4WZ3B

Crystal structure of the complex between lubx/legu2/lpp2887 u-box 1 and homo sapiens ube2d2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
183
structure length
183
Chain Sequence
b'RNPFDIDHKSKYLREAALEANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVAARQKEYTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 183
sequence length 183
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz3B02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz3B01
3C6WA 2KIZA 3SHBA 1HYIA 4FJCA 3IHPA 1Z2QA 1MM2A 4N4FA 1X4JA 4A49A 2LRIC 3ZPV1 3NG2A 3EB6A 2YT5A 4IC2A 2VP7A 4GNGA 4R2YA 5B75A 5LCWB 3LQJA 2HYED 4L58A 5JG6A 2LN0A 2I50A 5KH7A 5KH9A 4LJNA 2YQLA 2K16A 4IC3A 1IYMA 4LK9A 4WA6A 4AUQB 2YYRA 3U5MA 4CCGX 4WZ2A 3MHSA 5FB1A 3EB5A 2EODA 2YSMA 3HTKC 4L7XA 1WEWA 2CKLB 5TDWA 4I7BA 2MA6A 2ECIA 4X3GA 3T7LA 3M62A 4ZUXU 5TBNA 4YABA 2VPBA 1E4UA 3M99A 3O7AA 4FK5A 5B77A 3ZPVE 4NN2A 2IDAA 2CSZA 2DX8A 4LLBA 2C2LA 4UP5A 1WE9A 4MVTA 4GB0A 4V3LC 1XWHA 2YHOA 5TDRA 1K2FA 4CA1A 1FP0A 3SOUA 2QJ0A 1V87A 2KU3A 1JM7B 4QF2A 2E6RA 3ZVZB 3T6RA 3KV5A 2EA6A 4YATA 1DVPA 2KFTA 1WEEA 1WESA 2OXQC 2KYUA 4W4UA 4V3KC 5C11A 3LQHA 2MA5A 4I7CA 4B7YC 3L11A 1Z60A 1U6GB 4F52B 1BORA 1LDKC 2JRJA 4A4CA 2CSYA 3ZTGA 3N9LA 3N9OA 2M85A 2C2VS 4BBQA 1WIMA 2YURA 4YBMA 4YAXA 5G0FA 3HCUA 1JM7A 5LKUA 3N9MA 2KWKA 3O34A 2JMJA 2XB1A 4AP4A 2KREA 2KGIA 3ASLA 4UP0A 3N9PA 4WZ0A 2L75A 2ECVA 2YU4A 1F62A 4B86C 2VNFA 3KQIA 2VJFB 2MT5A 3PHDA 1VFYA 2F6NA 2MD8C 2VPEA 5C13A 2LXHC 5LKZA 1X4IA 3L1ZB 4I7DA 3LRQA 3U5OA 1WEVA 4YBTA 2MD7B 5TABA 2MUMA 2RSDA 3QZVA 3KV6A 2YREA 5G05B 2G45A 4PTBA 2YQMA 4Q6FA 2KWJA 3O33A 5G04B 3DPLR 2Y1MA 3V43A 1WEQA 4WZ3B 3I2DA 5B79A 5FB0A 4P5OB 2KGGA 5EYAF 2ZETC 5H1UA 2JMIA 1N87A 1WEPA 4GNFA 3KNVA 5D1LB 2L5UA 4PPEA 4C9ZA 3ZYQA 2KR4A 2D8SA 2M3HA 1T1HA 1MM3A 2LGGA 2YUCA 2LGVA 4XI1A 4YC9A 2LGLA 2CKLA 2QICA 1G25A 4O64A 4UI9B 2XEUA 5FERA 2CT2A 4AYCB 5LKXA 2UZGA 5I3LA 3RTRB 4FO9A 2H0DB 2AN6A 1WILA 1LDJB 3L1XA 3LQIA 2ECJA 4YBSA 2ECWA 2LXPC 4LADB 2YHNA 2K17A 3M63A 5TRBA 3O35A 1VYXA 1WEOA 4LKAA 2LQ6A 2L80A 4R8PK 5H9MA 3HCTA 3O36A 3FL2A 3N9NA 2Y1NA 2FUUA 2KWNA 2MNZA 3HCSA 5B78A 5B76A 2M6MA 4AYCA 2LV9A 2PUYA 4BHWA 1CHCA 4ZQLA 2MIQA 3ZVYA 2KE1A 4MSXA 2HDPA 5AIUA 2H0DA 2FSAA 2MNYA 2VPDA 1X4UA 2M1RA 2VJEB 1JOCA 1WENA 1RMDA 3SOXA 5D1KB 4A4BA 2YSJA 2LDRA 2ECGA 2ECTA 1WEUA 3GL6A 3GV4A 2VPGA 2NAAA 2K1JA 4TKPB 3C5KA 1FBVA 3U5NA 5FEYA 3RPGB 3RPGC 3O37A 1WGMA 5KH3A 1HYJA 2F42A 2ECNA 1WFKA 2K4DA 5B8DA 5DINA 2BAYA 3MHHA 2VJFA 4GNEA 5DKAA 2RI7A 2LGKA 2L0BA 4GNDA 4ZDTA 5D1MB 3DQVR 4R7EA 1ZBDB 3PURA 2VJEA 5AITA 2E6SA 4S3OB 4S3OC 3N9QA 3O70A 4FIPA 2G43A 2L43A 2FUIA 2Y43A 3ZNIA 4QF3A 5H1TA 1Z6UA 2G6QA 2EGPA 3U5PA 3PUQA 2F6JA 1WEMA 4A0CD 4AVXA 5H1VA 5LKTA 2PNXA 2JMDA 2QIZA 5J3XA 4YADA 2KWOA 2YW8A 4N3WA 3VK6A 1VD4A 3SOWA
chains in the Genus database with same CATH superfamily
3C6WA 2KIZA 3SHBA 1HYIA 4FJCA 2KKXA 3IHPA 1Z2QA 2EGMA 1MM2A 4N4FA 1X4JA 4A49A 2LRIC 3ZPV1 3NG2A 3EB6A 3Q1DA 2YT5A 3KDEC 4IC2A 2VP7A 4GNGA 4R2YA 5B75A 2MKEA 4Z0OA 5LCWB 3LQJA 2HYED 4L58A 5JG6A 2LN0A 2I50A 3LVQE 5KH7A 5KH9A 4LJNA 4H9DA 2YQLA 2K16A 4IC3A 1IYMA 2CRRA 4LK9A 4WA6A 4AUQB 2YYRA 3U5MA 4CCGX 4WZ2A 3MHSA 5FB1A 3EB5A 2FFWA 2EODA 3DWDA 2YSMA 3HTKC 4L7XA 1WEWA 2CKLB 5TDWA 4I7BA 2MA6A 2ECIA 4X3GA 3T7LA 3M62A 4ZUXU 5TBNA 4YABA 2VPBA 1E4UA 5SVIB 3M99A 3O7AA 1MBMA 4FK5A 3E2DA 5B77A 3ZPVE 4NN2A 2IDAA 2CSZA 2XP0A 2DX8A 4LLBA 2C2LA 4UP5A 1WE9A 4MVTA 4GB0A 4V3LC 1XWHA 2KKYA 2YHOA 5TDRA 1K2FA 4CA1A 1FP0A 3SOUA 2QJ0A 1V87A 3FANA 2KU3A 1JM7B 4QF2A 2E6RA 3ZVZB 3T6RA 3KV5A 2EA6A 4YATA 1DVPA 2KFTA 1WEEA 1WESA 2OXQC 4Z0RA 2LAUA 2KYUA 4W4UA 2CRWA 4V3KC 2DSMA 5SVIA 5C11A 3FJUB 3LQHA 2MA5A 4I7CA 4B7YC 3L11A 1Z60A 1DCQA 1U6GB 4F52B 1BORA 1LDKC 2JRJA 4A4CA 2CSYA 3ZTGA 3N9LA 3FAOA 3N9OA 2M85A 2C2VS 4BBQA 1WIMA 2YURA 4YBMA 4YAXA 5G0FA 3HCUA 1JM7A 5LKUA 3N9MA 2KWKA 3LDYA 3O34A 2JMJA 2XB1A 4AP4A 2KREA 2KGIA 3ASLA 4UP0A 3N9PA 4WZ0A 5SVYA 2L75A 2ECVA 2YU4A 1F62A 4B86C 2VNFA 3KQIA 2VJFB 2MT5A 4F1PA 3PHDA 1VFYA 2F6NA 2MD8C 2VPEA 5C13A 2LXHC 2CONA 5LKZA 1X4IA 3L1ZB 4I7DA 2IQJA 3LRQA 3U5OA 1WEVA 4YBTA 3H7HA 4OGEA 2MD7B 5TABA 2MUMA 2RSDA 3QZVA 3KV6A 2YREA 5G05B 4OGCA 2G45A 4PTBA 2YQMA 4Q6FA 2KWJA 3O33A 5G04B 3DPLR 2Y1MA 3V43A 1WEQA 4WZ3B 3I2DA 5B79A 5FB0A 4P5OB 2KGGA 5EYAF 5SVXA 2ZETC 5H1UA 2JMIA 1N87A 1WEPA 4GNFA 2CSVA 3KNVA 5D1LB 2L5UA 2RR4A 4PPEA 4C9ZA 3ZYQA 2KR4A 2D8SA 2M3HA 1T1HA 1MM3A 2LGGA 2YUCA 2JM3A 2LGVA 2YVRA 4XI1A 4YC9A 2B0OE 2LGLA 2CKLA 2QICA 1G25A 4O64A 4UI9B 2XEUA 5FERA 3SUBA 2CT2A 4AYCB 5LKXA 2UZGA 5I3LA 3RTRB 4FO9A 2EXUA 2H0DB 2P57A 2AN6A 1WILA 1LDJB 3L1XA 3PLWA 3LQIA 2ECJA 4YBSA 2ECWA 2LXPC 4LADB 2YHNA 2K17A 3M63A 4QQ4A 3T9KA 5TRBA 4O62A 3O35A 1VYXA 1WEOA 4LKAA 2LQ6A 2L80A 4R8PK 5H9MA 3HCTA 3O36A 3FL2A 3N9NA 2Y1NA 2FUUA 2KWNA 5K3QA 2MNZA 3HCSA 5B78A 5B76A 2M6MA 2OWAA 4AYCA 2LV9A 2PUYA 4BHWA 1CHCA 4ZQLA 2MIQA 2E61A 3ZVYA 2KE1A 4MSXA 2HDPA 5AIUA 2H0DA 2JUNA 2FSAA 2MNYA 2FD4A 2VPDA 1X4UA 2M1RA 3O47A 3DDTA 2VJEB 1JOCA 1WENA 1RMDA 3SOXA 5D1KB 4A4BA 2YSJA 2LDRA 3FM8C 2ECGA 2ECTA 1WEUA 3GL6A 3GV4A 2M13A 2VPGA 2NAAA 2K1JA 4TKPB 2XOYA 3C5KA 1FBVA 3U5NA 5FEYA 3RPGB 3RPGC 3O37A 1WGMA 5KH3A 1HYJA 2F42A 2ECNA 1WFKA 3MDBC 2XOZA 2K4DA 5B8DA 5DINA 2BAYA 3MHHA 2VJFA 4GNEA 5DKAA 3LJUX 2RI7A 2XOCA 2LGKA 2L0BA 4GNDA 4ZDTA 2L7PA 5D1MB 3DQVR 4R7EA 1ZBDB 3PURA 3FEHA 2VJEA 5AITA 2DJAA 2E6SA 4S3OB 4S3OC 3N9QA 3O70A 4FIPA 2G43A 2L43A 2FUIA 2Y43A 3ZNIA 4QF3A 5H1TA 1Z6UA 2G6QA 2EGPA 3U5PA 3PUQA 3LVRE 2F6JA 1WEMA 4A0CD 4AVXA 5H1VA 5LKTA 2PNXA 2JMDA 3JUEA 2QIZA 5J3XA 3M7KA 2D8UA 4YADA 2KWOA 2YW8A 4N3WA 3VK6A 1VD4A 3SOWA
chains in the Genus database with same CATH topology
3C6WA 2KIZA 3SHBA 1HYIA 4FJCA 3IHPA 1Z2QA 1MM2A 4N4FA 1X4JA 4A49A 2LRIC 3ZPV1 3NG2A 3EB6A 2YT5A 4IC2A 2VP7A 4GNGA 4R2YA 5B75A 5LCWB 3LQJA 2HYED 4L58A 5JG6A 2LN0A 2I50A 5KH7A 5KH9A 4LJNA 2YQLA 2K16A 4IC3A 1IYMA 4LK9A 4WA6A 4AUQB 2YYRA 3U5MA 4CCGX 4WZ2A 3MHSA 5FB1A 3EB5A 2EODA 2YSMA 3HTKC 4L7XA 1WEWA 2CKLB 5TDWA 4I7BA 2MA6A 2ECIA 4X3GA 3T7LA 3M62A 4ZUXU 5TBNA 4YABA 2VPBA 1E4UA 3M99A 3O7AA 4FK5A 5B77A 3ZPVE 4NN2A 2IDAA 2CSZA 2DX8A 4LLBA 2C2LA 4UP5A 1WE9A 4MVTA 4GB0A 4V3LC 1XWHA 2YHOA 5TDRA 1K2FA 4CA1A 1FP0A 3SOUA 2QJ0A 1V87A 2KU3A 1JM7B 4QF2A 2E6RA 3ZVZB 3T6RA 3KV5A 2EA6A 4YATA 1DVPA 2KFTA 1WEEA 1WESA 2OXQC 2KYUA 4W4UA 4V3KC 5C11A 3LQHA 2MA5A 4I7CA 4B7YC 3L11A 1Z60A 1U6GB 4F52B 1BORA 1LDKC 2JRJA 4A4CA 2CSYA 3ZTGA 3N9LA 3N9OA 2M85A 2C2VS 4BBQA 1WIMA 2YURA 4YBMA 4YAXA 5G0FA 3HCUA 1JM7A 5LKUA 3N9MA 2KWKA 3O34A 2JMJA 2XB1A 4AP4A 2KREA 2KGIA 3ASLA 4UP0A 3N9PA 4WZ0A 2L75A 2ECVA 2YU4A 1F62A 4B86C 2VNFA 3KQIA 2VJFB 2MT5A 3PHDA 1VFYA 2F6NA 2MD8C 2VPEA 5C13A 2LXHC 5LKZA 1X4IA 3L1ZB 4I7DA 3LRQA 3U5OA 1WEVA 4YBTA 2MD7B 5TABA 2MUMA 2RSDA 3QZVA 3KV6A 2YREA 5G05B 2G45A 4PTBA 2YQMA 4Q6FA 2KWJA 3O33A 5G04B 3DPLR 2Y1MA 3V43A 1WEQA 4WZ3B 3I2DA 5B79A 5FB0A 4P5OB 2KGGA 5EYAF 2ZETC 5H1UA 2JMIA 1N87A 1WEPA 4GNFA 3KNVA 5D1LB 2L5UA 4PPEA 4C9ZA 3ZYQA 2KR4A 2D8SA 2M3HA 1T1HA 1MM3A 2LGGA 2YUCA 2LGVA 4XI1A 4YC9A 2LGLA 2CKLA 2QICA 1G25A 4O64A 4UI9B 2XEUA 5FERA 2CT2A 4AYCB 5LKXA 2UZGA 5I3LA 3RTRB 4FO9A 2H0DB 2AN6A 1WILA 1LDJB 3L1XA 3LQIA 2ECJA 4YBSA 2ECWA 2LXPC 4LADB 2YHNA 2K17A 3M63A 5TRBA 3O35A 1VYXA 1WEOA 4LKAA 2LQ6A 2L80A 4R8PK 5H9MA 3HCTA 3O36A 3FL2A 3N9NA 2Y1NA 2FUUA 2KWNA 2MNZA 3HCSA 5B78A 5B76A 2M6MA 4AYCA 2LV9A 2PUYA 4BHWA 1CHCA 4ZQLA 2MIQA 3ZVYA 2KE1A 4MSXA 2HDPA 5AIUA 2H0DA 2FSAA 2MNYA 2VPDA 1X4UA 2M1RA 2VJEB 1JOCA 1WENA 1RMDA 3SOXA 5D1KB 4A4BA 2YSJA 2LDRA 2ECGA 2ECTA 1WEUA 3GL6A 3GV4A 2VPGA 2NAAA 2K1JA 4TKPB 3C5KA 1FBVA 3U5NA 5FEYA 3RPGB 3RPGC 3O37A 1WGMA 5KH3A 1HYJA 2F42A 2ECNA 1WFKA 2K4DA 5B8DA 5DINA 2BAYA 3MHHA 2VJFA 4GNEA 5DKAA 2RI7A 2LGKA 2L0BA 4GNDA 4ZDTA 5D1MB 3DQVR 4R7EA 1ZBDB 3PURA 2VJEA 5AITA 2E6SA 4S3OB 4S3OC 3N9QA 3O70A 4FIPA 2G43A 2L43A 2FUIA 2Y43A 3ZNIA 4QF3A 5H1TA 1Z6UA 2G6QA 2EGPA 3U5PA 3PUQA 2F6JA 1WEMA 4A0CD 4AVXA 5H1VA 5LKTA 2PNXA 2JMDA 2QIZA 5J3XA 4YADA 2KWOA 2YW8A 4N3WA 3VK6A 1VD4A 3SOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6W A;  2KIZ A;  3SHB A;  1HYI A;  4FJC A;  3IHP A;  1Z2Q A;  1MM2 A;  4N4F A;  1X4J A;  4A49 A;  2LRI C;  3ZPV 1;  3NG2 A;  3EB6 A;  2YT5 A;  4IC2 A;  2VP7 A;  4GNG A;  4R2Y A;  5B75 A;  5LCW B;  3LQJ A;  2HYE D;  4L58 A;  5JG6 A;  2LN0 A;  2I50 A;  5KH7 A;  5KH9 A;  4LJN A;  2YQL A;  2K16 A;  4IC3 A;  1IYM A;  4LK9 A;  4WA6 A;  4AUQ B;  2YYR A;  3U5M A;  4CCG X;  4WZ2 A;  3MHS A;  5FB1 A;  3EB5 A;  2EOD A;  2YSM A;  3HTK C;  4L7X A;  1WEW A;  2CKL B;  5TDW A;  4I7B A;  2MA6 A;  2ECI A;  4X3G A;  3T7L A;  3M62 A;  4ZUX U;  5TBN A;  4YAB A;  2VPB A;  1E4U A;  3M99 A;  3O7A A;  4FK5 A;  5B77 A;  3ZPV E;  4NN2 A;  2IDA A;  2CSZ A;  2DX8 A;  4LLB A;  2C2L A;  4UP5 A;  1WE9 A;  4MVT A;  4GB0 A;  4V3L C;  1XWH A;  2YHO A;  5TDR A;  1K2F A;  4CA1 A;  1FP0 A;  3SOU A;  2QJ0 A;  1V87 A;  2KU3 A;  1JM7 B;  4QF2 A;  2E6R A;  3ZVZ B;  3T6R A;  3KV5 A;  2EA6 A;  4YAT A;  1DVP A;  2KFT A;  1WEE A;  1WES A;  2OXQ C;  2KYU A;  4W4U A;  4V3K C;  5C11 A;  3LQH A;  2MA5 A;  4I7C A;  4B7Y C;  3L11 A;  1Z60 A;  1U6G B;  4F52 B;  1BOR A;  1LDK C;  2JRJ A;  4A4C A;  2CSY A;  3ZTG A;  3N9L A;  3N9O A;  2M85 A;  2C2V S;  4BBQ A;  1WIM A;  2YUR A;  4YBM A;  4YAX A;  5G0F A;  3HCU A;  1JM7 A;  5LKU A;  3N9M A;  2KWK A;  3O34 A;  2JMJ A;  2XB1 A;  4AP4 A;  2KRE A;  2KGI A;  3ASL A;  4UP0 A;  3N9P A;  4WZ0 A;  2L75 A;  2ECV A;  2YU4 A;  1F62 A;  4B86 C;  2VNF A;  3KQI A;  2VJF B;  2MT5 A;  3PHD A;  1VFY A;  2F6N A;  2MD8 C;  2VPE A;  5C13 A;  2LXH C;  5LKZ A;  1X4I A;  3L1Z B;  4I7D A;  3LRQ A;  3U5O A;  1WEV A;  4YBT A;  2MD7 B;  5TAB A;  2MUM A;  2RSD A;  3QZV A;  3KV6 A;  2YRE A;  5G05 B;  2G45 A;  4PTB A;  2YQM A;  4Q6F A;  2KWJ A;  3O33 A;  5G04 B;  3DPL R;  2Y1M A;  3V43 A;  1WEQ A;  4WZ3 B;  3I2D A;  5B79 A;  5FB0 A;  4P5O B;  2KGG A;  5EYA F;  2ZET C;  5H1U A;  2JMI A;  1N87 A;  1WEP A;  4GNF A;  3KNV A;  5D1L B;  2L5U A;  4PPE A;  4C9Z A;  3ZYQ A;  2KR4 A;  2D8S A;  2M3H A;  1T1H A;  1MM3 A;  2LGG A;  2YUC A;  2LGV A;  4XI1 A;  4YC9 A;  2LGL A;  2CKL A;  2QIC A;  1G25 A;  4O64 A;  4UI9 B;  2XEU A;  5FER A;  2CT2 A;  4AYC B;  5LKX A;  2UZG A;  5I3L A;  3RTR B;  4FO9 A;  2H0D B;  2AN6 A;  1WIL A;  1LDJ B;  3L1X A;  3LQI A;  2ECJ A;  4YBS A;  2ECW A;  2LXP C;  4LAD B;  2YHN A;  2K17 A;  3M63 A;  5TRB A;  3O35 A;  1VYX A;  1WEO A;  4LKA A;  2LQ6 A;  2L80 A;  4R8P K;  5H9M A;  3HCT A;  3O36 A;  3FL2 A;  3N9N A;  2Y1N A;  2FUU A;  2KWN A;  2MNZ A;  3HCS A;  5B78 A;  5B76 A;  2M6M A;  4AYC A;  2LV9 A;  2PUY A;  4BHW A;  1CHC A;  4ZQL A;  2MIQ A;  3ZVY A;  2KE1 A;  4MSX A;  2HDP A;  5AIU A;  2H0D A;  2FSA A;  2MNY A;  2VPD A;  1X4U A;  2M1R A;  2VJE B;  1JOC A;  1WEN A;  1RMD A;  3SOX A;  5D1K B;  4A4B A;  2YSJ A;  2LDR A;  2ECG A;  2ECT A;  1WEU A;  3GL6 A;  3GV4 A;  2VPG A;  2NAA A;  2K1J A;  4TKP B;  3C5K A;  1FBV A;  3U5N A;  5FEY A;  3RPG B;  3RPG C;  3O37 A;  1WGM A;  5KH3 A;  1HYJ A;  2F42 A;  2ECN A;  1WFK A;  2K4D A;  5B8D A;  5DIN A;  2BAY A;  3MHH A;  2VJF A;  4GNE A;  5DKA A;  2RI7 A;  2LGK A;  2L0B A;  4GND A;  4ZDT A;  5D1M B;  3DQV R;  4R7E A;  1ZBD B;  3PUR A;  2VJE A;  5AIT A;  2E6S A;  4S3O B;  4S3O C;  3N9Q A;  3O70 A;  4FIP A;  2G43 A;  2L43 A;  2FUI A;  2Y43 A;  3ZNI A;  4QF3 A;  5H1T A;  1Z6U A;  2G6Q A;  2EGP A;  3U5P A;  3PUQ A;  2F6J A;  1WEM A;  4A0C D;  4AVX A;  5H1V A;  5LKT A;  2PNX A;  2JMD A;  2QIZ A;  5J3X A;  4YAD A;  2KWO A;  2YW8 A;  4N3W A;  3VK6 A;  1VD4 A;  3SOW A; 
#chains in the Genus database with same CATH topology
 3C6W A;  2KIZ A;  3SHB A;  1HYI A;  4FJC A;  2KKX A;  3IHP A;  1Z2Q A;  2EGM A;  1MM2 A;  4N4F A;  1X4J A;  4A49 A;  2LRI C;  3ZPV 1;  3NG2 A;  3EB6 A;  3Q1D A;  2YT5 A;  3KDE C;  4IC2 A;  2VP7 A;  4GNG A;  4R2Y A;  5B75 A;  2MKE A;  4Z0O A;  5LCW B;  3LQJ A;  2HYE D;  4L58 A;  5JG6 A;  2LN0 A;  2I50 A;  3LVQ E;  5KH7 A;  5KH9 A;  4LJN A;  4H9D A;  2YQL A;  2K16 A;  4IC3 A;  1IYM A;  2CRR A;  4LK9 A;  4WA6 A;  4AUQ B;  2YYR A;  3U5M A;  4CCG X;  4WZ2 A;  3MHS A;  5FB1 A;  3EB5 A;  2FFW A;  2EOD A;  3DWD A;  2YSM A;  3HTK C;  4L7X A;  1WEW A;  2CKL B;  5TDW A;  4I7B A;  2MA6 A;  2ECI A;  4X3G A;  3T7L A;  3M62 A;  4ZUX U;  5TBN A;  4YAB A;  2VPB A;  1E4U A;  5SVI B;  3M99 A;  3O7A A;  1MBM A;  4FK5 A;  3E2D A;  5B77 A;  3ZPV E;  4NN2 A;  2IDA A;  2CSZ A;  2XP0 A;  2DX8 A;  4LLB A;  2C2L A;  4UP5 A;  1WE9 A;  4MVT A;  4GB0 A;  4V3L C;  1XWH A;  2KKY A;  2YHO A;  5TDR A;  1K2F A;  4CA1 A;  1FP0 A;  3SOU A;  2QJ0 A;  1V87 A;  3FAN A;  2KU3 A;  1JM7 B;  4QF2 A;  2E6R A;  3ZVZ B;  3T6R A;  3KV5 A;  2EA6 A;  4YAT A;  1DVP A;  2KFT A;  1WEE A;  1WES A;  2OXQ C;  4Z0R A;  2LAU A;  2KYU A;  4W4U A;  2CRW A;  4V3K C;  2DSM A;  5SVI A;  5C11 A;  3FJU B;  3LQH A;  2MA5 A;  4I7C A;  4B7Y C;  3L11 A;  1Z60 A;  1DCQ A;  1U6G B;  4F52 B;  1BOR A;  1LDK C;  2JRJ A;  4A4C A;  2CSY A;  3ZTG A;  3N9L A;  3FAO A;  3N9O A;  2M85 A;  2C2V S;  4BBQ A;  1WIM A;  2YUR A;  4YBM A;  4YAX A;  5G0F A;  3HCU A;  1JM7 A;  5LKU A;  3N9M A;  2KWK A;  3LDY A;  3O34 A;  2JMJ A;  2XB1 A;  4AP4 A;  2KRE A;  2KGI A;  3ASL A;  4UP0 A;  3N9P A;  4WZ0 A;  5SVY A;  2L75 A;  2ECV A;  2YU4 A;  1F62 A;  4B86 C;  2VNF A;  3KQI A;  2VJF B;  2MT5 A;  4F1P A;  3PHD A;  1VFY A;  2F6N A;  2MD8 C;  2VPE A;  5C13 A;  2LXH C;  2CON A;  5LKZ A;  1X4I A;  3L1Z B;  4I7D A;  2IQJ A;  3LRQ A;  3U5O A;  1WEV A;  4YBT A;  3H7H A;  4OGE A;  2MD7 B;  5TAB A;  2MUM A;  2RSD A;  3QZV A;  3KV6 A;  2YRE A;  5G05 B;  4OGC A;  2G45 A;  4PTB A;  2YQM A;  4Q6F A;  2KWJ A;  3O33 A;  5G04 B;  3DPL R;  2Y1M A;  3V43 A;  1WEQ A;  4WZ3 B;  3I2D A;  5B79 A;  5FB0 A;  4P5O B;  2KGG A;  5EYA F;  5SVX A;  2ZET C;  5H1U A;  2JMI A;  1N87 A;  1WEP A;  4GNF A;  2CSV A;  3KNV A;  5D1L B;  2L5U A;  2RR4 A;  4PPE A;  4C9Z A;  3ZYQ A;  2KR4 A;  2D8S A;  2M3H A;  1T1H A;  1MM3 A;  2LGG A;  2YUC A;  2JM3 A;  2LGV A;  2YVR A;  4XI1 A;  4YC9 A;  2B0O E;  2LGL A;  2CKL A;  2QIC A;  1G25 A;  4O64 A;  4UI9 B;  2XEU A;  5FER A;  3SUB A;  2CT2 A;  4AYC B;  5LKX A;  2UZG A;  5I3L A;  3RTR B;  4FO9 A;  2EXU A;  2H0D B;  2P57 A;  2AN6 A;  1WIL A;  1LDJ B;  3L1X A;  3PLW A;  3LQI A;  2ECJ A;  4YBS A;  2ECW A;  2LXP C;  4LAD B;  2YHN A;  2K17 A;  3M63 A;  4QQ4 A;  3T9K A;  5TRB A;  4O62 A;  3O35 A;  1VYX A;  1WEO A;  4LKA A;  2LQ6 A;  2L80 A;  4R8P K;  5H9M A;  3HCT A;  3O36 A;  3FL2 A;  3N9N A;  2Y1N A;  2FUU A;  2KWN A;  5K3Q A;  2MNZ A;  3HCS A;  5B78 A;  5B76 A;  2M6M A;  2OWA A;  4AYC A;  2LV9 A;  2PUY A;  4BHW A;  1CHC A;  4ZQL A;  2MIQ A;  2E61 A;  3ZVY A;  2KE1 A;  4MSX A;  2HDP A;  5AIU A;  2H0D A;  2JUN A;  2FSA A;  2MNY A;  2FD4 A;  2VPD A;  1X4U A;  2M1R A;  3O47 A;  3DDT A;  2VJE B;  1JOC A;  1WEN A;  1RMD A;  3SOX A;  5D1K B;  4A4B A;  2YSJ A;  2LDR A;  3FM8 C;  2ECG A;  2ECT A;  1WEU A;  3GL6 A;  3GV4 A;  2M13 A;  2VPG A;  2NAA A;  2K1J A;  4TKP B;  2XOY A;  3C5K A;  1FBV A;  3U5N A;  5FEY A;  3RPG B;  3RPG C;  3O37 A;  1WGM A;  5KH3 A;  1HYJ A;  2F42 A;  2ECN A;  1WFK A;  3MDB C;  2XOZ A;  2K4D A;  5B8D A;  5DIN A;  2BAY A;  3MHH A;  2VJF A;  4GNE A;  5DKA A;  3LJU X;  2RI7 A;  2XOC A;  2LGK A;  2L0B A;  4GND A;  4ZDT A;  2L7P A;  5D1M B;  3DQV R;  4R7E A;  1ZBD B;  3PUR A;  3FEH A;  2VJE A;  5AIT A;  2DJA A;  2E6S A;  4S3O B;  4S3O C;  3N9Q A;  3O70 A;  4FIP A;  2G43 A;  2L43 A;  2FUI A;  2Y43 A;  3ZNI A;  4QF3 A;  5H1T A;  1Z6U A;  2G6Q A;  2EGP A;  3U5P A;  3PUQ A;  3LVR E;  2F6J A;  1WEM A;  4A0C D;  4AVX A;  5H1V A;  5LKT A;  2PNX A;  2JMD A;  3JUE A;  2QIZ A;  5J3X A;  3M7K A;  2D8U A;  4YAD A;  2KWO A;  2YW8 A;  4N3W A;  3VK6 A;  1VD4 A;  3SOW A; 
#chains in the Genus database with same CATH homology
 3C6W A;  2KIZ A;  3SHB A;  1HYI A;  4FJC A;  3IHP A;  1Z2Q A;  1MM2 A;  4N4F A;  1X4J A;  4A49 A;  2LRI C;  3ZPV 1;  3NG2 A;  3EB6 A;  2YT5 A;  4IC2 A;  2VP7 A;  4GNG A;  4R2Y A;  5B75 A;  5LCW B;  3LQJ A;  2HYE D;  4L58 A;  5JG6 A;  2LN0 A;  2I50 A;  5KH7 A;  5KH9 A;  4LJN A;  2YQL A;  2K16 A;  4IC3 A;  1IYM A;  4LK9 A;  4WA6 A;  4AUQ B;  2YYR A;  3U5M A;  4CCG X;  4WZ2 A;  3MHS A;  5FB1 A;  3EB5 A;  2EOD A;  2YSM A;  3HTK C;  4L7X A;  1WEW A;  2CKL B;  5TDW A;  4I7B A;  2MA6 A;  2ECI A;  4X3G A;  3T7L A;  3M62 A;  4ZUX U;  5TBN A;  4YAB A;  2VPB A;  1E4U A;  3M99 A;  3O7A A;  4FK5 A;  5B77 A;  3ZPV E;  4NN2 A;  2IDA A;  2CSZ A;  2DX8 A;  4LLB A;  2C2L A;  4UP5 A;  1WE9 A;  4MVT A;  4GB0 A;  4V3L C;  1XWH A;  2YHO A;  5TDR A;  1K2F A;  4CA1 A;  1FP0 A;  3SOU A;  2QJ0 A;  1V87 A;  2KU3 A;  1JM7 B;  4QF2 A;  2E6R A;  3ZVZ B;  3T6R A;  3KV5 A;  2EA6 A;  4YAT A;  1DVP A;  2KFT A;  1WEE A;  1WES A;  2OXQ C;  2KYU A;  4W4U A;  4V3K C;  5C11 A;  3LQH A;  2MA5 A;  4I7C A;  4B7Y C;  3L11 A;  1Z60 A;  1U6G B;  4F52 B;  1BOR A;  1LDK C;  2JRJ A;  4A4C A;  2CSY A;  3ZTG A;  3N9L A;  3N9O A;  2M85 A;  2C2V S;  4BBQ A;  1WIM A;  2YUR A;  4YBM A;  4YAX A;  5G0F A;  3HCU A;  1JM7 A;  5LKU A;  3N9M A;  2KWK A;  3O34 A;  2JMJ A;  2XB1 A;  4AP4 A;  2KRE A;  2KGI A;  3ASL A;  4UP0 A;  3N9P A;  4WZ0 A;  2L75 A;  2ECV A;  2YU4 A;  1F62 A;  4B86 C;  2VNF A;  3KQI A;  2VJF B;  2MT5 A;  3PHD A;  1VFY A;  2F6N A;  2MD8 C;  2VPE A;  5C13 A;  2LXH C;  5LKZ A;  1X4I A;  3L1Z B;  4I7D A;  3LRQ A;  3U5O A;  1WEV A;  4YBT A;  2MD7 B;  5TAB A;  2MUM A;  2RSD A;  3QZV A;  3KV6 A;  2YRE A;  5G05 B;  2G45 A;  4PTB A;  2YQM A;  4Q6F A;  2KWJ A;  3O33 A;  5G04 B;  3DPL R;  2Y1M A;  3V43 A;  1WEQ A;  4WZ3 B;  3I2D A;  5B79 A;  5FB0 A;  4P5O B;  2KGG A;  5EYA F;  2ZET C;  5H1U A;  2JMI A;  1N87 A;  1WEP A;  4GNF A;  3KNV A;  5D1L B;  2L5U A;  4PPE A;  4C9Z A;  3ZYQ A;  2KR4 A;  2D8S A;  2M3H A;  1T1H A;  1MM3 A;  2LGG A;  2YUC A;  2LGV A;  4XI1 A;  4YC9 A;  2LGL A;  2CKL A;  2QIC A;  1G25 A;  4O64 A;  4UI9 B;  2XEU A;  5FER A;  2CT2 A;  4AYC B;  5LKX A;  2UZG A;  5I3L A;  3RTR B;  4FO9 A;  2H0D B;  2AN6 A;  1WIL A;  1LDJ B;  3L1X A;  3LQI A;  2ECJ A;  4YBS A;  2ECW A;  2LXP C;  4LAD B;  2YHN A;  2K17 A;  3M63 A;  5TRB A;  3O35 A;  1VYX A;  1WEO A;  4LKA A;  2LQ6 A;  2L80 A;  4R8P K;  5H9M A;  3HCT A;  3O36 A;  3FL2 A;  3N9N A;  2Y1N A;  2FUU A;  2KWN A;  2MNZ A;  3HCS A;  5B78 A;  5B76 A;  2M6M A;  4AYC A;  2LV9 A;  2PUY A;  4BHW A;  1CHC A;  4ZQL A;  2MIQ A;  3ZVY A;  2KE1 A;  4MSX A;  2HDP A;  5AIU A;  2H0D A;  2FSA A;  2MNY A;  2VPD A;  1X4U A;  2M1R A;  2VJE B;  1JOC A;  1WEN A;  1RMD A;  3SOX A;  5D1K B;  4A4B A;  2YSJ A;  2LDR A;  2ECG A;  2ECT A;  1WEU A;  3GL6 A;  3GV4 A;  2VPG A;  2NAA A;  2K1J A;  4TKP B;  3C5K A;  1FBV A;  3U5N A;  5FEY A;  3RPG B;  3RPG C;  3O37 A;  1WGM A;  5KH3 A;  1HYJ A;  2F42 A;  2ECN A;  1WFK A;  2K4D A;  5B8D A;  5DIN A;  2BAY A;  3MHH A;  2VJF A;  4GNE A;  5DKA A;  2RI7 A;  2LGK A;  2L0B A;  4GND A;  4ZDT A;  5D1M B;  3DQV R;  4R7E A;  1ZBD B;  3PUR A;  2VJE A;  5AIT A;  2E6S A;  4S3O B;  4S3O C;  3N9Q A;  3O70 A;  4FIP A;  2G43 A;  2L43 A;  2FUI A;  2Y43 A;  3ZNI A;  4QF3 A;  5H1T A;  1Z6U A;  2G6Q A;  2EGP A;  3U5P A;  3PUQ A;  2F6J A;  1WEM A;  4A0C D;  4AVX A;  5H1V A;  5LKT A;  2PNX A;  2JMD A;  2QIZ A;  5J3X A;  4YAD A;  2KWO A;  2YW8 A;  4N3W A;  3VK6 A;  1VD4 A;  3SOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...