4QQ4A

Cw-type zinc finger of morc3 in complex with the amino terminus of histone h3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
48
structure length
48
Chain Sequence
PDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MORC family CW-type zinc finger protein 3
publication title Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 8
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4qq4A00
2RR4A 4O62A 5SVXA 2E61A 4Z0OA 4QQ4A 5SVIA 5SVYA 4Z0RA 5SVIB 2L7PA
chains in the Genus database with same CATH superfamily
3V43A 4ZUXU 1F62A 1WEMA 3DQVR 1WIMA 5FERA 2VP7A 4F52B 3ZVZB 5C13A 2MNZA 5I3LA 3N9PA 4GNEA 2PUYA 2FFWA 3HCSA 5B78A 4FJCA 2HDPA 2KWOA 4L58A 1MBMA 2MA6A 2L0BA 2XP0A 2F42A 2KE1A 3ZNIA 3ZYQA 2G45A 4YBTA 4I7BA 4GNGA 2QJ0A 2KU3A 4YADA 3DDTA 4AYCB 5B76A 2VPGA 4WZ2A 4LK9A 1DVPA 2YSJA 2Y1NA 5EYAF 2M3HA 1WEWA 1WEVA 3LVQE 3LVRE 4F1PA 5DINA 2FUUA 2IQJA 3RTRB 2VJEA 2RSDA 1WILA 2E6RA 4GB0A 1T1HA 2LQ6A 3KNVA 1G25A 3PHDA 1WFKA 2ECVA 4QF2A 3ASLA 5B79A 1RMDA 5SVIA 4A4BA 3LQJA 2L75A 2M1RA 2LGLA 1X4JA 3SOWA 3KV5A 2FD4A 1E4UA 1JM7A 4MVTA 2CRRA 4FIPA 5TBNA 4Z0RA 2JM3A 4S3OC 2YW8A 1WESA 2MUMA 1VYXA 5LCWB 2QICA 3L1ZB 4OGCA 2KGIA 2JMIA 1Z6UA 3RPGB 2ECIA 2XOZA 5TRBA 3O37A 4OGEA 2BAYA 4N3WA 2JMDA 4BHWA 1CHCA 2CSYA 5G0FA 2MD8C 2P57A 3O36A 2L7PA 2OWAA 1WEEA 2YURA 1X4IA 3T6RA 3ZTGA 3FEHA 3T9KA 2EGPA 5KH9A 2JMJA 4UP5A 1V87A 2Y43A 5AIUA 4GNFA 1WEPA 2YT5A 3LQHA 2LRIC 2MIQA 4N4FA 5C11A 4LADB 2EGMA 2AN6A 2LXHC 4IC3A 3C5KA 2KWKA 2K17A 4PTBA 2VJEB 3C6WA 3Q1DA 2E6SA 5H1TA 2ECTA 1XWHA 2YQLA 1LDKC 2YUCA 5H1UA 4UP0A 5SVIB 4AVXA 1HYIA 3M63A 3DWDA 2KGGA 3T7LA 3SOUA 3N9LA 2LXPC 4LLBA 1JOCA 4Q6FA 4ZDTA 1JM7B 2DSMA 5SVYA 2YU4A 3LDYA 4YBSA 1N87A 2KWJA 4A0CD 3E2DA 3LJUX 2VPEA 2KYUA 2C2VS 4O62A 5H9MA 5SVXA 2L80A 4YAXA 4I7DA 2MKEA 2L5UA 5D1MB 2MT5A 1MM3A 2M6MA 3PLWA 2CSVA 2I50A 2YREA 3N9QA 2JUNA 4YBMA 1U6GB 2ECJA 5TABA 2EODA 2XEUA 4LJNA 3HCUA 3FL2A 2FUIA 2DJAA 2VNFA 4TKPB 1Z2QA 2LDRA 1WGMA 2RI7A 2ECWA 3ZPVE 3SUBA 2KKYA 5KH7A 3L11A 4AP4A 2LGKA 2MA5A 3ZVYA 2CONA 2H0DA 4V3KC 2L43A 5LKXA 4B86C 2VPBA 1WEQA 2MNYA 3KV6A 3SOXA 2UZGA 5G04B 4MSXA 2LGVA 4C9ZA 4NN2A 4FO9A 5TDRA 3SHBA 3KDEC 2KWNA 2CRWA 2DX8A 1WE9A 4FK5A 3O7AA 2K4DA 2LV9A 3U5PA 1FP0A 3HTKC 4B7YC 2CT2A 2D8SA 3ZPV1 5KH3A 2C2LA 3O33A 4GNDA 2VJFA 3M99A 3N9NA 1X4UA 5JG6A 3QZVA 4QQ4A 1Z60A 3EB5A 2KKXA 2XB1A 2IDAA 2YVRA 2NAAA 2KREA 4WA6A 5D1KB 2F6NA 1K2FA 3O35A 4WZ0A 1VD4A 4R7EA 5H1VA 3N9OA 5LKZA 2FSAA 2YHOA 2CKLB 3IHPA 3L1XA 1WEUA 3HCTA 5FEYA 1BORA 3RPGC 2G6QA 5D1LB 3GV4A 4I7CA 5K3QA 2ECGA 3O70A 4AUQB 2B0OE 2LN0A 3U5NA 1LDJB 3PUQA 2H0DB 3LRQA 4W4UA 2M85A 3EB6A 3KQIA 1FBVA 2YSMA 3O47A 2YHNA 3PURA 2CSZA 3FANA 5FB0A 2D8UA 2KFTA 3MHHA 4Z0OA 4S3OB 2Y1MA 3FAOA 4R2YA 2KR4A 5FB1A 4YATA 3LQIA 2VPDA 2HYED 4XI1A 4YABA 2YYRA 3I2DA 4BBQA 2XOCA 3M7KA 2CKLA 3N9MA 4UI9B 1DCQA 3MDBC 2VJFB 1ZBDB 1IYMA 4LKAA 5TDWA 2LAUA 3GL6A 4WZ3B 2LGGA 5B75A 2OXQC 2ZETC 2YQMA 3O34A 2MD7B 2F6JA 5B77A 3U5MA 3FJUB 4ZQLA 4H9DA 2E61A 2K1JA 4CCGX 4A49A 3M62A 1MM2A 2QIZA 1VFYA 2G43A 5DKAA 1WENA 1HYJA 4X3GA 4YC9A 3H7HA 4AYCA 2EA6A 5J3XA 2ECNA 4QF3A 3FM8C 4CA1A 5AITA 4R8PK 3VK6A 5LKUA 2XOYA 3DPLR 4IC2A 2PNXA 4V3LC 2RR4A 3JUEA 2JRJA 5LKTA 2K16A 1WEOA 5G05B 4A4CA 3U5OA 2EXUA 3NG2A 4PPEA 2KIZA 5B8DA 4O64A 4P5OB 3MHSA 2M13A 4L7XA
chains in the Genus database with same CATH topology
2RR4A 4O62A 5SVXA 2D8UA 3JUEA 3KDEC 3DWDA 4Z0OA 2FD4A 2MKEA 5K3QA 2CRWA 2P57A 2LAUA 2YVRA 3LVQE 3LVRE 2KKYA 3SUBA 4F1PA 2L7PA 2OWAA 2XP0A 2EXUA 3PLWA 2IQJA 2B0OE 2CSVA 2CRRA 2EGMA 2YREA 2CONA 5SVYA 4Z0RA 2JM3A 2M13A 2JUNA 3FJUB 3LDYA 3Q1DA 4H9DA 2XOCA 3H7HA 4OGCA 3M7KA 3DDTA 2FFWA 3FEHA 2DJAA 3T9KA 3FM8C 1DCQA 3MDBC 2E61A 3O47A 3E2DA 2XOYA 2XOZA 4QQ4A 5SVIA 3LJUX 5SVIB 4OGEA 2KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR4 A;  4O62 A;  5SVX A;  2E61 A;  4Z0O A;  4QQ4 A;  5SVI A;  5SVY A;  4Z0R A;  5SVI B;  2L7P A; 
#chains in the Genus database with same CATH topology
 3V43 A;  4ZUX U;  1F62 A;  1WEM A;  3DQV R;  1WIM A;  5FER A;  2VP7 A;  4F52 B;  3ZVZ B;  5C13 A;  2MNZ A;  5I3L A;  3N9P A;  4GNE A;  2PUY A;  2FFW A;  3HCS A;  5B78 A;  4FJC A;  2HDP A;  2KWO A;  4L58 A;  1MBM A;  2MA6 A;  2L0B A;  2XP0 A;  2F42 A;  2KE1 A;  3ZNI A;  3ZYQ A;  2G45 A;  4YBT A;  4I7B A;  4GNG A;  2QJ0 A;  2KU3 A;  4YAD A;  3DDT A;  4AYC B;  5B76 A;  2VPG A;  4WZ2 A;  4LK9 A;  1DVP A;  2YSJ A;  2Y1N A;  5EYA F;  2M3H A;  1WEW A;  1WEV A;  3LVQ E;  3LVR E;  4F1P A;  5DIN A;  2FUU A;  2IQJ A;  3RTR B;  2VJE A;  2RSD A;  1WIL A;  2E6R A;  4GB0 A;  1T1H A;  2LQ6 A;  3KNV A;  1G25 A;  3PHD A;  1WFK A;  2ECV A;  4QF2 A;  3ASL A;  5B79 A;  1RMD A;  5SVI A;  4A4B A;  3LQJ A;  2L75 A;  2M1R A;  2LGL A;  1X4J A;  3SOW A;  3KV5 A;  2FD4 A;  1E4U A;  1JM7 A;  4MVT A;  2CRR A;  4FIP A;  5TBN A;  4Z0R A;  2JM3 A;  4S3O C;  2YW8 A;  1WES A;  2MUM A;  1VYX A;  5LCW B;  2QIC A;  3L1Z B;  4OGC A;  2KGI A;  2JMI A;  1Z6U A;  3RPG B;  2ECI A;  2XOZ A;  5TRB A;  3O37 A;  4OGE A;  2BAY A;  4N3W A;  2JMD A;  4BHW A;  1CHC A;  2CSY A;  5G0F A;  2MD8 C;  2P57 A;  3O36 A;  2L7P A;  2OWA A;  1WEE A;  2YUR A;  1X4I A;  3T6R A;  3ZTG A;  3FEH A;  3T9K A;  2EGP A;  5KH9 A;  2JMJ A;  4UP5 A;  1V87 A;  2Y43 A;  5AIU A;  4GNF A;  1WEP A;  2YT5 A;  3LQH A;  2LRI C;  2MIQ A;  4N4F A;  5C11 A;  4LAD B;  2EGM A;  2AN6 A;  2LXH C;  4IC3 A;  3C5K A;  2KWK A;  2K17 A;  4PTB A;  2VJE B;  3C6W A;  3Q1D A;  2E6S A;  5H1T A;  2ECT A;  1XWH A;  2YQL A;  1LDK C;  2YUC A;  5H1U A;  4UP0 A;  5SVI B;  4AVX A;  1HYI A;  3M63 A;  3DWD A;  2KGG A;  3T7L A;  3SOU A;  3N9L A;  2LXP C;  4LLB A;  1JOC A;  4Q6F A;  4ZDT A;  1JM7 B;  2DSM A;  5SVY A;  2YU4 A;  3LDY A;  4YBS A;  1N87 A;  2KWJ A;  4A0C D;  3E2D A;  3LJU X;  2VPE A;  2KYU A;  2C2V S;  4O62 A;  5H9M A;  5SVX A;  2L80 A;  4YAX A;  4I7D A;  2MKE A;  2L5U A;  5D1M B;  2MT5 A;  1MM3 A;  2M6M A;  3PLW A;  2CSV A;  2I50 A;  2YRE A;  3N9Q A;  2JUN A;  4YBM A;  1U6G B;  2ECJ A;  5TAB A;  2EOD A;  2XEU A;  4LJN A;  3HCU A;  3FL2 A;  2FUI A;  2DJA A;  2VNF A;  4TKP B;  1Z2Q A;  2LDR A;  1WGM A;  2RI7 A;  2ECW A;  3ZPV E;  3SUB A;  2KKY A;  5KH7 A;  3L11 A;  4AP4 A;  2LGK A;  2MA5 A;  3ZVY A;  2CON A;  2H0D A;  4V3K C;  2L43 A;  5LKX A;  4B86 C;  2VPB A;  1WEQ A;  2MNY A;  3KV6 A;  3SOX A;  2UZG A;  5G04 B;  4MSX A;  2LGV A;  4C9Z A;  4NN2 A;  4FO9 A;  5TDR A;  3SHB A;  3KDE C;  2KWN A;  2CRW A;  2DX8 A;  1WE9 A;  4FK5 A;  3O7A A;  2K4D A;  2LV9 A;  3U5P A;  1FP0 A;  3HTK C;  4B7Y C;  2CT2 A;  2D8S A;  3ZPV 1;  5KH3 A;  2C2L A;  3O33 A;  4GND A;  2VJF A;  3M99 A;  3N9N A;  1X4U A;  5JG6 A;  3QZV A;  4QQ4 A;  1Z60 A;  3EB5 A;  2KKX A;  2XB1 A;  2IDA A;  2YVR A;  2NAA A;  2KRE A;  4WA6 A;  5D1K B;  2F6N A;  1K2F A;  3O35 A;  4WZ0 A;  1VD4 A;  4R7E A;  5H1V A;  3N9O A;  5LKZ A;  2FSA A;  2YHO A;  2CKL B;  3IHP A;  3L1X A;  1WEU A;  3HCT A;  5FEY A;  1BOR A;  3RPG C;  2G6Q A;  5D1L B;  3GV4 A;  4I7C A;  5K3Q A;  2ECG A;  3O70 A;  4AUQ B;  2B0O E;  2LN0 A;  3U5N A;  1LDJ B;  3PUQ A;  2H0D B;  3LRQ A;  4W4U A;  2M85 A;  3EB6 A;  3KQI A;  1FBV A;  2YSM A;  3O47 A;  2YHN A;  3PUR A;  2CSZ A;  3FAN A;  5FB0 A;  2D8U A;  2KFT A;  3MHH A;  4Z0O A;  4S3O B;  2Y1M A;  3FAO A;  4R2Y A;  2KR4 A;  5FB1 A;  4YAT A;  3LQI A;  2VPD A;  2HYE D;  4XI1 A;  4YAB A;  2YYR A;  3I2D A;  4BBQ A;  2XOC A;  3M7K A;  2CKL A;  3N9M A;  4UI9 B;  1DCQ A;  3MDB C;  2VJF B;  1ZBD B;  1IYM A;  4LKA A;  5TDW A;  2LAU A;  3GL6 A;  4WZ3 B;  2LGG A;  5B75 A;  2OXQ C;  2ZET C;  2YQM A;  3O34 A;  2MD7 B;  2F6J A;  5B77 A;  3U5M A;  3FJU B;  4ZQL A;  4H9D A;  2E61 A;  2K1J A;  4CCG X;  4A49 A;  3M62 A;  1MM2 A;  2QIZ A;  1VFY A;  2G43 A;  5DKA A;  1WEN A;  1HYJ A;  4X3G A;  4YC9 A;  3H7H A;  4AYC A;  2EA6 A;  5J3X A;  2ECN A;  4QF3 A;  3FM8 C;  4CA1 A;  5AIT A;  4R8P K;  3VK6 A;  5LKU A;  2XOY A;  3DPL R;  4IC2 A;  2PNX A;  4V3L C;  2RR4 A;  3JUE A;  2JRJ A;  5LKT A;  2K16 A;  1WEO A;  5G05 B;  4A4C A;  3U5O A;  2EXU A;  3NG2 A;  4PPE A;  2KIZ A;  5B8D A;  4O64 A;  4P5O B;  3MHS A;  2M13 A;  4L7X A; 
#chains in the Genus database with same CATH homology
 2RR4 A;  4O62 A;  5SVX A;  2D8U A;  3JUE A;  3KDE C;  3DWD A;  4Z0O A;  2FD4 A;  2MKE A;  5K3Q A;  2CRW A;  2P57 A;  2LAU A;  2YVR A;  3LVQ E;  3LVR E;  2KKY A;  3SUB A;  4F1P A;  2L7P A;  2OWA A;  2XP0 A;  2EXU A;  3PLW A;  2IQJ A;  2B0O E;  2CSV A;  2CRR A;  2EGM A;  2YRE A;  2CON A;  5SVY A;  4Z0R A;  2JM3 A;  2M13 A;  2JUN A;  3FJU B;  3LDY A;  3Q1D A;  4H9D A;  2XOC A;  3H7H A;  4OGC A;  3M7K A;  3DDT A;  2FFW A;  3FEH A;  2DJA A;  3T9K A;  3FM8 C;  1DCQ A;  3MDB C;  2E61 A;  3O47 A;  3E2D A;  2XOY A;  2XOZ A;  4QQ4 A;  5SVI A;  3LJU X;  5SVI B;  4OGE A;  2KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...