1IYM A;  3GV4 A;  2LXH C;  3VK6 A;  4A0C D;  3HCT A;  4A49 A;  1X4J A;  3LRQ A;  1ZBD B;  3O36 A;  3I2D A;  2CKL A;  1JOC A;  2LXP C;  3IHP A;  5G0F A;  1WEM A;  3KV6 A;  2M6M A;  4NN2 A;  3C5K A;  5LKU A;  2FUI A;  3U5P A;  5FB1 A;  3M63 A;  4O64 A;  5TDR A;  4WA6 A;  5KH7 A;  5H1U A;  1G25 A;  2M85 A;  5G05 B;  2BAY A;  1N87 A;  2IDA A;  2YQL A;  2CT2 A;  5EYA F;  2MA6 A;  2KE1 A;  3PUR A;  2ECI A;  2VJE B;  4QF2 A;  2LGL A;  4R2Y A;  2L43 A;  4YAT A;  4BBQ A;  4I7D A;  2AN6 A;  5FB0 A;  3KQI A;  2ECG A;  3HTK C;  4YC9 A;  3FL2 A;  2YHO A;  2RI7 A;  4LJN A;  2K4D A;  4B7Y C;  2VPD A;  4I7B A;  3U5N A;  4R8P K;  2H0D B;  1XWH A;  2VJE A;  5AIU A;  1F62 A;  4WZ0 A;  3RTR B;  5LCW B;  4BHW A;  1DVP A;  4AUQ B;  1Z60 A;  3EB5 A;  4LLB A;  3O35 A;  5TRB A;  4P5O B;  3N9L A;  3SHB A;  2YSM A;  4FJC A;  2KIZ A;  4S3O C;  2LRI C;  4FIP A;  3N9M A;  2VNF A;  4YBT A;  1X4I A;  2OXQ C;  2YHN A;  2HDP A;  2Y43 A;  4GND A;  3LQI A;  3O70 A;  1JM7 B;  2VPG A;  3U5O A;  3NG2 A;  2MUM A;  3ZTG A;  5FER A;  1VD4 A;  3V43 A;  4FK5 A;  4LK9 A;  5DKA A;  2C2L A;  2MT5 A;  2JMD A;  2KRE A;  2KWO A;  4S3O B;  2L80 A;  2L5U A;  1HYJ A;  3ZNI A;  4AP4 A;  3DQV R;  5H9M A;  5C13 A;  1MM3 A;  3SOX A;  5B75 A;  1VYX A;  5LKT A;  2MIQ A;  2K17 A;  5LKX A;  2RSD A;  5DIN A;  4WZ3 B;  4YAD A;  2KR4 A;  1WIL A;  1X4U A;  2PUY A;  3N9P A;  2CSY A;  4X3G A;  4CCG X;  5B76 A;  3N9O A;  1WES A;  3HCU A;  2FUU A;  4TKP B;  3M62 A;  4A4B A;  5B8D A;  1WEP A;  4MVT A;  2EGP A;  2H0D A;  5G04 B;  1WEO A;  4ZQL A;  2JMJ A;  2MA5 A;  2JMI A;  2M1R A;  4L7X A;  1HYI A;  2YUR A;  3ZVY A;  3L1Z B;  2EOD A;  1FBV A;  2L0B A;  3RPG B;  2VPE A;  4YAX A;  4I7C A;  3O34 A;  5I3L A;  3ASL A;  1V87 A;  4B86 C;  1WEW A;  5B77 A;  4AVX A;  1MM2 A;  5TDW A;  5LKZ A;  2KWJ A;  4XI1 A;  5KH3 A;  5H1V A;  4UI9 B;  1JM7 A; 
#chains in the Genus database with same CATH topology
 3PHD A;  2L75 A;  5AIT A;  4IC3 A;  2HYE D;  4AYC A;  2YT5 A;  2ECV A;  2MKE A;  2LV9 A;  1E4U A;  3FAN A;  2PNX A;  4AYC B;  2ECN A;  2CSV A;  2E61 A;  2EA6 A;  2LQ6 A;  2YW8 A;  5B79 A;  2G6Q A;  3LVR E;  2JUN A;  2M13 A;  4F52 B;  4GNF A;  2XB1 A;  4YBS A;  4V3L C;  5H1T A;  2M3H A;  2KWK A;  1WEN A;  2QIZ A;  2ZET C;  1RMD A;  2RR4 A;  2YVR A;  3O7A A;  1WGM A;  3QZV A;  2KYU A;  2E6R A;  2Y1M A;  4H9D A;  4OGE A;  5SVY A;  2QIC A;  4ZUX U;  3KDE C;  1WEQ A;  2IQJ A;  4YBM A;  2K1J A;  3MHS A;  5KH9 A;  4O62 A;  3SUB A;  4LAD B;  2FSA A;  4LKA A;  3O37 A;  2E6S A;  3N9Q A;  2XOC A;  3KNV A;  3T9K A;  2VJF B;  2VP7 A;  2YSJ A;  3C6W A;  2YU4 A;  1LDJ B;  4C9Z A;  3PUQ A;  3M99 A;  4Q6F A;  4GNE A;  4W4U A;  3L1X A;  1K2F A;  5D1M B;  3ZVZ B;  3O33 A;  5K3Q A;  2FFW A;  4N3W A;  5D1L B;  3T6R A;  4QF3 A;  2ECW A;  5C11 A;  3T7L A;  3HCS A;  4Z0R A;  2LN0 A;  1MBM A;  5JG6 A;  4R7E A;  2LGV A;  4YAB A;  2C2V S;  4IC2 A;  2K16 A;  4PPE A;  2MD8 C;  2I50 A;  2QJ0 A;  1WEV A;  1Z2Q A;  3SOU A;  3L11 A;  2LGG A;  2DX8 A;  3LQJ A;  1WIM A;  3M7K A;  2DSM A;  4FO9 A;  3PLW A;  2MNZ A;  4A4C A;  3U5M A;  2NAA A;  5TAB A;  2EGM A;  4UP5 A;  2Y1N A;  3ZYQ A;  2YYR A;  4CA1 A;  1Z6U A;  3LDY A;  1T1H A;  3EB6 A;  3Q1D A;  2ECT A;  2XP0 A;  2KU3 A;  2XEU A;  1WFK A;  2YUC A;  3KV5 A;  2KGG A;  2KGI A;  2G45 A;  4ZDT A;  3GL6 A;  2VPB A;  5FEY A;  4V3K C;  5TBN A;  2F6J A;  3H7H A;  3N9N A;  1LDK C;  2D8S A;  2B0O E;  4GB0 A;  1WEU A;  2VJF A;  1FP0 A;  2DJA A;  2CKL B;  2ECJ A;  4MSX A;  4N4F A;  4PTB A;  5B78 A;  2D8U A;  3ZPV 1;  1BOR A;  2LDR A;  2YQM A;  2JRJ A;  5SVI B;  4WZ2 A;  2L7P A;  5J3X A;  5SVI A;  1VFY A;  4GNG A;  1U6G B;  2CSZ A;  1WEE A;  2F42 A;  3MDB C;  3MHH A;  2F6N A;  2KWN A;  3LQH A;  3DPL R;  1CHC A;  3SOW A;  5D1K B;  2YRE A;  2MNY A;  3ZPV E;  2LGK A;  2MD7 B;  1WE9 A;  2KFT A;  2G43 A;  4UP0 A;  3RPG C;  2UZG A;  4L58 A;  1IYM A;  3GV4 A;  2LXH C;  3VK6 A;  4A0C D;  3HCT A;  4A49 A;  1X4J A;  3LRQ A;  1ZBD B;  3O36 A;  2KKX A;  3I2D A;  2CKL A;  1JOC A;  2LXP C;  3IHP A;  5G0F A;  1WEM A;  3KV6 A;  2M6M A;  4NN2 A;  3C5K A;  5LKU A;  2FUI A;  3U5P A;  5FB1 A;  3M63 A;  3LVQ E;  4O64 A;  5TDR A;  4WA6 A;  5KH7 A;  5H1U A;  1G25 A;  2M85 A;  3O47 A;  5G05 B;  2BAY A;  1N87 A;  2IDA A;  2YQL A;  2CT2 A;  5EYA F;  2MA6 A;  2KE1 A;  3PUR A;  2OWA A;  3E2D A;  2ECI A;  2P57 A;  2VJE B;  4QF2 A;  2LGL A;  4R2Y A;  2L43 A;  4YAT A;  4BBQ A;  4I7D A;  2AN6 A;  5FB0 A;  3DDT A;  3LJU X;  3KQI A;  2XOZ A;  2ECG A;  3HTK C;  4YC9 A;  3FL2 A;  2YHO A;  2RI7 A;  4LJN A;  2K4D A;  4B7Y C;  2LAU A;  1DCQ A;  2VPD A;  4I7B A;  3U5N A;  2EXU A;  4R8P K;  2H0D B;  1XWH A;  2VJE A;  5AIU A;  1F62 A;  4WZ0 A;  3RTR B;  3FJU B;  5LCW B;  4BHW A;  1DVP A;  3FAO A;  4AUQ B;  1Z60 A;  3EB5 A;  4LLB A;  3O35 A;  5TRB A;  4P5O B;  3N9L A;  2JM3 A;  3SHB A;  2YSM A;  3FM8 C;  4FJC A;  2KIZ A;  3JUE A;  4Z0O A;  4S3O C;  2LRI C;  4FIP A;  3N9M A;  2VNF A;  4YBT A;  1X4I A;  2OXQ C;  2YHN A;  2HDP A;  2Y43 A;  2KKY A;  4GND A;  3LQI A;  3O70 A;  1JM7 B;  2VPG A;  3U5O A;  2CRW A;  3NG2 A;  2MUM A;  3ZTG A;  5FER A;  1VD4 A;  3V43 A;  4FK5 A;  2CON A;  4F1P A;  4LK9 A;  5DKA A;  2C2L A;  2MT5 A;  2JMD A;  2KRE A;  2KWO A;  4S3O B;  2L80 A;  2L5U A;  1HYJ A;  3ZNI A;  4AP4 A;  3DQV R;  5H9M A;  5C13 A;  1MM3 A;  3SOX A;  4QQ4 A;  5SVX A;  5B75 A;  1VYX A;  5LKT A;  2MIQ A;  2K17 A;  5LKX A;  2RSD A;  3FEH A;  5DIN A;  4WZ3 B;  4YAD A;  2KR4 A;  1WIL A;  1X4U A;  2PUY A;  3N9P A;  2CSY A;  4X3G A;  4CCG X;  5B76 A;  3N9O A;  1WES A;  3HCU A;  2FUU A;  4TKP B;  3M62 A;  4A4B A;  5B8D A;  1WEP A;  4MVT A;  2EGP A;  2H0D A;  5G04 B;  1WEO A;  4ZQL A;  2JMJ A;  2MA5 A;  2JMI A;  2M1R A;  4L7X A;  1HYI A;  2YUR A;  3ZVY A;  3L1Z B;  2EOD A;  1FBV A;  2L0B A;  3RPG B;  2VPE A;  4YAX A;  4I7C A;  3O34 A;  5I3L A;  2FD4 A;  3ASL A;  4OGC A;  1V87 A;  4B86 C;  1WEW A;  5B77 A;  2CRR A;  4AVX A;  2XOY A;  1MM2 A;  5TDW A;  5LKZ A;  2KWJ A;  4XI1 A;  5KH3 A;  5H1V A;  3DWD A;  4UI9 B;  1JM7 A; 
#chains in the Genus database with same CATH homology
 3PHD A;  2L75 A;  5AIT A;  4IC3 A;  2HYE D;  4AYC A;  2YT5 A;  2ECV A;  2LV9 A;  1E4U A;  2PNX A;  4AYC B;  2ECN A;  2EA6 A;  2LQ6 A;  2YW8 A;  5B79 A;  2G6Q A;  4F52 B;  4GNF A;  2XB1 A;  4YBS A;  4V3L C;  5H1T A;  2M3H A;  2KWK A;  1WEN A;  2QIZ A;  2ZET C;  1RMD A;  3O7A A;  1WGM A;  3QZV A;  2KYU A;  2E6R A;  2Y1M A;  2QIC A;  4ZUX U;  1WEQ A;  4YBM A;  2K1J A;  3MHS A;  5KH9 A;  4LAD B;  2FSA A;  4LKA A;  3O37 A;  2E6S A;  3N9Q A;  3KNV A;  2VJF B;  2VP7 A;  2YSJ A;  3C6W A;  2YU4 A;  1LDJ B;  4C9Z A;  3PUQ A;  3M99 A;  4Q6F A;  4GNE A;  4W4U A;  3L1X A;  1K2F A;  5D1M B;  3ZVZ B;  3O33 A;  4N3W A;  5D1L B;  3T6R A;  4QF3 A;  2ECW A;  5C11 A;  3T7L A;  3HCS A;  2LN0 A;  5JG6 A;  4R7E A;  2LGV A;  4YAB A;  2C2V S;  4IC2 A;  2K16 A;  4PPE A;  2MD8 C;  2I50 A;  2QJ0 A;  1WEV A;  1Z2Q A;  3SOU A;  3L11 A;  2LGG A;  2DX8 A;  3LQJ A;  1WIM A;  4FO9 A;  2MNZ A;  4A4C A;  3U5M A;  2NAA A;  5TAB A;  4UP5 A;  2Y1N A;  3ZYQ A;  2YYR A;  4CA1 A;  1Z6U A;  1T1H A;  3EB6 A;  2ECT A;  2KU3 A;  2XEU A;  1WFK A;  2YUC A;  3KV5 A;  2KGG A;  2KGI A;  2G45 A;  4ZDT A;  3GL6 A;  2VPB A;  5FEY A;  4V3K C;  5TBN A;  2F6J A;  3N9N A;  1LDK C;  2D8S A;  4GB0 A;  1WEU A;  2VJF A;  1FP0 A;  2CKL B;  2ECJ A;  4MSX A;  4N4F A;  4PTB A;  5B78 A;  3ZPV 1;  1BOR A;  2LDR A;  2YQM A;  2JRJ A;  4WZ2 A;  5J3X A;  1VFY A;  4GNG A;  1U6G B;  2CSZ A;  1WEE A;  2F42 A;  3MHH A;  2F6N A;  2KWN A;  3LQH A;  3DPL R;  1CHC A;  3SOW A;  5D1K B;  2YRE A;  2MNY A;  3ZPV E;  2LGK A;  2MD7 B;  1WE9 A;  2KFT A;  2G43 A;  4UP0 A;  3RPG C;  2UZG A;  4L58 A;  1IYM A;  3GV4 A;  2LXH C;  3VK6 A;  4A0C D;  3HCT A;  4A49 A;  1X4J A;  3LRQ A;  1ZBD B;  3O36 A;  3I2D A;  2CKL A;  1JOC A;  2LXP C;  3IHP A;  5G0F A;  1WEM A;  3KV6 A;  2M6M A;  4NN2 A;  3C5K A;  5LKU A;  2FUI A;  3U5P A;  5FB1 A;  3M63 A;  4O64 A;  5TDR A;  4WA6 A;  5KH7 A;  5H1U A;  1G25 A;  2M85 A;  5G05 B;  2BAY A;  1N87 A;  2IDA A;  2YQL A;  2CT2 A;  5EYA F;  2MA6 A;  2KE1 A;  3PUR A;  2ECI A;  2VJE B;  4QF2 A;  2LGL A;  4R2Y A;  2L43 A;  4YAT A;  4BBQ A;  4I7D A;  2AN6 A;  5FB0 A;  3KQI A;  2ECG A;  3HTK C;  4YC9 A;  3FL2 A;  2YHO A;  2RI7 A;  4LJN A;  2K4D A;  4B7Y C;  2VPD A;  4I7B A;  3U5N A;  4R8P K;  2H0D B;  1XWH A;  2VJE A;  5AIU A;  1F62 A;  4WZ0 A;  3RTR B;  5LCW B;  4BHW A;  1DVP A;  4AUQ B;  1Z60 A;  3EB5 A;  4LLB A;  3O35 A;  5TRB A;  4P5O B;  3N9L A;  3SHB A;  2YSM A;  4FJC A;  2KIZ A;  4S3O C;  2LRI C;  4FIP A;  3N9M A;  2VNF A;  4YBT A;  1X4I A;  2OXQ C;  2YHN A;  2HDP A;  2Y43 A;  4GND A;  3LQI A;  3O70 A;  1JM7 B;  2VPG A;  3U5O A;  3NG2 A;  2MUM A;  3ZTG A;  5FER A;  1VD4 A;  3V43 A;  4FK5 A;  4LK9 A;  5DKA A;  2C2L A;  2MT5 A;  2JMD A;  2KRE A;  2KWO A;  4S3O B;  2L80 A;  2L5U A;  1HYJ A;  3ZNI A;  4AP4 A;  3DQV R;  5H9M A;  5C13 A;  1MM3 A;  3SOX A;  5B75 A;  1VYX A;  5LKT A;  2MIQ A;  2K17 A;  5LKX A;  2RSD A;  5DIN A;  4WZ3 B;  4YAD A;  2KR4 A;  1WIL A;  1X4U A;  2PUY A;  3N9P A;  2CSY A;  4X3G A;  4CCG X;  5B76 A;  3N9O A;  1WES A;  3HCU A;  2FUU A;  4TKP B;  3M62 A;  4A4B A;  5B8D A;  1WEP A;  4MVT A;  2EGP A;  2H0D A;  5G04 B;  1WEO A;  4ZQL A;  2JMJ A;  2MA5 A;  2JMI A;  2M1R A;  4L7X A;  1HYI A;  2YUR A;  3ZVY A;  3L1Z B;  2EOD A;  1FBV A;  2L0B A;  3RPG B;  2VPE A;  4YAX A;  4I7C A;  3O34 A;  5I3L A;  3ASL A;  1V87 A;  4B86 C;  1WEW A;  5B77 A;  4AVX A;  1MM2 A;  5TDW A;  5LKZ A;  2KWJ A;  4XI1 A;  5KH3 A;  5H1V A;  4UI9 B;  1JM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...