4WZ3B

Crystal structure of the complex between lubx/legu2/lpp2887 u-box 1 and homo sapiens ube2d2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
183
structure length
183
Chain Sequence
RNPFDIDHKSKYLREAALEANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVAARQKEYTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDELYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 183
sequence length 183
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz3B02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz3B01
3SHBA 4LLBA 4IC2A 3EB6A 4YBTA 5B8DA 3N9LA 5TRBA 2CKLA 1WEUA 3MHHA 1WIMA 4WZ0A 2K16A 5I3LA 1E4UA 2MT5A 3NG2A 4I7DA 1Z60A 5H1TA 2LXHC 1K2FA 1X4JA 4C9ZA 5LKZA 2K17A 2MA5A 2C2LA 2LXPC 1N87A 2MD7B 2ECNA 1U6GB 2Y1NA 3O36A 3T7LA 5TDWA 3C5KA 2YUCA 4P5OB 4AP4A 2KR4A 3PUQA 3ZVYA 2JMDA 2JMIA 3HTKC 3N9NA 4MSXA 1WEPA 2K4DA 4ZDTA 2JMJA 5LCWB 2VJEB 5B79A 3O70A 3ZVZB 1DVPA 1LDKC 3PURA 2FUIA 4GNFA 4YBMA 3DPLR 1FBVA 2G43A 4A49A 2AN6A 1VYXA 3N9QA 4R8PK 2VP7A 4TKPB 2C2VS 3EB5A 2MUMA 2KREA 2VPGA 3LQHA 3MHSA 2Y43A 1RMDA 2YHOA 1WEEA 2ECVA 3O33A 5TDRA 1MM2A 4BHWA 4B86C 3IHPA 1JOCA 5KH7A 3M99A 3GV4A 2I50A 2KIZA 4L58A 2L5UA 3SOUA 2H0DA 1VFYA 2KWJA 2VJFB 4AUQB 2M3HA 4YBSA 4N4FA 2LGGA 3LQJA 1WENA 2VPEA 5D1KB 5C13A 4YABA 4BBQA 1WEQA 3N9PA 2CSZA 2RSDA 2PNXA 5TABA 3C6WA 3RPGB 2RI7A 4A0CD 1WEMA 2M1RA 2LV9A 3RPGC 4CA1A 1VD4A 4GNEA 3FL2A 2L80A 2L75A 2LDRA 3N9MA 2UZGA 2D8SA 3O7AA 1WGMA 2ECWA 2NAAA 5G04B 5DINA 4WZ2A 5H1UA 4A4BA 5B75A 4FK5A 1X4UA 3KQIA 2ECTA 2M6MA 4QF2A 2ECGA 3T6RA 4B7YC 2CT2A 3HCSA 3U5NA 4S3OB 3DQVR 2MD8C 4YADA 2HDPA 1CHCA 2MNYA 5B77A 4S3OC 4LADB 2YW8A 4UI9B 1JM7B 2KYUA 1MM3A 2KU3A 1ZBDB 3KV5A 2IDAA 1Z6UA 5TBNA 2H0DB 3ASLA 5G0FA 5J3XA 2YHNA 2FUUA 4GNDA 3L1ZB 4WZ3B 4XI1A 4YATA 2EA6A 2XEUA 5AITA 1WFKA 4NN2A 2KFTA 4ZQLA 3SOXA 1XWHA 5B76A 2OXQC 3RTRB 2F6JA 2HYED 2G45A 2YU4A 4AYCA 3O37A 2CKLB 2LN0A 4GB0A 2G6QA 1WE9A 2ECJA 2KE1A 4LJNA 4UP0A 5D1LB 3M63A 3SOWA 4MVTA 2KGIA 2LGVA 3L1XA 2LQ6A 2EODA 3O34A 2FSAA 2YURA 1F62A 3ZTGA 4FO9A 5C11A 5KH3A 2MIQA 1V87A 2F42A 5AIUA 5DKAA 3L11A 4V3LC 2KWNA 4R7EA 3KV6A 4V3KC 2KGGA 3U5MA 2MA6A 4FIPA 2KWOA 4WA6A 2MNZA 2L43A 2VPDA 3KNVA 3VK6A 5FERA 5LKXA 3HCUA 5KH9A 2QJ0A 2YSMA 5EYAF 1HYIA 2PUYA 2L0BA 5H1VA 2E6RA 3HCTA 2YQLA 5H9MA 2VJFA 4PPEA 2LGLA 2F6NA 5D1MB 4GNGA 3QZVA 2E6SA 5LKUA 5LKTA 2BAYA 2LGKA 2DX8A 4R2YA 4FJCA 3U5OA 2EGPA 4AVXA 1LDJB 2YSJA 5B78A 4QF3A 3ZPV1 4PTBA 4YC9A 4L7XA 1FP0A 4AYCB 3ZNIA 3I2DA 3U5PA 4W4UA 1WILA 3LQIA 3V43A 4F52B 5FB0A 1IYMA 2QIZA 2LRIC 2VNFA 3ZYQA 2XB1A 2YYRA 1WEVA 1Z2QA 4A4CA 4ZUXU 2Y1MA 4LKAA 2JRJA 4Q6FA 2QICA 4UP5A 2ZETC 5FEYA 3PHDA 2KWKA 3ZPVE 2VJEA 4IC3A 5FB1A 2YT5A 4N3WA 1HYJA 1WESA 1BORA 4CCGX 1G25A 2YREA 2YQMA 3LRQA 1JM7A 4O64A 1X4IA 2VPBA 1WEOA 2CSYA 3O35A 5G05B 4I7BA 4X3GA 3M62A 2ECIA 2M85A 2K1JA 4LK9A 4I7CA 3GL6A 3N9OA 1WEWA 4YAXA 1T1HA 5JG6A
chains in the Genus database with same CATH superfamily
3SHBA 4LLBA 4IC2A 3EB6A 4YBTA 5B8DA 3N9LA 5TRBA 2CKLA 1WEUA 3Q1DA 3MHHA 1WIMA 4WZ0A 2K16A 5I3LA 1E4UA 2MT5A 3NG2A 4I7DA 1Z60A 5H1TA 2LXHC 1K2FA 1X4JA 4C9ZA 5LKZA 2K17A 2MA5A 2C2LA 2LXPC 1N87A 2MD7B 2ECNA 2EXUA 1U6GB 2Y1NA 3O36A 3T7LA 3PLWA 3C5KA 4P5OB 2YUCA 5TDWA 4AP4A 2KR4A 3PUQA 3ZVYA 2JMDA 2JMIA 3HTKC 3N9NA 4MSXA 1WEPA 2K4DA 4ZDTA 2JMJA 5LCWB 2VJEB 3LJUX 5B79A 3O70A 3ZVZB 2D8UA 1DVPA 2B0OE 1LDKC 3PURA 2FUIA 4GNFA 4YBMA 3DPLR 1FBVA 2JUNA 2G43A 4A49A 2AN6A 1VYXA 3N9QA 4R8PK 2VP7A 4TKPB 2C2VS 3EB5A 2MUMA 2FFWA 4O62A 3H7HA 2KREA 2VPGA 3LQHA 4Z0OA 4QQ4A 3MHSA 2FD4A 2Y43A 1RMDA 2YHOA 1WEEA 2ECVA 3O33A 5TDRA 1MM2A 4BHWA 3LDYA 2OWAA 4B86C 3IHPA 1JOCA 3O47A 5KH7A 3M99A 2MKEA 4H9DA 3GV4A 3KDEC 2I50A 2KIZA 4L58A 5SVXA 2L5UA 3SOUA 2H0DA 1VFYA 2KWJA 2VJFB 4AUQB 2M3HA 4YBSA 4N4FA 2LGGA 3FEHA 3LQJA 1WENA 2VPEA 5D1KB 5C13A 4YABA 2KKYA 4BBQA 1WEQA 3N9PA 2CSZA 2RSDA 2PNXA 5TABA 3C6WA 3RPGB 2RI7A 5SVIA 3DWDA 4A0CD 1WEMA 2DSMA 2M1RA 2LV9A 2DJAA 3RPGC 4CA1A 1VD4A 3E2DA 2XOCA 4GNEA 3FL2A 2L80A 2L75A 2LDRA 3N9MA 2UZGA 2D8SA 3O7AA 1WGMA 2ECWA 2NAAA 5G04B 2P57A 5DINA 4WZ2A 5H1UA 4A4BA 5B75A 2XP0A 4FK5A 1X4UA 3KQIA 2ECTA 2M6MA 4QF2A 2ECGA 3T6RA 1MBMA 4OGEA 4B7YC 2CRWA 2CT2A 3HCSA 3U5NA 4S3OB 5K3QA 3DQVR 2MD8C 4YADA 2HDPA 1CHCA 2MNYA 5B77A 4S3OC 4LADB 2YW8A 2JM3A 4UI9B 1JM7B 2KYUA 1MM3A 3LVRE 2KU3A 1ZBDB 2EGMA 3KV5A 2IDAA 1Z6UA 3FAOA 5TBNA 2H0DB 3ASLA 5G0FA 2CSVA 5J3XA 2YHNA 2FUUA 4GNDA 2XOZA 3L1ZB 4WZ3B 2CRRA 4XI1A 2EA6A 4YATA 2XEUA 4Z0RA 5AITA 1WFKA 4NN2A 2KFTA 4ZQLA 3SOXA 1XWHA 5B76A 2OXQC 3RTRB 2F6JA 2HYED 2G45A 2YU4A 4AYCA 3O37A 2CKLB 2LN0A 4F1PA 4GB0A 5SVIB 3FM8C 2G6QA 1WE9A 2ECJA 2KE1A 4LJNA 4OGCA 4UP0A 5D1LB 3M63A 3SOWA 4MVTA 2KGIA 2LGVA 3L1XA 2LQ6A 2M13A 2EODA 3O34A 2FSAA 2YURA 1F62A 3ZTGA 4FO9A 5C11A 5KH3A 2MIQA 2RR4A 2XOYA 1V87A 2F42A 5AIUA 5DKAA 3L11A 4V3LC 2KWNA 4R7EA 3KV6A 4V3KC 2KGGA 3U5MA 2MA6A 4FIPA 2KWOA 4WA6A 2MNZA 2L43A 2VPDA 3KNVA 3FJUB 3VK6A 5FERA 5LKXA 3HCUA 3LVQE 5KH9A 2QJ0A 2YSMA 5EYAF 1HYIA 2PUYA 2L0BA 5H1VA 3M7KA 2E6RA 3HCTA 2YQLA 5H9MA 2VJFA 4PPEA 2LGLA 2F6NA 5D1MB 4GNGA 3QZVA 2E6SA 5LKUA 5LKTA 1DCQA 2BAYA 2LGKA 2DX8A 4R2YA 4FJCA 3U5OA 2EGPA 4AVXA 1LDJB 2YSJA 5B78A 4QF3A 5SVYA 3ZPV1 4PTBA 4YC9A 4L7XA 3JUEA 1FP0A 4AYCB 2E61A 3ZNIA 3I2DA 3U5PA 4W4UA 1WILA 3LQIA 3DDTA 3V43A 4F52B 5FB0A 1IYMA 2QIZA 2LRIC 2VNFA 2YVRA 3ZYQA 2XB1A 3T9KA 2YYRA 1WEVA 3FANA 1Z2QA 4A4CA 4ZUXU 2LAUA 2Y1MA 4LKAA 2JRJA 4Q6FA 2QICA 4UP5A 2ZETC 5FEYA 3PHDA 2KWKA 2CONA 2L7PA 3ZPVE 2VJEA 4IC3A 5FB1A 2YT5A 2IQJA 4N3WA 1HYJA 1WESA 1BORA 4CCGX 1G25A 2YREA 2YQMA 3LRQA 1JM7A 4O64A 1X4IA 2VPBA 2KKXA 1WEOA 2CSYA 3O35A 5G05B 4I7BA 4X3GA 3M62A 2ECIA 2M85A 2K1JA 3SUBA 4LK9A 4I7CA 3MDBC 3GL6A 3N9OA 1WEWA 4YAXA 1T1HA 5JG6A
chains in the Genus database with same CATH topology
3SHBA 4LLBA 4IC2A 3EB6A 4YBTA 5B8DA 3N9LA 5TRBA 2CKLA 1WEUA 3MHHA 1WIMA 4WZ0A 2K16A 5I3LA 1E4UA 2MT5A 3NG2A 4I7DA 1Z60A 5H1TA 2LXHC 1K2FA 1X4JA 4C9ZA 5LKZA 2K17A 2MA5A 2C2LA 2LXPC 1N87A 2MD7B 2ECNA 1U6GB 2Y1NA 3O36A 3T7LA 5TDWA 3C5KA 2YUCA 4P5OB 4AP4A 2KR4A 3PUQA 3ZVYA 2JMDA 2JMIA 3HTKC 3N9NA 4MSXA 1WEPA 2K4DA 4ZDTA 2JMJA 5LCWB 2VJEB 5B79A 3O70A 3ZVZB 1DVPA 1LDKC 3PURA 2FUIA 4GNFA 4YBMA 3DPLR 1FBVA 2G43A 4A49A 2AN6A 1VYXA 3N9QA 4R8PK 2VP7A 4TKPB 2C2VS 3EB5A 2MUMA 2KREA 2VPGA 3LQHA 3MHSA 2Y43A 1RMDA 2YHOA 1WEEA 2ECVA 3O33A 5TDRA 1MM2A 4BHWA 4B86C 3IHPA 1JOCA 5KH7A 3M99A 3GV4A 2I50A 2KIZA 4L58A 2L5UA 3SOUA 2H0DA 1VFYA 2KWJA 2VJFB 4AUQB 2M3HA 4YBSA 4N4FA 2LGGA 3LQJA 1WENA 2VPEA 5D1KB 5C13A 4YABA 4BBQA 1WEQA 3N9PA 2CSZA 2RSDA 2PNXA 5TABA 3C6WA 3RPGB 2RI7A 4A0CD 1WEMA 2M1RA 2LV9A 3RPGC 4CA1A 1VD4A 4GNEA 3FL2A 2L80A 2L75A 2LDRA 3N9MA 2UZGA 2D8SA 3O7AA 1WGMA 2ECWA 2NAAA 5G04B 5DINA 4WZ2A 5H1UA 4A4BA 5B75A 4FK5A 1X4UA 3KQIA 2ECTA 2M6MA 4QF2A 2ECGA 3T6RA 4B7YC 2CT2A 3HCSA 3U5NA 4S3OB 3DQVR 2MD8C 4YADA 2HDPA 1CHCA 2MNYA 5B77A 4S3OC 4LADB 2YW8A 4UI9B 1JM7B 2KYUA 1MM3A 2KU3A 1ZBDB 3KV5A 2IDAA 1Z6UA 5TBNA 2H0DB 3ASLA 5G0FA 5J3XA 2YHNA 2FUUA 4GNDA 3L1ZB 4WZ3B 4XI1A 4YATA 2EA6A 2XEUA 5AITA 1WFKA 4NN2A 2KFTA 4ZQLA 3SOXA 1XWHA 5B76A 2OXQC 3RTRB 2F6JA 2HYED 2G45A 2YU4A 4AYCA 3O37A 2CKLB 2LN0A 4GB0A 2G6QA 1WE9A 2ECJA 2KE1A 4LJNA 4UP0A 5D1LB 3M63A 3SOWA 4MVTA 2KGIA 2LGVA 3L1XA 2LQ6A 2EODA 3O34A 2FSAA 2YURA 1F62A 3ZTGA 4FO9A 5C11A 5KH3A 2MIQA 1V87A 2F42A 5AIUA 5DKAA 3L11A 4V3LC 2KWNA 4R7EA 3KV6A 4V3KC 2KGGA 3U5MA 2MA6A 4FIPA 2KWOA 4WA6A 2MNZA 2L43A 2VPDA 3KNVA 3VK6A 5FERA 5LKXA 3HCUA 5KH9A 2QJ0A 2YSMA 5EYAF 1HYIA 2PUYA 2L0BA 5H1VA 2E6RA 3HCTA 2YQLA 5H9MA 2VJFA 4PPEA 2LGLA 2F6NA 5D1MB 4GNGA 3QZVA 2E6SA 5LKUA 5LKTA 2BAYA 2LGKA 2DX8A 4R2YA 4FJCA 3U5OA 2EGPA 4AVXA 1LDJB 2YSJA 5B78A 4QF3A 3ZPV1 4PTBA 4YC9A 4L7XA 1FP0A 4AYCB 3ZNIA 3I2DA 3U5PA 4W4UA 1WILA 3LQIA 3V43A 4F52B 5FB0A 1IYMA 2QIZA 2LRIC 2VNFA 3ZYQA 2XB1A 2YYRA 1WEVA 1Z2QA 4A4CA 4ZUXU 2Y1MA 4LKAA 2JRJA 4Q6FA 2QICA 4UP5A 2ZETC 5FEYA 3PHDA 2KWKA 3ZPVE 2VJEA 4IC3A 5FB1A 2YT5A 4N3WA 1HYJA 1WESA 1BORA 4CCGX 1G25A 2YREA 2YQMA 3LRQA 1JM7A 4O64A 1X4IA 2VPBA 1WEOA 2CSYA 3O35A 5G05B 4I7BA 4X3GA 3M62A 2ECIA 2M85A 2K1JA 4LK9A 4I7CA 3GL6A 3N9OA 1WEWA 4YAXA 1T1HA 5JG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHB A;  4LLB A;  4IC2 A;  3EB6 A;  4YBT A;  5B8D A;  3N9L A;  5TRB A;  2CKL A;  1WEU A;  3MHH A;  1WIM A;  4WZ0 A;  2K16 A;  5I3L A;  1E4U A;  2MT5 A;  3NG2 A;  4I7D A;  1Z60 A;  5H1T A;  2LXH C;  1K2F A;  1X4J A;  4C9Z A;  5LKZ A;  2K17 A;  2MA5 A;  2C2L A;  2LXP C;  1N87 A;  2MD7 B;  2ECN A;  1U6G B;  2Y1N A;  3O36 A;  3T7L A;  5TDW A;  3C5K A;  2YUC A;  4P5O B;  4AP4 A;  2KR4 A;  3PUQ A;  3ZVY A;  2JMD A;  2JMI A;  3HTK C;  3N9N A;  4MSX A;  1WEP A;  2K4D A;  4ZDT A;  2JMJ A;  5LCW B;  2VJE B;  5B79 A;  3O70 A;  3ZVZ B;  1DVP A;  1LDK C;  3PUR A;  2FUI A;  4GNF A;  4YBM A;  3DPL R;  1FBV A;  2G43 A;  4A49 A;  2AN6 A;  1VYX A;  3N9Q A;  4R8P K;  2VP7 A;  4TKP B;  2C2V S;  3EB5 A;  2MUM A;  2KRE A;  2VPG A;  3LQH A;  3MHS A;  2Y43 A;  1RMD A;  2YHO A;  1WEE A;  2ECV A;  3O33 A;  5TDR A;  1MM2 A;  4BHW A;  4B86 C;  3IHP A;  1JOC A;  5KH7 A;  3M99 A;  3GV4 A;  2I50 A;  2KIZ A;  4L58 A;  2L5U A;  3SOU A;  2H0D A;  1VFY A;  2KWJ A;  2VJF B;  4AUQ B;  2M3H A;  4YBS A;  4N4F A;  2LGG A;  3LQJ A;  1WEN A;  2VPE A;  5D1K B;  5C13 A;  4YAB A;  4BBQ A;  1WEQ A;  3N9P A;  2CSZ A;  2RSD A;  2PNX A;  5TAB A;  3C6W A;  3RPG B;  2RI7 A;  4A0C D;  1WEM A;  2M1R A;  2LV9 A;  3RPG C;  4CA1 A;  1VD4 A;  4GNE A;  3FL2 A;  2L80 A;  2L75 A;  2LDR A;  3N9M A;  2UZG A;  2D8S A;  3O7A A;  1WGM A;  2ECW A;  2NAA A;  5G04 B;  5DIN A;  4WZ2 A;  5H1U A;  4A4B A;  5B75 A;  4FK5 A;  1X4U A;  3KQI A;  2ECT A;  2M6M A;  4QF2 A;  2ECG A;  3T6R A;  4B7Y C;  2CT2 A;  3HCS A;  3U5N A;  4S3O B;  3DQV R;  2MD8 C;  4YAD A;  2HDP A;  1CHC A;  2MNY A;  5B77 A;  4S3O C;  4LAD B;  2YW8 A;  4UI9 B;  1JM7 B;  2KYU A;  1MM3 A;  2KU3 A;  1ZBD B;  3KV5 A;  2IDA A;  1Z6U A;  5TBN A;  2H0D B;  3ASL A;  5G0F A;  5J3X A;  2YHN A;  2FUU A;  4GND A;  3L1Z B;  4WZ3 B;  4XI1 A;  4YAT A;  2EA6 A;  2XEU A;  5AIT A;  1WFK A;  4NN2 A;  2KFT A;  4ZQL A;  3SOX A;  1XWH A;  5B76 A;  2OXQ C;  3RTR B;  2F6J A;  2HYE D;  2G45 A;  2YU4 A;  4AYC A;  3O37 A;  2CKL B;  2LN0 A;  4GB0 A;  2G6Q A;  1WE9 A;  2ECJ A;  2KE1 A;  4LJN A;  4UP0 A;  5D1L B;  3M63 A;  3SOW A;  4MVT A;  2KGI A;  2LGV A;  3L1X A;  2LQ6 A;  2EOD A;  3O34 A;  2FSA A;  2YUR A;  1F62 A;  3ZTG A;  4FO9 A;  5C11 A;  5KH3 A;  2MIQ A;  1V87 A;  2F42 A;  5AIU A;  5DKA A;  3L11 A;  4V3L C;  2KWN A;  4R7E A;  3KV6 A;  4V3K C;  2KGG A;  3U5M A;  2MA6 A;  4FIP A;  2KWO A;  4WA6 A;  2MNZ A;  2L43 A;  2VPD A;  3KNV A;  3VK6 A;  5FER A;  5LKX A;  3HCU A;  5KH9 A;  2QJ0 A;  2YSM A;  5EYA F;  1HYI A;  2PUY A;  2L0B A;  5H1V A;  2E6R A;  3HCT A;  2YQL A;  5H9M A;  2VJF A;  4PPE A;  2LGL A;  2F6N A;  5D1M B;  4GNG A;  3QZV A;  2E6S A;  5LKU A;  5LKT A;  2BAY A;  2LGK A;  2DX8 A;  4R2Y A;  4FJC A;  3U5O A;  2EGP A;  4AVX A;  1LDJ B;  2YSJ A;  5B78 A;  4QF3 A;  3ZPV 1;  4PTB A;  4YC9 A;  4L7X A;  1FP0 A;  4AYC B;  3ZNI A;  3I2D A;  3U5P A;  4W4U A;  1WIL A;  3LQI A;  3V43 A;  4F52 B;  5FB0 A;  1IYM A;  2QIZ A;  2LRI C;  2VNF A;  3ZYQ A;  2XB1 A;  2YYR A;  1WEV A;  1Z2Q A;  4A4C A;  4ZUX U;  2Y1M A;  4LKA A;  2JRJ A;  4Q6F A;  2QIC A;  4UP5 A;  2ZET C;  5FEY A;  3PHD A;  2KWK A;  3ZPV E;  2VJE A;  4IC3 A;  5FB1 A;  2YT5 A;  4N3W A;  1HYJ A;  1WES A;  1BOR A;  4CCG X;  1G25 A;  2YRE A;  2YQM A;  3LRQ A;  1JM7 A;  4O64 A;  1X4I A;  2VPB A;  1WEO A;  2CSY A;  3O35 A;  5G05 B;  4I7B A;  4X3G A;  3M62 A;  2ECI A;  2M85 A;  2K1J A;  4LK9 A;  4I7C A;  3GL6 A;  3N9O A;  1WEW A;  4YAX A;  1T1H A;  5JG6 A; 
#chains in the Genus database with same CATH topology
 3SHB A;  4LLB A;  4IC2 A;  3EB6 A;  4YBT A;  5B8D A;  3N9L A;  5TRB A;  2CKL A;  1WEU A;  3Q1D A;  3MHH A;  1WIM A;  4WZ0 A;  2K16 A;  5I3L A;  1E4U A;  2MT5 A;  3NG2 A;  4I7D A;  1Z60 A;  5H1T A;  2LXH C;  1K2F A;  1X4J A;  4C9Z A;  5LKZ A;  2K17 A;  2MA5 A;  2C2L A;  2LXP C;  1N87 A;  2MD7 B;  2ECN A;  2EXU A;  1U6G B;  2Y1N A;  3O36 A;  3T7L A;  3PLW A;  3C5K A;  4P5O B;  2YUC A;  5TDW A;  4AP4 A;  2KR4 A;  3PUQ A;  3ZVY A;  2JMD A;  2JMI A;  3HTK C;  3N9N A;  4MSX A;  1WEP A;  2K4D A;  4ZDT A;  2JMJ A;  5LCW B;  2VJE B;  3LJU X;  5B79 A;  3O70 A;  3ZVZ B;  2D8U A;  1DVP A;  2B0O E;  1LDK C;  3PUR A;  2FUI A;  4GNF A;  4YBM A;  3DPL R;  1FBV A;  2JUN A;  2G43 A;  4A49 A;  2AN6 A;  1VYX A;  3N9Q A;  4R8P K;  2VP7 A;  4TKP B;  2C2V S;  3EB5 A;  2MUM A;  2FFW A;  4O62 A;  3H7H A;  2KRE A;  2VPG A;  3LQH A;  4Z0O A;  4QQ4 A;  3MHS A;  2FD4 A;  2Y43 A;  1RMD A;  2YHO A;  1WEE A;  2ECV A;  3O33 A;  5TDR A;  1MM2 A;  4BHW A;  3LDY A;  2OWA A;  4B86 C;  3IHP A;  1JOC A;  3O47 A;  5KH7 A;  3M99 A;  2MKE A;  4H9D A;  3GV4 A;  3KDE C;  2I50 A;  2KIZ A;  4L58 A;  5SVX A;  2L5U A;  3SOU A;  2H0D A;  1VFY A;  2KWJ A;  2VJF B;  4AUQ B;  2M3H A;  4YBS A;  4N4F A;  2LGG A;  3FEH A;  3LQJ A;  1WEN A;  2VPE A;  5D1K B;  5C13 A;  4YAB A;  2KKY A;  4BBQ A;  1WEQ A;  3N9P A;  2CSZ A;  2RSD A;  2PNX A;  5TAB A;  3C6W A;  3RPG B;  2RI7 A;  5SVI A;  3DWD A;  4A0C D;  1WEM A;  2DSM A;  2M1R A;  2LV9 A;  2DJA A;  3RPG C;  4CA1 A;  1VD4 A;  3E2D A;  2XOC A;  4GNE A;  3FL2 A;  2L80 A;  2L75 A;  2LDR A;  3N9M A;  2UZG A;  2D8S A;  3O7A A;  1WGM A;  2ECW A;  2NAA A;  5G04 B;  2P57 A;  5DIN A;  4WZ2 A;  5H1U A;  4A4B A;  5B75 A;  2XP0 A;  4FK5 A;  1X4U A;  3KQI A;  2ECT A;  2M6M A;  4QF2 A;  2ECG A;  3T6R A;  1MBM A;  4OGE A;  4B7Y C;  2CRW A;  2CT2 A;  3HCS A;  3U5N A;  4S3O B;  5K3Q A;  3DQV R;  2MD8 C;  4YAD A;  2HDP A;  1CHC A;  2MNY A;  5B77 A;  4S3O C;  4LAD B;  2YW8 A;  2JM3 A;  4UI9 B;  1JM7 B;  2KYU A;  1MM3 A;  3LVR E;  2KU3 A;  1ZBD B;  2EGM A;  3KV5 A;  2IDA A;  1Z6U A;  3FAO A;  5TBN A;  2H0D B;  3ASL A;  5G0F A;  2CSV A;  5J3X A;  2YHN A;  2FUU A;  4GND A;  2XOZ A;  3L1Z B;  4WZ3 B;  2CRR A;  4XI1 A;  2EA6 A;  4YAT A;  2XEU A;  4Z0R A;  5AIT A;  1WFK A;  4NN2 A;  2KFT A;  4ZQL A;  3SOX A;  1XWH A;  5B76 A;  2OXQ C;  3RTR B;  2F6J A;  2HYE D;  2G45 A;  2YU4 A;  4AYC A;  3O37 A;  2CKL B;  2LN0 A;  4F1P A;  4GB0 A;  5SVI B;  3FM8 C;  2G6Q A;  1WE9 A;  2ECJ A;  2KE1 A;  4LJN A;  4OGC A;  4UP0 A;  5D1L B;  3M63 A;  3SOW A;  4MVT A;  2KGI A;  2LGV A;  3L1X A;  2LQ6 A;  2M13 A;  2EOD A;  3O34 A;  2FSA A;  2YUR A;  1F62 A;  3ZTG A;  4FO9 A;  5C11 A;  5KH3 A;  2MIQ A;  2RR4 A;  2XOY A;  1V87 A;  2F42 A;  5AIU A;  5DKA A;  3L11 A;  4V3L C;  2KWN A;  4R7E A;  3KV6 A;  4V3K C;  2KGG A;  3U5M A;  2MA6 A;  4FIP A;  2KWO A;  4WA6 A;  2MNZ A;  2L43 A;  2VPD A;  3KNV A;  3FJU B;  3VK6 A;  5FER A;  5LKX A;  3HCU A;  3LVQ E;  5KH9 A;  2QJ0 A;  2YSM A;  5EYA F;  1HYI A;  2PUY A;  2L0B A;  5H1V A;  3M7K A;  2E6R A;  3HCT A;  2YQL A;  5H9M A;  2VJF A;  4PPE A;  2LGL A;  2F6N A;  5D1M B;  4GNG A;  3QZV A;  2E6S A;  5LKU A;  5LKT A;  1DCQ A;  2BAY A;  2LGK A;  2DX8 A;  4R2Y A;  4FJC A;  3U5O A;  2EGP A;  4AVX A;  1LDJ B;  2YSJ A;  5B78 A;  4QF3 A;  5SVY A;  3ZPV 1;  4PTB A;  4YC9 A;  4L7X A;  3JUE A;  1FP0 A;  4AYC B;  2E61 A;  3ZNI A;  3I2D A;  3U5P A;  4W4U A;  1WIL A;  3LQI A;  3DDT A;  3V43 A;  4F52 B;  5FB0 A;  1IYM A;  2QIZ A;  2LRI C;  2VNF A;  2YVR A;  3ZYQ A;  2XB1 A;  3T9K A;  2YYR A;  1WEV A;  3FAN A;  1Z2Q A;  4A4C A;  4ZUX U;  2LAU A;  2Y1M A;  4LKA A;  2JRJ A;  4Q6F A;  2QIC A;  4UP5 A;  2ZET C;  5FEY A;  3PHD A;  2KWK A;  2CON A;  2L7P A;  3ZPV E;  2VJE A;  4IC3 A;  5FB1 A;  2YT5 A;  2IQJ A;  4N3W A;  1HYJ A;  1WES A;  1BOR A;  4CCG X;  1G25 A;  2YRE A;  2YQM A;  3LRQ A;  1JM7 A;  4O64 A;  1X4I A;  2VPB A;  2KKX A;  1WEO A;  2CSY A;  3O35 A;  5G05 B;  4I7B A;  4X3G A;  3M62 A;  2ECI A;  2M85 A;  2K1J A;  3SUB A;  4LK9 A;  4I7C A;  3MDB C;  3GL6 A;  3N9O A;  1WEW A;  4YAX A;  1T1H A;  5JG6 A; 
#chains in the Genus database with same CATH homology
 3SHB A;  4LLB A;  4IC2 A;  3EB6 A;  4YBT A;  5B8D A;  3N9L A;  5TRB A;  2CKL A;  1WEU A;  3MHH A;  1WIM A;  4WZ0 A;  2K16 A;  5I3L A;  1E4U A;  2MT5 A;  3NG2 A;  4I7D A;  1Z60 A;  5H1T A;  2LXH C;  1K2F A;  1X4J A;  4C9Z A;  5LKZ A;  2K17 A;  2MA5 A;  2C2L A;  2LXP C;  1N87 A;  2MD7 B;  2ECN A;  1U6G B;  2Y1N A;  3O36 A;  3T7L A;  5TDW A;  3C5K A;  2YUC A;  4P5O B;  4AP4 A;  2KR4 A;  3PUQ A;  3ZVY A;  2JMD A;  2JMI A;  3HTK C;  3N9N A;  4MSX A;  1WEP A;  2K4D A;  4ZDT A;  2JMJ A;  5LCW B;  2VJE B;  5B79 A;  3O70 A;  3ZVZ B;  1DVP A;  1LDK C;  3PUR A;  2FUI A;  4GNF A;  4YBM A;  3DPL R;  1FBV A;  2G43 A;  4A49 A;  2AN6 A;  1VYX A;  3N9Q A;  4R8P K;  2VP7 A;  4TKP B;  2C2V S;  3EB5 A;  2MUM A;  2KRE A;  2VPG A;  3LQH A;  3MHS A;  2Y43 A;  1RMD A;  2YHO A;  1WEE A;  2ECV A;  3O33 A;  5TDR A;  1MM2 A;  4BHW A;  4B86 C;  3IHP A;  1JOC A;  5KH7 A;  3M99 A;  3GV4 A;  2I50 A;  2KIZ A;  4L58 A;  2L5U A;  3SOU A;  2H0D A;  1VFY A;  2KWJ A;  2VJF B;  4AUQ B;  2M3H A;  4YBS A;  4N4F A;  2LGG A;  3LQJ A;  1WEN A;  2VPE A;  5D1K B;  5C13 A;  4YAB A;  4BBQ A;  1WEQ A;  3N9P A;  2CSZ A;  2RSD A;  2PNX A;  5TAB A;  3C6W A;  3RPG B;  2RI7 A;  4A0C D;  1WEM A;  2M1R A;  2LV9 A;  3RPG C;  4CA1 A;  1VD4 A;  4GNE A;  3FL2 A;  2L80 A;  2L75 A;  2LDR A;  3N9M A;  2UZG A;  2D8S A;  3O7A A;  1WGM A;  2ECW A;  2NAA A;  5G04 B;  5DIN A;  4WZ2 A;  5H1U A;  4A4B A;  5B75 A;  4FK5 A;  1X4U A;  3KQI A;  2ECT A;  2M6M A;  4QF2 A;  2ECG A;  3T6R A;  4B7Y C;  2CT2 A;  3HCS A;  3U5N A;  4S3O B;  3DQV R;  2MD8 C;  4YAD A;  2HDP A;  1CHC A;  2MNY A;  5B77 A;  4S3O C;  4LAD B;  2YW8 A;  4UI9 B;  1JM7 B;  2KYU A;  1MM3 A;  2KU3 A;  1ZBD B;  3KV5 A;  2IDA A;  1Z6U A;  5TBN A;  2H0D B;  3ASL A;  5G0F A;  5J3X A;  2YHN A;  2FUU A;  4GND A;  3L1Z B;  4WZ3 B;  4XI1 A;  4YAT A;  2EA6 A;  2XEU A;  5AIT A;  1WFK A;  4NN2 A;  2KFT A;  4ZQL A;  3SOX A;  1XWH A;  5B76 A;  2OXQ C;  3RTR B;  2F6J A;  2HYE D;  2G45 A;  2YU4 A;  4AYC A;  3O37 A;  2CKL B;  2LN0 A;  4GB0 A;  2G6Q A;  1WE9 A;  2ECJ A;  2KE1 A;  4LJN A;  4UP0 A;  5D1L B;  3M63 A;  3SOW A;  4MVT A;  2KGI A;  2LGV A;  3L1X A;  2LQ6 A;  2EOD A;  3O34 A;  2FSA A;  2YUR A;  1F62 A;  3ZTG A;  4FO9 A;  5C11 A;  5KH3 A;  2MIQ A;  1V87 A;  2F42 A;  5AIU A;  5DKA A;  3L11 A;  4V3L C;  2KWN A;  4R7E A;  3KV6 A;  4V3K C;  2KGG A;  3U5M A;  2MA6 A;  4FIP A;  2KWO A;  4WA6 A;  2MNZ A;  2L43 A;  2VPD A;  3KNV A;  3VK6 A;  5FER A;  5LKX A;  3HCU A;  5KH9 A;  2QJ0 A;  2YSM A;  5EYA F;  1HYI A;  2PUY A;  2L0B A;  5H1V A;  2E6R A;  3HCT A;  2YQL A;  5H9M A;  2VJF A;  4PPE A;  2LGL A;  2F6N A;  5D1M B;  4GNG A;  3QZV A;  2E6S A;  5LKU A;  5LKT A;  2BAY A;  2LGK A;  2DX8 A;  4R2Y A;  4FJC A;  3U5O A;  2EGP A;  4AVX A;  1LDJ B;  2YSJ A;  5B78 A;  4QF3 A;  3ZPV 1;  4PTB A;  4YC9 A;  4L7X A;  1FP0 A;  4AYC B;  3ZNI A;  3I2D A;  3U5P A;  4W4U A;  1WIL A;  3LQI A;  3V43 A;  4F52 B;  5FB0 A;  1IYM A;  2QIZ A;  2LRI C;  2VNF A;  3ZYQ A;  2XB1 A;  2YYR A;  1WEV A;  1Z2Q A;  4A4C A;  4ZUX U;  2Y1M A;  4LKA A;  2JRJ A;  4Q6F A;  2QIC A;  4UP5 A;  2ZET C;  5FEY A;  3PHD A;  2KWK A;  3ZPV E;  2VJE A;  4IC3 A;  5FB1 A;  2YT5 A;  4N3W A;  1HYJ A;  1WES A;  1BOR A;  4CCG X;  1G25 A;  2YRE A;  2YQM A;  3LRQ A;  1JM7 A;  4O64 A;  1X4I A;  2VPB A;  1WEO A;  2CSY A;  3O35 A;  5G05 B;  4I7B A;  4X3G A;  3M62 A;  2ECI A;  2M85 A;  2K1J A;  4LK9 A;  4I7C A;  3GL6 A;  3N9O A;  1WEW A;  4YAX A;  1T1H A;  5JG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...