2C2VS

Crystal structure of the chip-ubc13-uev1a complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 N
publication title Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 15
structure length 74
sequence length 74
chains with identical sequence T, U, V
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2vS00
2JRJA 1WEWA 3VK6A 2YUCA 2MD7B 3N9NA 4C9ZA 3ZYQA 2ECVA 2LGKA 4LK9A 4R2YA 2YSJA 2LGVA 1WEMA 3O35A 4X3GA 1HYJA 4LLBA 2YURA 4CCGX 2YU4A 5D1LB 2M6MA 4B86C 5AIUA 1U6GB 4BHWA 4I7BA 1X4IA 1F62A 2MA6A 2QICA 2KFTA 4R7EA 3ZVZB 2AN6A 3ZPV1 4IC2A 2YQMA 2CT2A 2KR4A 4GNFA 2LGLA 4R8PK 4YBMA 4N3WA 2ECIA 1X4JA 2CKLB 3RPGB 4AYCA 2YHOA 1BORA 1E4UA 5D1MB 5DINA 1N87A 5B79A 2L5UA 1LDJB 2Y1MA 3KQIA 2CSZA 2ZETC 3FL2A 3HCTA 1WEPA 3PURA 1FP0A 5FEYA 2JMJA 2ECGA 3LQHA 2DX8A 4FJCA 5B77A 1DVPA 1V87A 1WEEA 5LKTA 3T6RA 3O33A 4YADA 3PUQA 3NG2A 2YYRA 2MA5A 2VJFA 3I2DA 4B7YC 1ZBDB 2K4DA 2VJEB 3DQVR 2K17A 2LV9A 1WEOA 3N9QA 1WILA 2RSDA 5TDWA 2LXPC 3KV6A 2CKLA 2CSYA 2YQLA 2C2LA 2ECWA 2FUUA 3HCUA 4FIPA 2G45A 3HTKC 5B8DA 4P5OB 3SOUA 2UZGA 3O70A 4YC9A 4L58A 4A4CA 2IDAA 4W4UA 3MHHA 2BAYA 3HCSA 3SOWA 3M62A 2F42A 5FB0A 2MT5A 5I3LA 1JM7B 3N9PA 2E6RA 1LDKC 3L11A 2D8SA 4V3KC 3M99A 3ZTGA 3ASLA 3U5NA 3C6WA 4FO9A 1K2FA 4L7XA 5DKAA 5H1UA 5J3XA 2Y43A 3T7LA 4MVTA 4I7CA 3C5KA 3SHBA 4PPEA 3KV5A 5B76A 5FB1A 1XWHA 2L43A 3QZVA 4YBTA 2VNFA 2PUYA 2KGGA 2MIQA 3ZNIA 1WIMA 2H0DA 2I50A 2LQ6A 4FK5A 2MD8C 1HYIA 4YATA 2MNZA 1WENA 2M85A 1IYMA 2JMDA 5TRBA 2QIZA 5LKZA 4GB0A 3ZVYA 2PNXA 2KE1A 4GNDA 4LADB 5C11A 2K1JA 4LJNA 2YREA 1VD4A 3EB6A 4WZ0A 4A0CD 2YW8A 2YHNA 4AP4A 1WGMA 5EYAF 1WEVA 4ZUXU 4WA6A 2YSMA 3N9OA 2XB1A 1Z6UA 5FERA 4CA1A 2G6QA 4V3LC 2XEUA 2KGIA 2LRIC 2MNYA 3O37A 4A49A 1CHCA 2KU3A 3GL6A 4PTBA 2HDPA 5H1TA 4O64A 5TBNA 2VPGA 4AUQB 2EGPA 2F6JA 2ECNA 2KYUA 2KWNA 5JG6A 2G43A 1RMDA 5G0FA 2EA6A 4AVXA 5H1VA 3U5MA 4GNEA 5C13A 3N9MA 1T1HA 3MHSA 3O34A 4XI1A 3U5PA 2NAAA 2OXQC 3GV4A 4ZDTA 2L0BA 2LN0A 4N4FA 4ZQLA 2M1RA 4S3OB 3LQJA 2FSAA 2VJEA 5D1KB 5KH3A 3IHPA 4Q6FA 4MSXA 2KWKA 2VPBA 1X4UA 3LQIA 3KNVA 2F6NA 2VJFB 4UI9B 3EB5A 3N9LA 4S3OC 2ECJA 3DPLR 3O36A 2E6SA 5B75A 3M63A 1FBVA 3U5OA 4A4BA 2KWJA 4BBQA 3LRQA 2QJ0A 2KWOA 4LKAA 4IC3A 2HYED 5TDRA 1WEQA 1WE9A 2L75A 4WZ3B 2VP7A 3SOXA 2LXHC 1JM7A 3L1XA 2KREA 2RI7A 4UP5A 1WFKA 1VYXA 5KH9A 5G04B 4QF3A 2LDRA 3RPGC 5LKUA 2MUMA 4NN2A 4YBSA 2JMIA 4QF2A 1MM3A 2K16A 4F52B 1Z60A 3RTRB 2YT5A 4UP0A 2L80A 3PHDA 3ZPVE 5AITA 5LCWB 5H9MA 2M3HA 2EODA 2LGGA 4TKPB 1Z2QA 2VPDA 3O7AA 2VPEA 3L1ZB 3V43A 4GNGA 4I7DA 5G05B 1WEUA 1JOCA 1G25A 1VFYA 4AYCB 4YABA 2ECTA 2C2VS 2Y1NA 2H0DB 4YAXA 2FUIA 1MM2A 1WESA 5B78A 2KIZA 4WZ2A 5KH7A 5TABA 5LKXA
chains in the Genus database with same CATH superfamily
2JRJA 1WEWA 3VK6A 2YUCA 2MD7B 3N9NA 4C9ZA 3ZYQA 2ECVA 2LGKA 4LK9A 4R2YA 2YSJA 2LGVA 1WEMA 2CRRA 3O35A 4X3GA 1HYJA 4LLBA 2YURA 4CCGX 2YU4A 5D1LB 2M6MA 4B86C 5AIUA 3FAOA 1U6GB 4BHWA 2L7PA 3H7HA 4I7BA 1X4IA 1F62A 2LAUA 2XOCA 2CRWA 2FD4A 2MA6A 2QICA 2KFTA 4R7EA 3ZVZB 3E2DA 2AN6A 3ZPV1 4IC2A 2YQMA 2CT2A 2KR4A 3FEHA 4GNFA 2LGLA 4R8PK 4YBMA 4N3WA 2ECIA 1X4JA 2CKLB 3RPGB 4AYCA 2YHOA 1BORA 3DWDA 1E4UA 5D1MB 5DINA 1N87A 5B79A 2L5UA 1LDJB 2Y1MA 3KQIA 2CSZA 2FFWA 2ZETC 3FL2A 3HCTA 1WEPA 3PURA 1FP0A 5FEYA 2JMJA 2ECGA 3LQHA 2DX8A 4FJCA 5B77A 1DVPA 2P57A 1V87A 1WEEA 5LKTA 3T6RA 3O33A 4YADA 3PUQA 5SVIA 3NG2A 2YYRA 2MA5A 1DCQA 2VJFA 3I2DA 4B7YC 2D8UA 1ZBDB 2K4DA 2VJEB 3DQVR 2K17A 2LV9A 1WEOA 3N9QA 1WILA 3LVQE 2RSDA 5TDWA 2LXPC 3KV6A 2CKLA 2CSYA 2YQLA 2C2LA 2ECWA 2FUUA 3HCUA 4FIPA 2G45A 3HTKC 5B8DA 4P5OB 3SOUA 2UZGA 3O70A 4YC9A 4L58A 4A4CA 2IDAA 4W4UA 3MHHA 2BAYA 3HCSA 3SOWA 3M62A 2F42A 5FB0A 3MDBC 2MT5A 3LVRE 5I3LA 1JM7B 2DSMA 3N9PA 2KKXA 2E6RA 1LDKC 3L11A 2D8SA 4V3KC 3M99A 3ZTGA 2B0OE 3ASLA 3U5NA 3FANA 3C6WA 4FO9A 1K2FA 4L7XA 5DKAA 5H1UA 2CONA 3SUBA 5J3XA 2Y43A 3T7LA 4MVTA 4I7CA 3C5KA 3SHBA 4PPEA 3KV5A 5B76A 5FB1A 1XWHA 2L43A 3QZVA 4YBTA 2VNFA 2PUYA 2KGGA 2MIQA 3ZNIA 1WIMA 2H0DA 3KDEC 2I50A 2LQ6A 4FK5A 2MD8C 1MBMA 1HYIA 4YATA 2MNZA 2JM3A 1WENA 2M85A 1IYMA 2OWAA 2JMDA 5TRBA 2QIZA 5LKZA 2EXUA 4GB0A 3ZVYA 2PNXA 2KE1A 4GNDA 4LADB 4H9DA 5C11A 2K1JA 3Q1DA 4LJNA 2YREA 2XP0A 2YVRA 5SVXA 3PLWA 1VD4A 4QQ4A 3EB6A 4Z0OA 4WZ0A 5K3QA 4A0CD 2YW8A 2YHNA 4AP4A 4OGEA 1WGMA 5EYAF 1WEVA 4ZUXU 4WA6A 2YSMA 3N9OA 2XB1A 2MKEA 1Z6UA 5FERA 4CA1A 2G6QA 3LJUX 4V3LC 2XEUA 2KGIA 2LRIC 2MNYA 3O37A 4A49A 1CHCA 2KU3A 3GL6A 4PTBA 2HDPA 5H1TA 4O64A 5TBNA 2VPGA 4AUQB 3LDYA 2EGPA 2F6JA 2ECNA 2KYUA 2KWNA 5JG6A 2G43A 1RMDA 2IQJA 2RR4A 3FJUB 5G0FA 2EA6A 2XOZA 5H1VA 4AVXA 3T9KA 3U5MA 4GNEA 5C13A 3N9MA 1T1HA 3MHSA 3O34A 4XI1A 3U5PA 4O62A 2NAAA 2OXQC 3GV4A 4ZDTA 2L0BA 2LN0A 4N4FA 4ZQLA 2M1RA 4S3OB 3LQJA 2FSAA 2VJEA 5D1KB 4F1PA 5KH3A 3IHPA 2KKYA 4Q6FA 2DJAA 4MSXA 2KWKA 2VPBA 1X4UA 3LQIA 5SVIB 3KNVA 2F6NA 3O47A 2VJFB 4UI9B 3EB5A 3N9LA 4S3OC 2ECJA 3DPLR 3O36A 2E6SA 5B75A 2E61A 3M63A 1FBVA 3U5OA 4A4BA 2KWJA 4BBQA 3LRQA 2QJ0A 2KWOA 4LKAA 4IC3A 2HYED 5TDRA 1WEQA 1WE9A 2EGMA 2L75A 4WZ3B 2VP7A 3SOXA 5SVYA 2LXHC 3FM8C 1JM7A 3L1XA 2KREA 2RI7A 4UP5A 1WFKA 2M13A 1VYXA 5KH9A 5G04B 4QF3A 2LDRA 3RPGC 5LKUA 2MUMA 4NN2A 4YBSA 2JMIA 4QF2A 1MM3A 2K16A 4F52B 1Z60A 3RTRB 2YT5A 4UP0A 2L80A 3PHDA 3ZPVE 5AITA 3JUEA 5LCWB 5H9MA 2JUNA 2M3HA 4Z0RA 2EODA 2LGGA 4TKPB 1Z2QA 2VPDA 3DDTA 3O7AA 4OGCA 2VPEA 3L1ZB 3V43A 4GNGA 2CSVA 4I7DA 5G05B 1WEUA 1JOCA 1G25A 1VFYA 4AYCB 4YABA 2ECTA 2C2VS 3M7KA 2Y1NA 2H0DB 4YAXA 2FUIA 1MM2A 1WESA 5B78A 2KIZA 2XOYA 4WZ2A 5KH7A 5TABA 5LKXA
chains in the Genus database with same CATH topology
2JRJA 1WEWA 3VK6A 2YUCA 2MD7B 3N9NA 4C9ZA 3ZYQA 2ECVA 2LGKA 4LK9A 4R2YA 2YSJA 2LGVA 1WEMA 3O35A 4X3GA 1HYJA 4LLBA 2YURA 4CCGX 2YU4A 5D1LB 2M6MA 4B86C 5AIUA 1U6GB 4BHWA 4I7BA 1X4IA 1F62A 2MA6A 2QICA 2KFTA 4R7EA 3ZVZB 2AN6A 3ZPV1 4IC2A 2YQMA 2CT2A 2KR4A 4GNFA 2LGLA 4R8PK 4YBMA 4N3WA 2ECIA 1X4JA 2CKLB 3RPGB 4AYCA 2YHOA 1BORA 1E4UA 5D1MB 5DINA 1N87A 5B79A 2L5UA 1LDJB 2Y1MA 3KQIA 2CSZA 2ZETC 3FL2A 3HCTA 1WEPA 3PURA 1FP0A 5FEYA 2JMJA 2ECGA 3LQHA 2DX8A 4FJCA 5B77A 1DVPA 1V87A 1WEEA 5LKTA 3T6RA 3O33A 4YADA 3PUQA 3NG2A 2YYRA 2MA5A 2VJFA 3I2DA 4B7YC 1ZBDB 2K4DA 2VJEB 3DQVR 2K17A 2LV9A 1WEOA 3N9QA 1WILA 2RSDA 5TDWA 2LXPC 3KV6A 2CKLA 2CSYA 2YQLA 2C2LA 2ECWA 2FUUA 3HCUA 4FIPA 2G45A 3HTKC 5B8DA 4P5OB 3SOUA 2UZGA 3O70A 4YC9A 4L58A 4A4CA 2IDAA 4W4UA 3MHHA 2BAYA 3HCSA 3SOWA 3M62A 2F42A 5FB0A 2MT5A 5I3LA 1JM7B 3N9PA 2E6RA 1LDKC 3L11A 2D8SA 4V3KC 3M99A 3ZTGA 3ASLA 3U5NA 3C6WA 4FO9A 1K2FA 4L7XA 5DKAA 5H1UA 5J3XA 2Y43A 3T7LA 4MVTA 4I7CA 3C5KA 3SHBA 4PPEA 3KV5A 5B76A 5FB1A 1XWHA 2L43A 3QZVA 4YBTA 2VNFA 2PUYA 2KGGA 2MIQA 3ZNIA 1WIMA 2H0DA 2I50A 2LQ6A 4FK5A 2MD8C 1HYIA 4YATA 2MNZA 1WENA 2M85A 1IYMA 2JMDA 5TRBA 2QIZA 5LKZA 4GB0A 3ZVYA 2PNXA 2KE1A 4GNDA 4LADB 5C11A 2K1JA 4LJNA 2YREA 1VD4A 3EB6A 4WZ0A 4A0CD 2YW8A 2YHNA 4AP4A 1WGMA 5EYAF 1WEVA 4ZUXU 4WA6A 2YSMA 3N9OA 2XB1A 1Z6UA 5FERA 4CA1A 2G6QA 4V3LC 2XEUA 2KGIA 2LRIC 2MNYA 3O37A 4A49A 1CHCA 2KU3A 3GL6A 4PTBA 2HDPA 5H1TA 4O64A 5TBNA 2VPGA 4AUQB 2EGPA 2F6JA 2ECNA 2KYUA 2KWNA 5JG6A 2G43A 1RMDA 5G0FA 2EA6A 4AVXA 5H1VA 3U5MA 4GNEA 5C13A 3N9MA 1T1HA 3MHSA 3O34A 4XI1A 3U5PA 2NAAA 2OXQC 3GV4A 4ZDTA 2L0BA 2LN0A 4N4FA 4ZQLA 2M1RA 4S3OB 3LQJA 2FSAA 2VJEA 5D1KB 5KH3A 3IHPA 4Q6FA 4MSXA 2KWKA 2VPBA 1X4UA 3LQIA 3KNVA 2F6NA 2VJFB 4UI9B 3EB5A 3N9LA 4S3OC 2ECJA 3DPLR 3O36A 2E6SA 5B75A 3M63A 1FBVA 3U5OA 4A4BA 2KWJA 4BBQA 3LRQA 2QJ0A 2KWOA 4LKAA 4IC3A 2HYED 5TDRA 1WEQA 1WE9A 2L75A 4WZ3B 2VP7A 3SOXA 2LXHC 1JM7A 3L1XA 2KREA 2RI7A 4UP5A 1WFKA 1VYXA 5KH9A 5G04B 4QF3A 2LDRA 3RPGC 5LKUA 2MUMA 4NN2A 4YBSA 2JMIA 4QF2A 1MM3A 2K16A 4F52B 1Z60A 3RTRB 2YT5A 4UP0A 2L80A 3PHDA 3ZPVE 5AITA 5LCWB 5H9MA 2M3HA 2EODA 2LGGA 4TKPB 1Z2QA 2VPDA 3O7AA 2VPEA 3L1ZB 3V43A 4GNGA 4I7DA 5G05B 1WEUA 1JOCA 1G25A 1VFYA 4AYCB 4YABA 2ECTA 2C2VS 2Y1NA 2H0DB 4YAXA 2FUIA 1MM2A 1WESA 5B78A 2KIZA 4WZ2A 5KH7A 5TABA 5LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRJ A;  1WEW A;  3VK6 A;  2YUC A;  2MD7 B;  3N9N A;  4C9Z A;  3ZYQ A;  2ECV A;  2LGK A;  4LK9 A;  4R2Y A;  2YSJ A;  2LGV A;  1WEM A;  3O35 A;  4X3G A;  1HYJ A;  4LLB A;  2YUR A;  4CCG X;  2YU4 A;  5D1L B;  2M6M A;  4B86 C;  5AIU A;  1U6G B;  4BHW A;  4I7B A;  1X4I A;  1F62 A;  2MA6 A;  2QIC A;  2KFT A;  4R7E A;  3ZVZ B;  2AN6 A;  3ZPV 1;  4IC2 A;  2YQM A;  2CT2 A;  2KR4 A;  4GNF A;  2LGL A;  4R8P K;  4YBM A;  4N3W A;  2ECI A;  1X4J A;  2CKL B;  3RPG B;  4AYC A;  2YHO A;  1BOR A;  1E4U A;  5D1M B;  5DIN A;  1N87 A;  5B79 A;  2L5U A;  1LDJ B;  2Y1M A;  3KQI A;  2CSZ A;  2ZET C;  3FL2 A;  3HCT A;  1WEP A;  3PUR A;  1FP0 A;  5FEY A;  2JMJ A;  2ECG A;  3LQH A;  2DX8 A;  4FJC A;  5B77 A;  1DVP A;  1V87 A;  1WEE A;  5LKT A;  3T6R A;  3O33 A;  4YAD A;  3PUQ A;  3NG2 A;  2YYR A;  2MA5 A;  2VJF A;  3I2D A;  4B7Y C;  1ZBD B;  2K4D A;  2VJE B;  3DQV R;  2K17 A;  2LV9 A;  1WEO A;  3N9Q A;  1WIL A;  2RSD A;  5TDW A;  2LXP C;  3KV6 A;  2CKL A;  2CSY A;  2YQL A;  2C2L A;  2ECW A;  2FUU A;  3HCU A;  4FIP A;  2G45 A;  3HTK C;  5B8D A;  4P5O B;  3SOU A;  2UZG A;  3O70 A;  4YC9 A;  4L58 A;  4A4C A;  2IDA A;  4W4U A;  3MHH A;  2BAY A;  3HCS A;  3SOW A;  3M62 A;  2F42 A;  5FB0 A;  2MT5 A;  5I3L A;  1JM7 B;  3N9P A;  2E6R A;  1LDK C;  3L11 A;  2D8S A;  4V3K C;  3M99 A;  3ZTG A;  3ASL A;  3U5N A;  3C6W A;  4FO9 A;  1K2F A;  4L7X A;  5DKA A;  5H1U A;  5J3X A;  2Y43 A;  3T7L A;  4MVT A;  4I7C A;  3C5K A;  3SHB A;  4PPE A;  3KV5 A;  5B76 A;  5FB1 A;  1XWH A;  2L43 A;  3QZV A;  4YBT A;  2VNF A;  2PUY A;  2KGG A;  2MIQ A;  3ZNI A;  1WIM A;  2H0D A;  2I50 A;  2LQ6 A;  4FK5 A;  2MD8 C;  1HYI A;  4YAT A;  2MNZ A;  1WEN A;  2M85 A;  1IYM A;  2JMD A;  5TRB A;  2QIZ A;  5LKZ A;  4GB0 A;  3ZVY A;  2PNX A;  2KE1 A;  4GND A;  4LAD B;  5C11 A;  2K1J A;  4LJN A;  2YRE A;  1VD4 A;  3EB6 A;  4WZ0 A;  4A0C D;  2YW8 A;  2YHN A;  4AP4 A;  1WGM A;  5EYA F;  1WEV A;  4ZUX U;  4WA6 A;  2YSM A;  3N9O A;  2XB1 A;  1Z6U A;  5FER A;  4CA1 A;  2G6Q A;  4V3L C;  2XEU A;  2KGI A;  2LRI C;  2MNY A;  3O37 A;  4A49 A;  1CHC A;  2KU3 A;  3GL6 A;  4PTB A;  2HDP A;  5H1T A;  4O64 A;  5TBN A;  2VPG A;  4AUQ B;  2EGP A;  2F6J A;  2ECN A;  2KYU A;  2KWN A;  5JG6 A;  2G43 A;  1RMD A;  5G0F A;  2EA6 A;  4AVX A;  5H1V A;  3U5M A;  4GNE A;  5C13 A;  3N9M A;  1T1H A;  3MHS A;  3O34 A;  4XI1 A;  3U5P A;  2NAA A;  2OXQ C;  3GV4 A;  4ZDT A;  2L0B A;  2LN0 A;  4N4F A;  4ZQL A;  2M1R A;  4S3O B;  3LQJ A;  2FSA A;  2VJE A;  5D1K B;  5KH3 A;  3IHP A;  4Q6F A;  4MSX A;  2KWK A;  2VPB A;  1X4U A;  3LQI A;  3KNV A;  2F6N A;  2VJF B;  4UI9 B;  3EB5 A;  3N9L A;  4S3O C;  2ECJ A;  3DPL R;  3O36 A;  2E6S A;  5B75 A;  3M63 A;  1FBV A;  3U5O A;  4A4B A;  2KWJ A;  4BBQ A;  3LRQ A;  2QJ0 A;  2KWO A;  4LKA A;  4IC3 A;  2HYE D;  5TDR A;  1WEQ A;  1WE9 A;  2L75 A;  4WZ3 B;  2VP7 A;  3SOX A;  2LXH C;  1JM7 A;  3L1X A;  2KRE A;  2RI7 A;  4UP5 A;  1WFK A;  1VYX A;  5KH9 A;  5G04 B;  4QF3 A;  2LDR A;  3RPG C;  5LKU A;  2MUM A;  4NN2 A;  4YBS A;  2JMI A;  4QF2 A;  1MM3 A;  2K16 A;  4F52 B;  1Z60 A;  3RTR B;  2YT5 A;  4UP0 A;  2L80 A;  3PHD A;  3ZPV E;  5AIT A;  5LCW B;  5H9M A;  2M3H A;  2EOD A;  2LGG A;  4TKP B;  1Z2Q A;  2VPD A;  3O7A A;  2VPE A;  3L1Z B;  3V43 A;  4GNG A;  4I7D A;  5G05 B;  1WEU A;  1JOC A;  1G25 A;  1VFY A;  4AYC B;  4YAB A;  2ECT A;  2C2V S;  2Y1N A;  2H0D B;  4YAX A;  2FUI A;  1MM2 A;  1WES A;  5B78 A;  2KIZ A;  4WZ2 A;  5KH7 A;  5TAB A;  5LKX A; 
#chains in the Genus database with same CATH topology
 2JRJ A;  1WEW A;  3VK6 A;  2YUC A;  2MD7 B;  3N9N A;  4C9Z A;  3ZYQ A;  2ECV A;  2LGK A;  4LK9 A;  4R2Y A;  2YSJ A;  2LGV A;  1WEM A;  2CRR A;  3O35 A;  4X3G A;  1HYJ A;  4LLB A;  2YUR A;  4CCG X;  2YU4 A;  5D1L B;  2M6M A;  4B86 C;  5AIU A;  3FAO A;  1U6G B;  4BHW A;  2L7P A;  3H7H A;  4I7B A;  1X4I A;  1F62 A;  2LAU A;  2XOC A;  2CRW A;  2FD4 A;  2MA6 A;  2QIC A;  2KFT A;  4R7E A;  3ZVZ B;  3E2D A;  2AN6 A;  3ZPV 1;  4IC2 A;  2YQM A;  2CT2 A;  2KR4 A;  3FEH A;  4GNF A;  2LGL A;  4R8P K;  4YBM A;  4N3W A;  2ECI A;  1X4J A;  2CKL B;  3RPG B;  4AYC A;  2YHO A;  1BOR A;  3DWD A;  1E4U A;  5D1M B;  5DIN A;  1N87 A;  5B79 A;  2L5U A;  1LDJ B;  2Y1M A;  3KQI A;  2CSZ A;  2FFW A;  2ZET C;  3FL2 A;  3HCT A;  1WEP A;  3PUR A;  1FP0 A;  5FEY A;  2JMJ A;  2ECG A;  3LQH A;  2DX8 A;  4FJC A;  5B77 A;  1DVP A;  2P57 A;  1V87 A;  1WEE A;  5LKT A;  3T6R A;  3O33 A;  4YAD A;  3PUQ A;  5SVI A;  3NG2 A;  2YYR A;  2MA5 A;  1DCQ A;  2VJF A;  3I2D A;  4B7Y C;  2D8U A;  1ZBD B;  2K4D A;  2VJE B;  3DQV R;  2K17 A;  2LV9 A;  1WEO A;  3N9Q A;  1WIL A;  3LVQ E;  2RSD A;  5TDW A;  2LXP C;  3KV6 A;  2CKL A;  2CSY A;  2YQL A;  2C2L A;  2ECW A;  2FUU A;  3HCU A;  4FIP A;  2G45 A;  3HTK C;  5B8D A;  4P5O B;  3SOU A;  2UZG A;  3O70 A;  4YC9 A;  4L58 A;  4A4C A;  2IDA A;  4W4U A;  3MHH A;  2BAY A;  3HCS A;  3SOW A;  3M62 A;  2F42 A;  5FB0 A;  3MDB C;  2MT5 A;  3LVR E;  5I3L A;  1JM7 B;  2DSM A;  3N9P A;  2KKX A;  2E6R A;  1LDK C;  3L11 A;  2D8S A;  4V3K C;  3M99 A;  3ZTG A;  2B0O E;  3ASL A;  3U5N A;  3FAN A;  3C6W A;  4FO9 A;  1K2F A;  4L7X A;  5DKA A;  5H1U A;  2CON A;  3SUB A;  5J3X A;  2Y43 A;  3T7L A;  4MVT A;  4I7C A;  3C5K A;  3SHB A;  4PPE A;  3KV5 A;  5B76 A;  5FB1 A;  1XWH A;  2L43 A;  3QZV A;  4YBT A;  2VNF A;  2PUY A;  2KGG A;  2MIQ A;  3ZNI A;  1WIM A;  2H0D A;  3KDE C;  2I50 A;  2LQ6 A;  4FK5 A;  2MD8 C;  1MBM A;  1HYI A;  4YAT A;  2MNZ A;  2JM3 A;  1WEN A;  2M85 A;  1IYM A;  2OWA A;  2JMD A;  5TRB A;  2QIZ A;  5LKZ A;  2EXU A;  4GB0 A;  3ZVY A;  2PNX A;  2KE1 A;  4GND A;  4LAD B;  4H9D A;  5C11 A;  2K1J A;  3Q1D A;  4LJN A;  2YRE A;  2XP0 A;  2YVR A;  5SVX A;  3PLW A;  1VD4 A;  4QQ4 A;  3EB6 A;  4Z0O A;  4WZ0 A;  5K3Q A;  4A0C D;  2YW8 A;  2YHN A;  4AP4 A;  4OGE A;  1WGM A;  5EYA F;  1WEV A;  4ZUX U;  4WA6 A;  2YSM A;  3N9O A;  2XB1 A;  2MKE A;  1Z6U A;  5FER A;  4CA1 A;  2G6Q A;  3LJU X;  4V3L C;  2XEU A;  2KGI A;  2LRI C;  2MNY A;  3O37 A;  4A49 A;  1CHC A;  2KU3 A;  3GL6 A;  4PTB A;  2HDP A;  5H1T A;  4O64 A;  5TBN A;  2VPG A;  4AUQ B;  3LDY A;  2EGP A;  2F6J A;  2ECN A;  2KYU A;  2KWN A;  5JG6 A;  2G43 A;  1RMD A;  2IQJ A;  2RR4 A;  3FJU B;  5G0F A;  2EA6 A;  2XOZ A;  5H1V A;  4AVX A;  3T9K A;  3U5M A;  4GNE A;  5C13 A;  3N9M A;  1T1H A;  3MHS A;  3O34 A;  4XI1 A;  3U5P A;  4O62 A;  2NAA A;  2OXQ C;  3GV4 A;  4ZDT A;  2L0B A;  2LN0 A;  4N4F A;  4ZQL A;  2M1R A;  4S3O B;  3LQJ A;  2FSA A;  2VJE A;  5D1K B;  4F1P A;  5KH3 A;  3IHP A;  2KKY A;  4Q6F A;  2DJA A;  4MSX A;  2KWK A;  2VPB A;  1X4U A;  3LQI A;  5SVI B;  3KNV A;  2F6N A;  3O47 A;  2VJF B;  4UI9 B;  3EB5 A;  3N9L A;  4S3O C;  2ECJ A;  3DPL R;  3O36 A;  2E6S A;  5B75 A;  2E61 A;  3M63 A;  1FBV A;  3U5O A;  4A4B A;  2KWJ A;  4BBQ A;  3LRQ A;  2QJ0 A;  2KWO A;  4LKA A;  4IC3 A;  2HYE D;  5TDR A;  1WEQ A;  1WE9 A;  2EGM A;  2L75 A;  4WZ3 B;  2VP7 A;  3SOX A;  5SVY A;  2LXH C;  3FM8 C;  1JM7 A;  3L1X A;  2KRE A;  2RI7 A;  4UP5 A;  1WFK A;  2M13 A;  1VYX A;  5KH9 A;  5G04 B;  4QF3 A;  2LDR A;  3RPG C;  5LKU A;  2MUM A;  4NN2 A;  4YBS A;  2JMI A;  4QF2 A;  1MM3 A;  2K16 A;  4F52 B;  1Z60 A;  3RTR B;  2YT5 A;  4UP0 A;  2L80 A;  3PHD A;  3ZPV E;  5AIT A;  3JUE A;  5LCW B;  5H9M A;  2JUN A;  2M3H A;  4Z0R A;  2EOD A;  2LGG A;  4TKP B;  1Z2Q A;  2VPD A;  3DDT A;  3O7A A;  4OGC A;  2VPE A;  3L1Z B;  3V43 A;  4GNG A;  2CSV A;  4I7D A;  5G05 B;  1WEU A;  1JOC A;  1G25 A;  1VFY A;  4AYC B;  4YAB A;  2ECT A;  2C2V S;  3M7K A;  2Y1N A;  2H0D B;  4YAX A;  2FUI A;  1MM2 A;  1WES A;  5B78 A;  2KIZ A;  2XOY A;  4WZ2 A;  5KH7 A;  5TAB A;  5LKX A; 
#chains in the Genus database with same CATH homology
 2JRJ A;  1WEW A;  3VK6 A;  2YUC A;  2MD7 B;  3N9N A;  4C9Z A;  3ZYQ A;  2ECV A;  2LGK A;  4LK9 A;  4R2Y A;  2YSJ A;  2LGV A;  1WEM A;  3O35 A;  4X3G A;  1HYJ A;  4LLB A;  2YUR A;  4CCG X;  2YU4 A;  5D1L B;  2M6M A;  4B86 C;  5AIU A;  1U6G B;  4BHW A;  4I7B A;  1X4I A;  1F62 A;  2MA6 A;  2QIC A;  2KFT A;  4R7E A;  3ZVZ B;  2AN6 A;  3ZPV 1;  4IC2 A;  2YQM A;  2CT2 A;  2KR4 A;  4GNF A;  2LGL A;  4R8P K;  4YBM A;  4N3W A;  2ECI A;  1X4J A;  2CKL B;  3RPG B;  4AYC A;  2YHO A;  1BOR A;  1E4U A;  5D1M B;  5DIN A;  1N87 A;  5B79 A;  2L5U A;  1LDJ B;  2Y1M A;  3KQI A;  2CSZ A;  2ZET C;  3FL2 A;  3HCT A;  1WEP A;  3PUR A;  1FP0 A;  5FEY A;  2JMJ A;  2ECG A;  3LQH A;  2DX8 A;  4FJC A;  5B77 A;  1DVP A;  1V87 A;  1WEE A;  5LKT A;  3T6R A;  3O33 A;  4YAD A;  3PUQ A;  3NG2 A;  2YYR A;  2MA5 A;  2VJF A;  3I2D A;  4B7Y C;  1ZBD B;  2K4D A;  2VJE B;  3DQV R;  2K17 A;  2LV9 A;  1WEO A;  3N9Q A;  1WIL A;  2RSD A;  5TDW A;  2LXP C;  3KV6 A;  2CKL A;  2CSY A;  2YQL A;  2C2L A;  2ECW A;  2FUU A;  3HCU A;  4FIP A;  2G45 A;  3HTK C;  5B8D A;  4P5O B;  3SOU A;  2UZG A;  3O70 A;  4YC9 A;  4L58 A;  4A4C A;  2IDA A;  4W4U A;  3MHH A;  2BAY A;  3HCS A;  3SOW A;  3M62 A;  2F42 A;  5FB0 A;  2MT5 A;  5I3L A;  1JM7 B;  3N9P A;  2E6R A;  1LDK C;  3L11 A;  2D8S A;  4V3K C;  3M99 A;  3ZTG A;  3ASL A;  3U5N A;  3C6W A;  4FO9 A;  1K2F A;  4L7X A;  5DKA A;  5H1U A;  5J3X A;  2Y43 A;  3T7L A;  4MVT A;  4I7C A;  3C5K A;  3SHB A;  4PPE A;  3KV5 A;  5B76 A;  5FB1 A;  1XWH A;  2L43 A;  3QZV A;  4YBT A;  2VNF A;  2PUY A;  2KGG A;  2MIQ A;  3ZNI A;  1WIM A;  2H0D A;  2I50 A;  2LQ6 A;  4FK5 A;  2MD8 C;  1HYI A;  4YAT A;  2MNZ A;  1WEN A;  2M85 A;  1IYM A;  2JMD A;  5TRB A;  2QIZ A;  5LKZ A;  4GB0 A;  3ZVY A;  2PNX A;  2KE1 A;  4GND A;  4LAD B;  5C11 A;  2K1J A;  4LJN A;  2YRE A;  1VD4 A;  3EB6 A;  4WZ0 A;  4A0C D;  2YW8 A;  2YHN A;  4AP4 A;  1WGM A;  5EYA F;  1WEV A;  4ZUX U;  4WA6 A;  2YSM A;  3N9O A;  2XB1 A;  1Z6U A;  5FER A;  4CA1 A;  2G6Q A;  4V3L C;  2XEU A;  2KGI A;  2LRI C;  2MNY A;  3O37 A;  4A49 A;  1CHC A;  2KU3 A;  3GL6 A;  4PTB A;  2HDP A;  5H1T A;  4O64 A;  5TBN A;  2VPG A;  4AUQ B;  2EGP A;  2F6J A;  2ECN A;  2KYU A;  2KWN A;  5JG6 A;  2G43 A;  1RMD A;  5G0F A;  2EA6 A;  4AVX A;  5H1V A;  3U5M A;  4GNE A;  5C13 A;  3N9M A;  1T1H A;  3MHS A;  3O34 A;  4XI1 A;  3U5P A;  2NAA A;  2OXQ C;  3GV4 A;  4ZDT A;  2L0B A;  2LN0 A;  4N4F A;  4ZQL A;  2M1R A;  4S3O B;  3LQJ A;  2FSA A;  2VJE A;  5D1K B;  5KH3 A;  3IHP A;  4Q6F A;  4MSX A;  2KWK A;  2VPB A;  1X4U A;  3LQI A;  3KNV A;  2F6N A;  2VJF B;  4UI9 B;  3EB5 A;  3N9L A;  4S3O C;  2ECJ A;  3DPL R;  3O36 A;  2E6S A;  5B75 A;  3M63 A;  1FBV A;  3U5O A;  4A4B A;  2KWJ A;  4BBQ A;  3LRQ A;  2QJ0 A;  2KWO A;  4LKA A;  4IC3 A;  2HYE D;  5TDR A;  1WEQ A;  1WE9 A;  2L75 A;  4WZ3 B;  2VP7 A;  3SOX A;  2LXH C;  1JM7 A;  3L1X A;  2KRE A;  2RI7 A;  4UP5 A;  1WFK A;  1VYX A;  5KH9 A;  5G04 B;  4QF3 A;  2LDR A;  3RPG C;  5LKU A;  2MUM A;  4NN2 A;  4YBS A;  2JMI A;  4QF2 A;  1MM3 A;  2K16 A;  4F52 B;  1Z60 A;  3RTR B;  2YT5 A;  4UP0 A;  2L80 A;  3PHD A;  3ZPV E;  5AIT A;  5LCW B;  5H9M A;  2M3H A;  2EOD A;  2LGG A;  4TKP B;  1Z2Q A;  2VPD A;  3O7A A;  2VPE A;  3L1Z B;  3V43 A;  4GNG A;  4I7D A;  5G05 B;  1WEU A;  1JOC A;  1G25 A;  1VFY A;  4AYC B;  4YAB A;  2ECT A;  2C2V S;  2Y1N A;  2H0D B;  4YAX A;  2FUI A;  1MM2 A;  1WES A;  5B78 A;  2KIZ A;  4WZ2 A;  5KH7 A;  5TAB A;  5LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...