4WZ3B

Crystal structure of the complex between lubx/legu2/lpp2887 u-box 1 and homo sapiens ube2d2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
183
structure length
183
Chain Sequence
RNPFDIDHKSKYLREAALEANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVAARQKEYTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 183
sequence length 183
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz3B02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz3B01
1Z6UA 3C6WA 2KWNA 4W4UA 3O70A 2K1JA 3N9PA 2JRJA 5J3XA 4AP4A 2EGPA 4AVXA 4WZ2A 5FB1A 3O33A 2VPGA 2XEUA 2MIQA 2L80A 2IDAA 2LV9A 4AYCA 2KU3A 1MM2A 2LN0A 2QIZA 4C9ZA 3HCSA 4LJNA 2ZETC 2MUMA 5H1UA 2LRIC 1JM7B 2RI7A 2KGGA 2L0BA 5TABA 4B86C 2PNXA 2FUIA 3EB5A 3NG2A 2ECGA 2ECVA 3IHPA 2VJFB 3I2DA 2YW8A 1RMDA 2JMDA 2G43A 5LKUA 2BAYA 5C13A 1Z2QA 2VPDA 4A4BA 1LDJB 3MHHA 5B8DA 3U5PA 1WEEA 2UZGA 5I3LA 3N9MA 4TKPB 3ZPV1 2NAAA 4ZQLA 2OXQC 2MA6A 5B76A 3EB6A 1LDKC 1E4UA 1F62A 2QJ0A 4YAXA 2LGLA 2YREA 2K16A 2L75A 2LXPC 2ECTA 4F52B 1V87A 2CKLB 2MD8C 3MHSA 4AUQB 4YBMA 3N9NA 2MD7B 2VPEA 4YBSA 1WEMA 5B77A 4XI1A 2YURA 2H0DB 4A4CA 1WIMA 5G05B 4P5OB 1JM7A 2KIZA 2YHOA 2Y43A 2LGKA 1WFKA 4YABA 3KV6A 1FBVA 1WEUA 3QZVA 4GNDA 2MA5A 2DX8A 5LKTA 3N9LA 2M6MA 4YATA 2VJFA 5D1KB 4WZ3B 4FO9A 2KFTA 1X4JA 2FUUA 5FEYA 3FL2A 1VD4A 2YQLA 2KWKA 3SOXA 3ZYQA 5FB0A 3O36A 5EYAF 4UP5A 3SOUA 2ECJA 5B79A 1G25A 4GNFA 2EODA 3KV5A 3PHDA 4FK5A 3M99A 4BHWA 3HCTA 2KYUA 3SOWA 3LRQA 4QF3A 2PUYA 3KQIA 2M3HA 2G45A 1Z60A 3ZPVE 2CKLA 3HCUA 4LADB 2YHNA 1VFYA 3V43A 4N3WA 3N9QA 4FJCA 4S3OC 2F42A 2YSMA 3O34A 2E6SA 2H0DA 2K4DA 1WILA 4A49A 5TRBA 2QICA 5KH7A 1N87A 2XB1A 2K17A 2VP7A 2MNZA 1X4IA 4YADA 4R8PK 2LDRA 2VPBA 3M62A 4MVTA 2YQMA 5TBNA 4O64A 2JMIA 4CA1A 3RPGB 2LGGA 2LQ6A 4V3LC 1FP0A 3U5OA 1JOCA 4B7YC 2C2VS 5G04B 5D1LB 2VNFA 4LK9A 3ZNIA 4R2YA 3KNVA 5KH3A 3GV4A 1DVPA 4UP0A 2M85A 1WEWA 2LXHC 4V3KC 1CHCA 4PPEA 2HYED 2KR4A 1WEQA 4GNEA 4IC3A 3ZTGA 3O35A 1IYMA 3O7AA 3SHBA 3HTKC 3PUQA 5B78A 4I7BA 4I7DA 4WZ0A 3T6RA 2VJEB 3ZVYA 2KE1A 5C11A 2F6NA 2C2LA 5G0FA 2MT5A 3LQJA 3O37A 4X3GA 5D1MB 4I7CA 2Y1NA 5B75A 4BBQA 1WGMA 3ASLA 2D8SA 3GL6A 3C5KA 4LKAA 2E6RA 5LKXA 1WEPA 1U6GB 1HYIA 4QF2A 4WA6A 2L5UA 2JMJA 2Y1MA 5LCWB 3L1XA 3L1ZB 2YSJA 4CCGX 3L11A 4UI9B 1HYJA 3M63A 4A0CD 1K2FA 5KH9A 2MNYA 5DKAA 2RSDA 4FIPA 2EA6A 3U5MA 5FERA 3U5NA 2KWOA 2VJEA 4N4FA 4GB0A 1X4UA 2ECWA 4YBTA 4GNGA 1XWHA 4LLBA 3ZVZB 2KWJA 2YT5A 5AITA 4L58A 3DQVR 2KREA 4ZUXU 5JG6A 5H1TA 5TDRA 1VYXA 5LKZA 5H1VA 1T1HA 4YC9A 1MM3A 3T7LA 2CSZA 3LQHA 4PTBA 2HDPA 1WENA 5TDWA 4ZDTA 5H9MA 4AYCB 2YU4A 2CT2A 3RTRB 4IC2A 2FSAA 4L7XA 3VK6A 2ECNA 3PURA 4S3OB 2KGIA 2F6JA 2I50A 2LGVA 4Q6FA 2M1RA 1WE9A 3LQIA 2CSYA 1BORA 1WEOA 4R7EA 1WEVA 2G6QA 2YYRA 2YUCA 3RPGC 2ECIA 2L43A 1WESA 4MSXA 5AIUA 3N9OA 5DINA 1ZBDB 2AN6A 3DPLR 4NN2A
chains in the Genus database with same CATH superfamily
1Z6UA 3C6WA 2KWNA 4W4UA 3O70A 2K1JA 3LJUX 3N9PA 4F1PA 2JRJA 5J3XA 4AP4A 2EGPA 3Q1DA 4AVXA 4WZ2A 5FB1A 3O33A 2VPGA 2XEUA 2MIQA 2L80A 2IDAA 2LV9A 4AYCA 2KU3A 1MM2A 2LN0A 2QIZA 4C9ZA 3HCSA 4LJNA 2ZETC 2MUMA 5H1UA 2LRIC 1JM7B 2RI7A 2KGGA 2L0BA 5TABA 4B86C 2PNXA 2FUIA 3EB5A 4O62A 3LVRE 3NG2A 2ECGA 2XOZA 2ECVA 3IHPA 2XP0A 2VJFB 3I2DA 2YW8A 1RMDA 2JMDA 3FM8C 5SVXA 2G43A 5LKUA 3T9KA 2L7PA 2BAYA 5C13A 1Z2QA 2VPDA 4A4BA 1LDJB 3MHHA 5B8DA 3U5PA 1WEEA 2UZGA 3DDTA 5I3LA 3N9MA 4TKPB 3ZPV1 2NAAA 4ZQLA 2OXQC 2MA6A 5B76A 3EB6A 1LDKC 2KKYA 1E4UA 1F62A 2QJ0A 4YAXA 2LGLA 2YREA 2K16A 2L75A 2LXPC 2ECTA 4F52B 1V87A 2CKLB 2MD8C 3MHSA 4AUQB 4YBMA 3N9NA 2MD7B 2VPEA 4YBSA 1WEMA 5K3QA 2CRRA 5B77A 4XI1A 2YURA 2H0DB 4A4CA 1WIMA 2XOCA 5G05B 4P5OB 1JM7A 2KIZA 3LDYA 2YHOA 2Y43A 2LGKA 3SUBA 1WFKA 4YABA 3PLWA 3KV6A 1FBVA 3E2DA 4OGEA 1WEUA 3QZVA 4GNDA 2MA5A 2DX8A 5LKTA 3N9LA 2M6MA 4YATA 2VJFA 5D1KB 4WZ3B 4FO9A 2KFTA 1X4JA 2FUUA 5FEYA 3FL2A 1VD4A 2YQLA 2KWKA 3SOXA 3ZYQA 5FB0A 3O36A 5EYAF 2E61A 4UP5A 3SOUA 2ECJA 5B79A 1G25A 4GNFA 2EODA 3KV5A 3PHDA 4FK5A 3M99A 4BHWA 3HCTA 2KYUA 3O47A 3SOWA 3LRQA 4QF3A 2PUYA 3KQIA 2M3HA 1Z60A 2G45A 3ZPVE 2CKLA 3HCUA 4LADB 2YHNA 1VFYA 4Z0OA 3V43A 2DSMA 4N3WA 3N9QA 2CSVA 4FJCA 4S3OC 2F42A 3LVQE 2YSMA 3O34A 2E6SA 2LAUA 2H0DA 2K4DA 1WILA 4A49A 5TRBA 3FAOA 2QICA 5KH7A 1N87A 2XB1A 5SVIB 2K17A 4OGCA 2VP7A 2MNZA 1X4IA 4YADA 4R8PK 2LDRA 2VPBA 3M62A 4MVTA 2YQMA 5TBNA 4O64A 2JMIA 4CA1A 3RPGB 2LGGA 2LQ6A 3FEHA 4V3LC 1FP0A 3U5OA 1JOCA 4B7YC 2C2VS 5G04B 5D1LB 5SVYA 2M13A 3MDBC 2RR4A 2YVRA 2VNFA 4LK9A 3FANA 3ZNIA 2EXUA 4R2YA 3KNVA 5KH3A 3GV4A 1DVPA 4UP0A 2M85A 1WEWA 2LXHC 4V3KC 1CHCA 4Z0RA 4PPEA 2HYED 3JUEA 2KR4A 1WEQA 4GNEA 4IC3A 3ZTGA 3O35A 1IYMA 3O7AA 3SHBA 3HTKC 3PUQA 5B78A 4I7BA 4I7DA 4WZ0A 3T6RA 5SVIA 2XOYA 2IQJA 2VJEB 3ZVYA 2KE1A 5C11A 2F6NA 2C2LA 5G0FA 2MT5A 3LQJA 4H9DA 3O37A 4X3GA 2CRWA 5D1MB 2D8UA 4I7CA 2Y1NA 5B75A 4BBQA 1WGMA 3ASLA 2D8SA 3GL6A 4LKAA 3C5KA 2E6RA 5LKXA 2MKEA 1WEPA 1U6GB 2JM3A 1HYIA 4QF2A 4WA6A 2L5UA 2JMJA 2Y1MA 5LCWB 3L1XA 3L1ZB 2YSJA 4CCGX 3L11A 2FFWA 4UI9B 3KDEC 1HYJA 3M63A 1MBMA 4A0CD 1K2FA 2MNYA 5KH9A 5DKAA 2RSDA 4FIPA 2EA6A 1DCQA 3U5MA 5FERA 3U5NA 2KWOA 2VJEA 4N4FA 4GB0A 1X4UA 2ECWA 4GNGA 4YBTA 1XWHA 4LLBA 2B0OE 3ZVZB 2KWJA 2YT5A 5AITA 4L58A 3DQVR 2KREA 3H7HA 4ZUXU 5JG6A 5H1TA 5TDRA 1VYXA 5LKZA 5H1VA 1T1HA 4QQ4A 1MM3A 4YC9A 3T7LA 2CSZA 3LQHA 4PTBA 2HDPA 3M7KA 1WENA 5TDWA 3DWDA 4ZDTA 2DJAA 5H9MA 4AYCB 2YU4A 2CT2A 2OWAA 3RTRB 2JUNA 4IC2A 2FSAA 3FJUB 4L7XA 3VK6A 2CONA 2ECNA 3PURA 4S3OB 2KGIA 2F6JA 2I50A 2LGVA 4Q6FA 2M1RA 2P57A 2EGMA 1WE9A 3LQIA 2CSYA 1BORA 1WEOA 4R7EA 1WEVA 2G6QA 2YYRA 2YUCA 3RPGC 2ECIA 2L43A 1WESA 4MSXA 2KKXA 5AIUA 3N9OA 5DINA 2FD4A 1ZBDB 2AN6A 3DPLR 4NN2A
chains in the Genus database with same CATH topology
1Z6UA 3C6WA 2KWNA 4W4UA 3O70A 2K1JA 3N9PA 2JRJA 5J3XA 4AP4A 2EGPA 4AVXA 4WZ2A 5FB1A 3O33A 2VPGA 2XEUA 2MIQA 2L80A 2IDAA 2LV9A 4AYCA 2KU3A 1MM2A 2LN0A 2QIZA 4C9ZA 3HCSA 4LJNA 2ZETC 2MUMA 5H1UA 2LRIC 1JM7B 2RI7A 2KGGA 2L0BA 5TABA 4B86C 2PNXA 2FUIA 3EB5A 3NG2A 2ECGA 2ECVA 3IHPA 2VJFB 3I2DA 2YW8A 1RMDA 2JMDA 2G43A 5LKUA 2BAYA 5C13A 1Z2QA 2VPDA 4A4BA 1LDJB 3MHHA 5B8DA 3U5PA 1WEEA 2UZGA 5I3LA 3N9MA 4TKPB 3ZPV1 2NAAA 4ZQLA 2OXQC 2MA6A 5B76A 3EB6A 1LDKC 1E4UA 1F62A 2QJ0A 4YAXA 2LGLA 2YREA 2K16A 2L75A 2LXPC 2ECTA 4F52B 1V87A 2CKLB 2MD8C 3MHSA 4AUQB 4YBMA 3N9NA 2MD7B 2VPEA 4YBSA 1WEMA 5B77A 4XI1A 2YURA 2H0DB 4A4CA 1WIMA 5G05B 4P5OB 1JM7A 2KIZA 2YHOA 2Y43A 2LGKA 1WFKA 4YABA 3KV6A 1FBVA 1WEUA 3QZVA 4GNDA 2MA5A 2DX8A 5LKTA 3N9LA 2M6MA 4YATA 2VJFA 5D1KB 4WZ3B 4FO9A 2KFTA 1X4JA 2FUUA 5FEYA 3FL2A 1VD4A 2YQLA 2KWKA 3SOXA 3ZYQA 5FB0A 3O36A 5EYAF 4UP5A 3SOUA 2ECJA 5B79A 1G25A 4GNFA 2EODA 3KV5A 3PHDA 4FK5A 3M99A 4BHWA 3HCTA 2KYUA 3SOWA 3LRQA 4QF3A 2PUYA 3KQIA 2M3HA 2G45A 1Z60A 3ZPVE 2CKLA 3HCUA 4LADB 2YHNA 1VFYA 3V43A 4N3WA 3N9QA 4FJCA 4S3OC 2F42A 2YSMA 3O34A 2E6SA 2H0DA 2K4DA 1WILA 4A49A 5TRBA 2QICA 5KH7A 1N87A 2XB1A 2K17A 2VP7A 2MNZA 1X4IA 4YADA 4R8PK 2LDRA 2VPBA 3M62A 4MVTA 2YQMA 5TBNA 4O64A 2JMIA 4CA1A 3RPGB 2LGGA 2LQ6A 4V3LC 1FP0A 3U5OA 1JOCA 4B7YC 2C2VS 5G04B 5D1LB 2VNFA 4LK9A 3ZNIA 4R2YA 3KNVA 5KH3A 3GV4A 1DVPA 4UP0A 2M85A 1WEWA 2LXHC 4V3KC 1CHCA 4PPEA 2HYED 2KR4A 1WEQA 4GNEA 4IC3A 3ZTGA 3O35A 1IYMA 3O7AA 3SHBA 3HTKC 3PUQA 5B78A 4I7BA 4I7DA 4WZ0A 3T6RA 2VJEB 3ZVYA 2KE1A 5C11A 2F6NA 2C2LA 5G0FA 2MT5A 3LQJA 3O37A 4X3GA 5D1MB 4I7CA 2Y1NA 5B75A 4BBQA 1WGMA 3ASLA 2D8SA 3GL6A 3C5KA 4LKAA 2E6RA 5LKXA 1WEPA 1U6GB 1HYIA 4QF2A 4WA6A 2L5UA 2JMJA 2Y1MA 5LCWB 3L1XA 3L1ZB 2YSJA 4CCGX 3L11A 4UI9B 1HYJA 3M63A 4A0CD 1K2FA 5KH9A 2MNYA 5DKAA 2RSDA 4FIPA 2EA6A 3U5MA 5FERA 3U5NA 2KWOA 2VJEA 4N4FA 4GB0A 1X4UA 2ECWA 4YBTA 4GNGA 1XWHA 4LLBA 3ZVZB 2KWJA 2YT5A 5AITA 4L58A 3DQVR 2KREA 4ZUXU 5JG6A 5H1TA 5TDRA 1VYXA 5LKZA 5H1VA 1T1HA 4YC9A 1MM3A 3T7LA 2CSZA 3LQHA 4PTBA 2HDPA 1WENA 5TDWA 4ZDTA 5H9MA 4AYCB 2YU4A 2CT2A 3RTRB 4IC2A 2FSAA 4L7XA 3VK6A 2ECNA 3PURA 4S3OB 2KGIA 2F6JA 2I50A 2LGVA 4Q6FA 2M1RA 1WE9A 3LQIA 2CSYA 1BORA 1WEOA 4R7EA 1WEVA 2G6QA 2YYRA 2YUCA 3RPGC 2ECIA 2L43A 1WESA 4MSXA 5AIUA 3N9OA 5DINA 1ZBDB 2AN6A 3DPLR 4NN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6U A;  3C6W A;  2KWN A;  4W4U A;  3O70 A;  2K1J A;  3N9P A;  2JRJ A;  5J3X A;  4AP4 A;  2EGP A;  4AVX A;  4WZ2 A;  5FB1 A;  3O33 A;  2VPG A;  2XEU A;  2MIQ A;  2L80 A;  2IDA A;  2LV9 A;  4AYC A;  2KU3 A;  1MM2 A;  2LN0 A;  2QIZ A;  4C9Z A;  3HCS A;  4LJN A;  2ZET C;  2MUM A;  5H1U A;  2LRI C;  1JM7 B;  2RI7 A;  2KGG A;  2L0B A;  5TAB A;  4B86 C;  2PNX A;  2FUI A;  3EB5 A;  3NG2 A;  2ECG A;  2ECV A;  3IHP A;  2VJF B;  3I2D A;  2YW8 A;  1RMD A;  2JMD A;  2G43 A;  5LKU A;  2BAY A;  5C13 A;  1Z2Q A;  2VPD A;  4A4B A;  1LDJ B;  3MHH A;  5B8D A;  3U5P A;  1WEE A;  2UZG A;  5I3L A;  3N9M A;  4TKP B;  3ZPV 1;  2NAA A;  4ZQL A;  2OXQ C;  2MA6 A;  5B76 A;  3EB6 A;  1LDK C;  1E4U A;  1F62 A;  2QJ0 A;  4YAX A;  2LGL A;  2YRE A;  2K16 A;  2L75 A;  2LXP C;  2ECT A;  4F52 B;  1V87 A;  2CKL B;  2MD8 C;  3MHS A;  4AUQ B;  4YBM A;  3N9N A;  2MD7 B;  2VPE A;  4YBS A;  1WEM A;  5B77 A;  4XI1 A;  2YUR A;  2H0D B;  4A4C A;  1WIM A;  5G05 B;  4P5O B;  1JM7 A;  2KIZ A;  2YHO A;  2Y43 A;  2LGK A;  1WFK A;  4YAB A;  3KV6 A;  1FBV A;  1WEU A;  3QZV A;  4GND A;  2MA5 A;  2DX8 A;  5LKT A;  3N9L A;  2M6M A;  4YAT A;  2VJF A;  5D1K B;  4WZ3 B;  4FO9 A;  2KFT A;  1X4J A;  2FUU A;  5FEY A;  3FL2 A;  1VD4 A;  2YQL A;  2KWK A;  3SOX A;  3ZYQ A;  5FB0 A;  3O36 A;  5EYA F;  4UP5 A;  3SOU A;  2ECJ A;  5B79 A;  1G25 A;  4GNF A;  2EOD A;  3KV5 A;  3PHD A;  4FK5 A;  3M99 A;  4BHW A;  3HCT A;  2KYU A;  3SOW A;  3LRQ A;  4QF3 A;  2PUY A;  3KQI A;  2M3H A;  2G45 A;  1Z60 A;  3ZPV E;  2CKL A;  3HCU A;  4LAD B;  2YHN A;  1VFY A;  3V43 A;  4N3W A;  3N9Q A;  4FJC A;  4S3O C;  2F42 A;  2YSM A;  3O34 A;  2E6S A;  2H0D A;  2K4D A;  1WIL A;  4A49 A;  5TRB A;  2QIC A;  5KH7 A;  1N87 A;  2XB1 A;  2K17 A;  2VP7 A;  2MNZ A;  1X4I A;  4YAD A;  4R8P K;  2LDR A;  2VPB A;  3M62 A;  4MVT A;  2YQM A;  5TBN A;  4O64 A;  2JMI A;  4CA1 A;  3RPG B;  2LGG A;  2LQ6 A;  4V3L C;  1FP0 A;  3U5O A;  1JOC A;  4B7Y C;  2C2V S;  5G04 B;  5D1L B;  2VNF A;  4LK9 A;  3ZNI A;  4R2Y A;  3KNV A;  5KH3 A;  3GV4 A;  1DVP A;  4UP0 A;  2M85 A;  1WEW A;  2LXH C;  4V3K C;  1CHC A;  4PPE A;  2HYE D;  2KR4 A;  1WEQ A;  4GNE A;  4IC3 A;  3ZTG A;  3O35 A;  1IYM A;  3O7A A;  3SHB A;  3HTK C;  3PUQ A;  5B78 A;  4I7B A;  4I7D A;  4WZ0 A;  3T6R A;  2VJE B;  3ZVY A;  2KE1 A;  5C11 A;  2F6N A;  2C2L A;  5G0F A;  2MT5 A;  3LQJ A;  3O37 A;  4X3G A;  5D1M B;  4I7C A;  2Y1N A;  5B75 A;  4BBQ A;  1WGM A;  3ASL A;  2D8S A;  3GL6 A;  3C5K A;  4LKA A;  2E6R A;  5LKX A;  1WEP A;  1U6G B;  1HYI A;  4QF2 A;  4WA6 A;  2L5U A;  2JMJ A;  2Y1M A;  5LCW B;  3L1X A;  3L1Z B;  2YSJ A;  4CCG X;  3L11 A;  4UI9 B;  1HYJ A;  3M63 A;  4A0C D;  1K2F A;  5KH9 A;  2MNY A;  5DKA A;  2RSD A;  4FIP A;  2EA6 A;  3U5M A;  5FER A;  3U5N A;  2KWO A;  2VJE A;  4N4F A;  4GB0 A;  1X4U A;  2ECW A;  4YBT A;  4GNG A;  1XWH A;  4LLB A;  3ZVZ B;  2KWJ A;  2YT5 A;  5AIT A;  4L58 A;  3DQV R;  2KRE A;  4ZUX U;  5JG6 A;  5H1T A;  5TDR A;  1VYX A;  5LKZ A;  5H1V A;  1T1H A;  4YC9 A;  1MM3 A;  3T7L A;  2CSZ A;  3LQH A;  4PTB A;  2HDP A;  1WEN A;  5TDW A;  4ZDT A;  5H9M A;  4AYC B;  2YU4 A;  2CT2 A;  3RTR B;  4IC2 A;  2FSA A;  4L7X A;  3VK6 A;  2ECN A;  3PUR A;  4S3O B;  2KGI A;  2F6J A;  2I50 A;  2LGV A;  4Q6F A;  2M1R A;  1WE9 A;  3LQI A;  2CSY A;  1BOR A;  1WEO A;  4R7E A;  1WEV A;  2G6Q A;  2YYR A;  2YUC A;  3RPG C;  2ECI A;  2L43 A;  1WES A;  4MSX A;  5AIU A;  3N9O A;  5DIN A;  1ZBD B;  2AN6 A;  3DPL R;  4NN2 A; 
#chains in the Genus database with same CATH topology
 1Z6U A;  3C6W A;  2KWN A;  4W4U A;  3O70 A;  2K1J A;  3LJU X;  3N9P A;  4F1P A;  2JRJ A;  5J3X A;  4AP4 A;  2EGP A;  3Q1D A;  4AVX A;  4WZ2 A;  5FB1 A;  3O33 A;  2VPG A;  2XEU A;  2MIQ A;  2L80 A;  2IDA A;  2LV9 A;  4AYC A;  2KU3 A;  1MM2 A;  2LN0 A;  2QIZ A;  4C9Z A;  3HCS A;  4LJN A;  2ZET C;  2MUM A;  5H1U A;  2LRI C;  1JM7 B;  2RI7 A;  2KGG A;  2L0B A;  5TAB A;  4B86 C;  2PNX A;  2FUI A;  3EB5 A;  4O62 A;  3LVR E;  3NG2 A;  2ECG A;  2XOZ A;  2ECV A;  3IHP A;  2XP0 A;  2VJF B;  3I2D A;  2YW8 A;  1RMD A;  2JMD A;  3FM8 C;  5SVX A;  2G43 A;  5LKU A;  3T9K A;  2L7P A;  2BAY A;  5C13 A;  1Z2Q A;  2VPD A;  4A4B A;  1LDJ B;  3MHH A;  5B8D A;  3U5P A;  1WEE A;  2UZG A;  3DDT A;  5I3L A;  3N9M A;  4TKP B;  3ZPV 1;  2NAA A;  4ZQL A;  2OXQ C;  2MA6 A;  5B76 A;  3EB6 A;  1LDK C;  2KKY A;  1E4U A;  1F62 A;  2QJ0 A;  4YAX A;  2LGL A;  2YRE A;  2K16 A;  2L75 A;  2LXP C;  2ECT A;  4F52 B;  1V87 A;  2CKL B;  2MD8 C;  3MHS A;  4AUQ B;  4YBM A;  3N9N A;  2MD7 B;  2VPE A;  4YBS A;  1WEM A;  5K3Q A;  2CRR A;  5B77 A;  4XI1 A;  2YUR A;  2H0D B;  4A4C A;  1WIM A;  2XOC A;  5G05 B;  4P5O B;  1JM7 A;  2KIZ A;  3LDY A;  2YHO A;  2Y43 A;  2LGK A;  3SUB A;  1WFK A;  4YAB A;  3PLW A;  3KV6 A;  1FBV A;  3E2D A;  4OGE A;  1WEU A;  3QZV A;  4GND A;  2MA5 A;  2DX8 A;  5LKT A;  3N9L A;  2M6M A;  4YAT A;  2VJF A;  5D1K B;  4WZ3 B;  4FO9 A;  2KFT A;  1X4J A;  2FUU A;  5FEY A;  3FL2 A;  1VD4 A;  2YQL A;  2KWK A;  3SOX A;  3ZYQ A;  5FB0 A;  3O36 A;  5EYA F;  2E61 A;  4UP5 A;  3SOU A;  2ECJ A;  5B79 A;  1G25 A;  4GNF A;  2EOD A;  3KV5 A;  3PHD A;  4FK5 A;  3M99 A;  4BHW A;  3HCT A;  2KYU A;  3O47 A;  3SOW A;  3LRQ A;  4QF3 A;  2PUY A;  3KQI A;  2M3H A;  1Z60 A;  2G45 A;  3ZPV E;  2CKL A;  3HCU A;  4LAD B;  2YHN A;  1VFY A;  4Z0O A;  3V43 A;  2DSM A;  4N3W A;  3N9Q A;  2CSV A;  4FJC A;  4S3O C;  2F42 A;  3LVQ E;  2YSM A;  3O34 A;  2E6S A;  2LAU A;  2H0D A;  2K4D A;  1WIL A;  4A49 A;  5TRB A;  3FAO A;  2QIC A;  5KH7 A;  1N87 A;  2XB1 A;  5SVI B;  2K17 A;  4OGC A;  2VP7 A;  2MNZ A;  1X4I A;  4YAD A;  4R8P K;  2LDR A;  2VPB A;  3M62 A;  4MVT A;  2YQM A;  5TBN A;  4O64 A;  2JMI A;  4CA1 A;  3RPG B;  2LGG A;  2LQ6 A;  3FEH A;  4V3L C;  1FP0 A;  3U5O A;  1JOC A;  4B7Y C;  2C2V S;  5G04 B;  5D1L B;  5SVY A;  2M13 A;  3MDB C;  2RR4 A;  2YVR A;  2VNF A;  4LK9 A;  3FAN A;  3ZNI A;  2EXU A;  4R2Y A;  3KNV A;  5KH3 A;  3GV4 A;  1DVP A;  4UP0 A;  2M85 A;  1WEW A;  2LXH C;  4V3K C;  1CHC A;  4Z0R A;  4PPE A;  2HYE D;  3JUE A;  2KR4 A;  1WEQ A;  4GNE A;  4IC3 A;  3ZTG A;  3O35 A;  1IYM A;  3O7A A;  3SHB A;  3HTK C;  3PUQ A;  5B78 A;  4I7B A;  4I7D A;  4WZ0 A;  3T6R A;  5SVI A;  2XOY A;  2IQJ A;  2VJE B;  3ZVY A;  2KE1 A;  5C11 A;  2F6N A;  2C2L A;  5G0F A;  2MT5 A;  3LQJ A;  4H9D A;  3O37 A;  4X3G A;  2CRW A;  5D1M B;  2D8U A;  4I7C A;  2Y1N A;  5B75 A;  4BBQ A;  1WGM A;  3ASL A;  2D8S A;  3GL6 A;  4LKA A;  3C5K A;  2E6R A;  5LKX A;  2MKE A;  1WEP A;  1U6G B;  2JM3 A;  1HYI A;  4QF2 A;  4WA6 A;  2L5U A;  2JMJ A;  2Y1M A;  5LCW B;  3L1X A;  3L1Z B;  2YSJ A;  4CCG X;  3L11 A;  2FFW A;  4UI9 B;  3KDE C;  1HYJ A;  3M63 A;  1MBM A;  4A0C D;  1K2F A;  2MNY A;  5KH9 A;  5DKA A;  2RSD A;  4FIP A;  2EA6 A;  1DCQ A;  3U5M A;  5FER A;  3U5N A;  2KWO A;  2VJE A;  4N4F A;  4GB0 A;  1X4U A;  2ECW A;  4GNG A;  4YBT A;  1XWH A;  4LLB A;  2B0O E;  3ZVZ B;  2KWJ A;  2YT5 A;  5AIT A;  4L58 A;  3DQV R;  2KRE A;  3H7H A;  4ZUX U;  5JG6 A;  5H1T A;  5TDR A;  1VYX A;  5LKZ A;  5H1V A;  1T1H A;  4QQ4 A;  1MM3 A;  4YC9 A;  3T7L A;  2CSZ A;  3LQH A;  4PTB A;  2HDP A;  3M7K A;  1WEN A;  5TDW A;  3DWD A;  4ZDT A;  2DJA A;  5H9M A;  4AYC B;  2YU4 A;  2CT2 A;  2OWA A;  3RTR B;  2JUN A;  4IC2 A;  2FSA A;  3FJU B;  4L7X A;  3VK6 A;  2CON A;  2ECN A;  3PUR A;  4S3O B;  2KGI A;  2F6J A;  2I50 A;  2LGV A;  4Q6F A;  2M1R A;  2P57 A;  2EGM A;  1WE9 A;  3LQI A;  2CSY A;  1BOR A;  1WEO A;  4R7E A;  1WEV A;  2G6Q A;  2YYR A;  2YUC A;  3RPG C;  2ECI A;  2L43 A;  1WES A;  4MSX A;  2KKX A;  5AIU A;  3N9O A;  5DIN A;  2FD4 A;  1ZBD B;  2AN6 A;  3DPL R;  4NN2 A; 
#chains in the Genus database with same CATH homology
 1Z6U A;  3C6W A;  2KWN A;  4W4U A;  3O70 A;  2K1J A;  3N9P A;  2JRJ A;  5J3X A;  4AP4 A;  2EGP A;  4AVX A;  4WZ2 A;  5FB1 A;  3O33 A;  2VPG A;  2XEU A;  2MIQ A;  2L80 A;  2IDA A;  2LV9 A;  4AYC A;  2KU3 A;  1MM2 A;  2LN0 A;  2QIZ A;  4C9Z A;  3HCS A;  4LJN A;  2ZET C;  2MUM A;  5H1U A;  2LRI C;  1JM7 B;  2RI7 A;  2KGG A;  2L0B A;  5TAB A;  4B86 C;  2PNX A;  2FUI A;  3EB5 A;  3NG2 A;  2ECG A;  2ECV A;  3IHP A;  2VJF B;  3I2D A;  2YW8 A;  1RMD A;  2JMD A;  2G43 A;  5LKU A;  2BAY A;  5C13 A;  1Z2Q A;  2VPD A;  4A4B A;  1LDJ B;  3MHH A;  5B8D A;  3U5P A;  1WEE A;  2UZG A;  5I3L A;  3N9M A;  4TKP B;  3ZPV 1;  2NAA A;  4ZQL A;  2OXQ C;  2MA6 A;  5B76 A;  3EB6 A;  1LDK C;  1E4U A;  1F62 A;  2QJ0 A;  4YAX A;  2LGL A;  2YRE A;  2K16 A;  2L75 A;  2LXP C;  2ECT A;  4F52 B;  1V87 A;  2CKL B;  2MD8 C;  3MHS A;  4AUQ B;  4YBM A;  3N9N A;  2MD7 B;  2VPE A;  4YBS A;  1WEM A;  5B77 A;  4XI1 A;  2YUR A;  2H0D B;  4A4C A;  1WIM A;  5G05 B;  4P5O B;  1JM7 A;  2KIZ A;  2YHO A;  2Y43 A;  2LGK A;  1WFK A;  4YAB A;  3KV6 A;  1FBV A;  1WEU A;  3QZV A;  4GND A;  2MA5 A;  2DX8 A;  5LKT A;  3N9L A;  2M6M A;  4YAT A;  2VJF A;  5D1K B;  4WZ3 B;  4FO9 A;  2KFT A;  1X4J A;  2FUU A;  5FEY A;  3FL2 A;  1VD4 A;  2YQL A;  2KWK A;  3SOX A;  3ZYQ A;  5FB0 A;  3O36 A;  5EYA F;  4UP5 A;  3SOU A;  2ECJ A;  5B79 A;  1G25 A;  4GNF A;  2EOD A;  3KV5 A;  3PHD A;  4FK5 A;  3M99 A;  4BHW A;  3HCT A;  2KYU A;  3SOW A;  3LRQ A;  4QF3 A;  2PUY A;  3KQI A;  2M3H A;  2G45 A;  1Z60 A;  3ZPV E;  2CKL A;  3HCU A;  4LAD B;  2YHN A;  1VFY A;  3V43 A;  4N3W A;  3N9Q A;  4FJC A;  4S3O C;  2F42 A;  2YSM A;  3O34 A;  2E6S A;  2H0D A;  2K4D A;  1WIL A;  4A49 A;  5TRB A;  2QIC A;  5KH7 A;  1N87 A;  2XB1 A;  2K17 A;  2VP7 A;  2MNZ A;  1X4I A;  4YAD A;  4R8P K;  2LDR A;  2VPB A;  3M62 A;  4MVT A;  2YQM A;  5TBN A;  4O64 A;  2JMI A;  4CA1 A;  3RPG B;  2LGG A;  2LQ6 A;  4V3L C;  1FP0 A;  3U5O A;  1JOC A;  4B7Y C;  2C2V S;  5G04 B;  5D1L B;  2VNF A;  4LK9 A;  3ZNI A;  4R2Y A;  3KNV A;  5KH3 A;  3GV4 A;  1DVP A;  4UP0 A;  2M85 A;  1WEW A;  2LXH C;  4V3K C;  1CHC A;  4PPE A;  2HYE D;  2KR4 A;  1WEQ A;  4GNE A;  4IC3 A;  3ZTG A;  3O35 A;  1IYM A;  3O7A A;  3SHB A;  3HTK C;  3PUQ A;  5B78 A;  4I7B A;  4I7D A;  4WZ0 A;  3T6R A;  2VJE B;  3ZVY A;  2KE1 A;  5C11 A;  2F6N A;  2C2L A;  5G0F A;  2MT5 A;  3LQJ A;  3O37 A;  4X3G A;  5D1M B;  4I7C A;  2Y1N A;  5B75 A;  4BBQ A;  1WGM A;  3ASL A;  2D8S A;  3GL6 A;  3C5K A;  4LKA A;  2E6R A;  5LKX A;  1WEP A;  1U6G B;  1HYI A;  4QF2 A;  4WA6 A;  2L5U A;  2JMJ A;  2Y1M A;  5LCW B;  3L1X A;  3L1Z B;  2YSJ A;  4CCG X;  3L11 A;  4UI9 B;  1HYJ A;  3M63 A;  4A0C D;  1K2F A;  5KH9 A;  2MNY A;  5DKA A;  2RSD A;  4FIP A;  2EA6 A;  3U5M A;  5FER A;  3U5N A;  2KWO A;  2VJE A;  4N4F A;  4GB0 A;  1X4U A;  2ECW A;  4YBT A;  4GNG A;  1XWH A;  4LLB A;  3ZVZ B;  2KWJ A;  2YT5 A;  5AIT A;  4L58 A;  3DQV R;  2KRE A;  4ZUX U;  5JG6 A;  5H1T A;  5TDR A;  1VYX A;  5LKZ A;  5H1V A;  1T1H A;  4YC9 A;  1MM3 A;  3T7L A;  2CSZ A;  3LQH A;  4PTB A;  2HDP A;  1WEN A;  5TDW A;  4ZDT A;  5H9M A;  4AYC B;  2YU4 A;  2CT2 A;  3RTR B;  4IC2 A;  2FSA A;  4L7X A;  3VK6 A;  2ECN A;  3PUR A;  4S3O B;  2KGI A;  2F6J A;  2I50 A;  2LGV A;  4Q6F A;  2M1R A;  1WE9 A;  3LQI A;  2CSY A;  1BOR A;  1WEO A;  4R7E A;  1WEV A;  2G6Q A;  2YYR A;  2YUC A;  3RPG C;  2ECI A;  2L43 A;  1WES A;  4MSX A;  5AIU A;  3N9O A;  5DIN A;  1ZBD B;  2AN6 A;  3DPL R;  4NN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...