3Q1DA

The b-box domain of trim54
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
QHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tripartite motif-containing protein 54
publication title The B-Box Domain of Trim54
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 6.3.2.-:
pdb deposition date 2010-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3q1dA00
2CSVA 2DJAA 2EGMA 2D8UA 3DDTA 2JUNA 3Q1DA 5K3QA 2YVRA
chains in the Genus database with same CATH superfamily
2VPDA 2ECWA 2LGLA 4YAXA 2LQ6A 3N9PA 5KH7A 4L58A 1T1HA 4I7CA 2XB1A 2YVRA 1LDKC 2YSJA 4WZ3B 3KV6A 5AIUA 3ZYQA 1MBMA 3LQJA 2DJAA 3C6WA 2EA6A 1FP0A 4BHWA 4OGCA 2BAYA 4LLBA 1WEUA 4YATA 4X3GA 4IC3A 3PUQA 2RI7A 3O35A 4WA6A 1HYJA 4PTBA 3M7KA 3T6RA 4L7XA 3T7LA 4N3WA 4N4FA 3RTRB 3ZVYA 2YSMA 3LQHA 2XOZA 4FO9A 2LN0A 4PPEA 5D1MB 4QF3A 4FJCA 1WEEA 2FSAA 1JM7A 2KR4A 3HCSA 1VFYA 2KIZA 2MIQA 5FB0A 2F6NA 2QIZA 2QJ0A 3JUEA 2M1RA 2KWNA 5TDWA 4YBMA 2YUCA 2KU3A 1WE9A 3HCTA 2L5UA 4UP5A 3FM8C 2EGMA 1MM2A 2YREA 3PURA 4W4UA 5TRBA 5FERA 2ZETC 2KKYA 4WZ0A 5DINA 2F6JA 4CCGX 4QF2A 2AN6A 2KWOA 2M13A 1WILA 1WEQA 4A0CD 2DSMA 2K17A 1JOCA 2K4DA 5G04B 2G6QA 4P5OB 2NAAA 3GL6A 3KNVA 2JUNA 4F1PA 3LVRE 1K2FA 4F52B 3MHSA 3KDEC 2PNXA 5C11A 2VP7A 2F42A 4CA1A 5EYAF 2KFTA 2YURA 2ECTA 3GV4A 2KWJA 3O7AA 4LJNA 2ECNA 2VJEA 1Z6UA 5B76A 4IC2A 4MSXA 3N9MA 4NN2A 4LADB 4ZUXU 2E6RA 3FEHA 2MUMA 3PHDA 1HYIA 2DX8A 3M99A 4I7BA 1WENA 2MD7B 1DCQA 2XP0A 3IHPA 2FD4A 2G45A 5B77A 2LDRA 4Z0RA 3L11A 2CRWA 3DQVR 1WESA 5LKUA 2ECVA 4XI1A 3L1XA 4GB0A 2KGGA 5SVYA 5AITA 3C5KA 5FEYA 3ASLA 2JM3A 3O37A 1XWHA 2RR4A 4UI9B 3LVQE 2M3HA 4WZ2A 3NG2A 4Z0OA 2RSDA 2C2LA 1V87A 2VNFA 5SVIB 1X4UA 2FUIA 2L7PA 2I50A 3MHHA 2H0DB 4LKAA 2L0BA 4YADA 1VD4A 3KQIA 3O34A 3I2DA 5H9MA 2YW8A 3N9NA 3V43A 3M63A 4YBTA 2MNYA 3VK6A 2OXQC 4ZQLA 2YHOA 3O36A 3HTKC 5J3XA 3SOUA 3SOXA 1WEWA 1RMDA 2LXHC 4A4CA 2VPBA 1CHCA 3U5NA 3PLWA 3DWDA 2M85A 3EB6A 2LGVA 4LK9A 4QQ4A 4AP4A 2CKLB 3RPGC 2CSVA 2HDPA 4H9DA 1F62A 2YQLA 2CRRA 2JMJA 2JMIA 4YBSA 3MDBC 4AYCB 2EGPA 2CSYA 2ECGA 5K3QA 3N9QA 2FUUA 4FK5A 3LQIA 3T9KA 3DDTA 3E2DA 4ZDTA 2CT2A 1VYXA 4GNDA 2CONA 2G43A 2JRJA 4O64A 3HCUA 1WEVA 4MVTA 3ZPVE 2MA5A 4S3OC 3SUBA 2LGGA 2C2VS 2MA6A 3O33A 3N9OA 5KH9A 4B7YC 3FAOA 5KH3A 2Y1MA 1FBVA 2L80A 2VJFB 4TKPB 5H1VA 4GNGA 4YC9A 2KE1A 2L75A 2YU4A 4V3LC 2YYRA 5C13A 2K1JA 3N9LA 3O47A 2ECJA 3FANA 3M62A 5H1UA 2XEUA 2LGKA 5JG6A 5I3LA 4O62A 3DPLR 4R2YA 3ZVZB 5TABA 4BBQA 2XOCA 2MT5A 5H1TA 2FFWA 2HYED 5SVIA 2XOYA 2MD8C 3FL2A 3LRQA 2EXUA 2H0DA 1WIMA 2LAUA 2KREA 1WEPA 2YT5A 2MNZA 5LKTA 2L43A 3O70A 4R8PK 4Q6FA 1WEOA 2EODA 5B78A 3FJUB 3SOWA 2KKXA 2VPGA 1Z2QA 2OWAA 3RPGB 4B86C 4GNFA 1WGMA 4GNEA 2UZGA 1X4JA 5SVXA 1WEMA 2D8SA 5B8DA 1N87A 2P57A 3H7HA 1JM7B 2PUYA 5B79A 3Q1DA 3LJUX 2M6MA 3U5MA 2JMDA 3QZVA 3LDYA 2CKLA 5TDRA 4UP0A 5LKXA 2CSZA 2LXPC 1G25A 4A49A 2YHNA 2QICA 4S3OB 4V3KC 4AYCA 2Y1NA 3EB5A 5LKZA 2LV9A 4OGEA 1X4IA 2D8UA 2MKEA 1BORA 4AUQB 1DVPA 3U5OA 4C9ZA 2Y43A 2IDAA 3KV5A 4I7DA 4AVXA 2B0OE 2KYUA 1U6GB 2E6SA 2K16A 2VPEA 1MM3A 5G0FA 1IYMA 3ZNIA 2VJFA 2ECIA 5TBNA 3ZPV1 1Z60A 2LRIC 5FB1A 2E61A 2YQMA 4YABA 4A4BA 3L1ZB 5LCWB 5G05B 5D1KB 1LDJB 2IQJA 3ZTGA 3SHBA 2KWKA 2VJEB 4R7EA 2KGIA 1WFKA 3U5PA 5DKAA 5B75A 5D1LB 4FIPA 1E4UA 1ZBDB
chains in the Genus database with same CATH topology
2KKYA 2P57A 4OGEA 3T9KA 3H7HA 2MKEA 2D8UA 2E61A 2JM3A 2XOCA 3DDTA 3DWDA 3E2DA 3PLWA 3Q1DA 2RR4A 4QQ4A 2M13A 1DCQA 3LJUX 3LVQE 2XP0A 3JUEA 2CONA 4Z0OA 3KDEC 2FFWA 2FD4A 3M7KA 3FJUB 3LDYA 2YVRA 3SUBA 2CSVA 4H9DA 5SVIA 3O47A 2IQJA 5SVIB 2L7PA 4Z0RA 2KKXA 2XOYA 2CRWA 2OWAA 2CRRA 2JUNA 2B0OE 2EXUA 2XOZA 4O62A 4F1PA 3FM8C 2DJAA 3LVRE 3MDBC 2EGMA 4OGCA 2LAUA 2YREA 5SVXA 5SVYA 3FEHA 5K3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSV A;  2DJA A;  2EGM A;  2D8U A;  3DDT A;  2JUN A;  3Q1D A;  5K3Q A;  2YVR A; 
#chains in the Genus database with same CATH topology
 2VPD A;  2ECW A;  2LGL A;  4YAX A;  2LQ6 A;  3N9P A;  5KH7 A;  4L58 A;  1T1H A;  4I7C A;  2XB1 A;  2YVR A;  1LDK C;  2YSJ A;  4WZ3 B;  3KV6 A;  5AIU A;  3ZYQ A;  1MBM A;  3LQJ A;  2DJA A;  3C6W A;  2EA6 A;  1FP0 A;  4BHW A;  4OGC A;  2BAY A;  4LLB A;  1WEU A;  4YAT A;  4X3G A;  4IC3 A;  3PUQ A;  2RI7 A;  3O35 A;  4WA6 A;  1HYJ A;  4PTB A;  3M7K A;  3T6R A;  4L7X A;  3T7L A;  4N3W A;  4N4F A;  3RTR B;  3ZVY A;  2YSM A;  3LQH A;  2XOZ A;  4FO9 A;  2LN0 A;  4PPE A;  5D1M B;  4QF3 A;  4FJC A;  1WEE A;  2FSA A;  1JM7 A;  2KR4 A;  3HCS A;  1VFY A;  2KIZ A;  2MIQ A;  5FB0 A;  2F6N A;  2QIZ A;  2QJ0 A;  3JUE A;  2M1R A;  2KWN A;  5TDW A;  4YBM A;  2YUC A;  2KU3 A;  1WE9 A;  3HCT A;  2L5U A;  4UP5 A;  3FM8 C;  2EGM A;  1MM2 A;  2YRE A;  3PUR A;  4W4U A;  5TRB A;  5FER A;  2ZET C;  2KKY A;  4WZ0 A;  5DIN A;  2F6J A;  4CCG X;  4QF2 A;  2AN6 A;  2KWO A;  2M13 A;  1WIL A;  1WEQ A;  4A0C D;  2DSM A;  2K17 A;  1JOC A;  2K4D A;  5G04 B;  2G6Q A;  4P5O B;  2NAA A;  3GL6 A;  3KNV A;  2JUN A;  4F1P A;  3LVR E;  1K2F A;  4F52 B;  3MHS A;  3KDE C;  2PNX A;  5C11 A;  2VP7 A;  2F42 A;  4CA1 A;  5EYA F;  2KFT A;  2YUR A;  2ECT A;  3GV4 A;  2KWJ A;  3O7A A;  4LJN A;  2ECN A;  2VJE A;  1Z6U A;  5B76 A;  4IC2 A;  4MSX A;  3N9M A;  4NN2 A;  4LAD B;  4ZUX U;  2E6R A;  3FEH A;  2MUM A;  3PHD A;  1HYI A;  2DX8 A;  3M99 A;  4I7B A;  1WEN A;  2MD7 B;  1DCQ A;  2XP0 A;  3IHP A;  2FD4 A;  2G45 A;  5B77 A;  2LDR A;  4Z0R A;  3L11 A;  2CRW A;  3DQV R;  1WES A;  5LKU A;  2ECV A;  4XI1 A;  3L1X A;  4GB0 A;  2KGG A;  5SVY A;  5AIT A;  3C5K A;  5FEY A;  3ASL A;  2JM3 A;  3O37 A;  1XWH A;  2RR4 A;  4UI9 B;  3LVQ E;  2M3H A;  4WZ2 A;  3NG2 A;  4Z0O A;  2RSD A;  2C2L A;  1V87 A;  2VNF A;  5SVI B;  1X4U A;  2FUI A;  2L7P A;  2I50 A;  3MHH A;  2H0D B;  4LKA A;  2L0B A;  4YAD A;  1VD4 A;  3KQI A;  3O34 A;  3I2D A;  5H9M A;  2YW8 A;  3N9N A;  3V43 A;  3M63 A;  4YBT A;  2MNY A;  3VK6 A;  2OXQ C;  4ZQL A;  2YHO A;  3O36 A;  3HTK C;  5J3X A;  3SOU A;  3SOX A;  1WEW A;  1RMD A;  2LXH C;  4A4C A;  2VPB A;  1CHC A;  3U5N A;  3PLW A;  3DWD A;  2M85 A;  3EB6 A;  2LGV A;  4LK9 A;  4QQ4 A;  4AP4 A;  2CKL B;  3RPG C;  2CSV A;  2HDP A;  4H9D A;  1F62 A;  2YQL A;  2CRR A;  2JMJ A;  2JMI A;  4YBS A;  3MDB C;  4AYC B;  2EGP A;  2CSY A;  2ECG A;  5K3Q A;  3N9Q A;  2FUU A;  4FK5 A;  3LQI A;  3T9K A;  3DDT A;  3E2D A;  4ZDT A;  2CT2 A;  1VYX A;  4GND A;  2CON A;  2G43 A;  2JRJ A;  4O64 A;  3HCU A;  1WEV A;  4MVT A;  3ZPV E;  2MA5 A;  4S3O C;  3SUB A;  2LGG A;  2C2V S;  2MA6 A;  3O33 A;  3N9O A;  5KH9 A;  4B7Y C;  3FAO A;  5KH3 A;  2Y1M A;  1FBV A;  2L80 A;  2VJF B;  4TKP B;  5H1V A;  4GNG A;  4YC9 A;  2KE1 A;  2L75 A;  2YU4 A;  4V3L C;  2YYR A;  5C13 A;  2K1J A;  3N9L A;  3O47 A;  2ECJ A;  3FAN A;  3M62 A;  5H1U A;  2XEU A;  2LGK A;  5JG6 A;  5I3L A;  4O62 A;  3DPL R;  4R2Y A;  3ZVZ B;  5TAB A;  4BBQ A;  2XOC A;  2MT5 A;  5H1T A;  2FFW A;  2HYE D;  5SVI A;  2XOY A;  2MD8 C;  3FL2 A;  3LRQ A;  2EXU A;  2H0D A;  1WIM A;  2LAU A;  2KRE A;  1WEP A;  2YT5 A;  2MNZ A;  5LKT A;  2L43 A;  3O70 A;  4R8P K;  4Q6F A;  1WEO A;  2EOD A;  5B78 A;  3FJU B;  3SOW A;  2KKX A;  2VPG A;  1Z2Q A;  2OWA A;  3RPG B;  4B86 C;  4GNF A;  1WGM A;  4GNE A;  2UZG A;  1X4J A;  5SVX A;  1WEM A;  2D8S A;  5B8D A;  1N87 A;  2P57 A;  3H7H A;  1JM7 B;  2PUY A;  5B79 A;  3Q1D A;  3LJU X;  2M6M A;  3U5M A;  2JMD A;  3QZV A;  3LDY A;  2CKL A;  5TDR A;  4UP0 A;  5LKX A;  2CSZ A;  2LXP C;  1G25 A;  4A49 A;  2YHN A;  2QIC A;  4S3O B;  4V3K C;  4AYC A;  2Y1N A;  3EB5 A;  5LKZ A;  2LV9 A;  4OGE A;  1X4I A;  2D8U A;  2MKE A;  1BOR A;  4AUQ B;  1DVP A;  3U5O A;  4C9Z A;  2Y43 A;  2IDA A;  3KV5 A;  4I7D A;  4AVX A;  2B0O E;  2KYU A;  1U6G B;  2E6S A;  2K16 A;  2VPE A;  1MM3 A;  5G0F A;  1IYM A;  3ZNI A;  2VJF A;  2ECI A;  5TBN A;  3ZPV 1;  1Z60 A;  2LRI C;  5FB1 A;  2E61 A;  2YQM A;  4YAB A;  4A4B A;  3L1Z B;  5LCW B;  5G05 B;  5D1K B;  1LDJ B;  2IQJ A;  3ZTG A;  3SHB A;  2KWK A;  2VJE B;  4R7E A;  2KGI A;  1WFK A;  3U5P A;  5DKA A;  5B75 A;  5D1L B;  4FIP A;  1E4U A;  1ZBD B; 
#chains in the Genus database with same CATH homology
 2KKY A;  2P57 A;  4OGE A;  3T9K A;  3H7H A;  2MKE A;  2D8U A;  2E61 A;  2JM3 A;  2XOC A;  3DDT A;  3DWD A;  3E2D A;  3PLW A;  3Q1D A;  2RR4 A;  4QQ4 A;  2M13 A;  1DCQ A;  3LJU X;  3LVQ E;  2XP0 A;  3JUE A;  2CON A;  4Z0O A;  3KDE C;  2FFW A;  2FD4 A;  3M7K A;  3FJU B;  3LDY A;  2YVR A;  3SUB A;  2CSV A;  4H9D A;  5SVI A;  3O47 A;  2IQJ A;  5SVI B;  2L7P A;  4Z0R A;  2KKX A;  2XOY A;  2CRW A;  2OWA A;  2CRR A;  2JUN A;  2B0O E;  2EXU A;  2XOZ A;  4O62 A;  4F1P A;  3FM8 C;  2DJA A;  3LVR E;  3MDB C;  2EGM A;  4OGC A;  2LAU A;  2YRE A;  5SVX A;  5SVY A;  3FEH A;  5K3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...