4Q6FA

Crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
SVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4q6fA00
2RSDA 2G43A 2RI7A 2ECTA 3O36A 4GB0A 3ZNIA 2F6NA 4I7DA 1X4UA 5LKZA 2LGLA 2ECJA 1LDJB 1WE9A 2C2VS 4B86C 4Q6FA 3PUQA 2YW8A 4WZ0A 4S3OB 4A4CA 2KIZA 2EODA 5KH7A 1VFYA 4L58A 2CKLB 2YT5A 2CSYA 3N9PA 4R8PK 3KV6A 3QZVA 4W4UA 5J3XA 1WEQA 3O7AA 3PURA 5FERA 4CCGX 4I7BA 3M63A 1HYIA 3IHPA 4MVTA 3U5PA 2CSZA 3N9NA 2VP7A 5B76A 2MNZA 2YUCA 4ZUXU 2MT5A 3I2DA 5I3LA 2KR4A 5B77A 5B79A 5EYAF 4AVXA 3SOXA 1WEPA 2K16A 3ZYQA 2LRIC 4L7XA 4YATA 2D8SA 2ECVA 4UI9B 3N9OA 2LQ6A 3SOWA 3RTRB 1FP0A 2YSMA 5LCWB 2L5UA 3U5MA 1LDKC 4A0CD 2ECGA 2YU4A 2KWOA 3O34A 1DVPA 2PNXA 3LQJA 1WIMA 3HTKC 2VJFB 3GL6A 4WZ2A 4NN2A 4CA1A 3HCUA 2KU3A 2LGGA 3PHDA 4IC3A 1ZBDB 2F6JA 4QF3A 2MIQA 4PPEA 2LXHC 3L1XA 2ECIA 2KREA 4AP4A 2L80A 1Z2QA 5TDRA 4AYCA 2VJFA 4YC9A 3L11A 1WEVA 4WA6A 3DPLR 2YYRA 5C11A 3KV5A 3SOUA 5H1TA 4ZDTA 2G45A 3O35A 3ZVYA 3ASLA 2YQMA 3N9MA 3T6RA 2YURA 4LJNA 4YADA 1JOCA 2VNFA 4BBQA 2FUIA 1U6GB 4FK5A 2LGVA 5D1KB 1T1HA 2PUYA 3C5KA 1E4UA 2MA5A 4C9ZA 4R2YA 2XEUA 4LKAA 3MHHA 2KWNA 5B78A 4I7CA 3NG2A 1WFKA 4GNEA 2YHOA 2M1RA 1Z60A 2YSJA 1HYJA 4ZQLA 4YABA 2CKLA 2H0DB 5H9MA 3MHSA 5KH3A 1WEUA 3LQIA 1WILA 2MD8C 2LN0A 5AIUA 1MM3A 2UZGA 2JRJA 2L0BA 4TKPB 3ZVZB 4LADB 4A49A 1JM7B 3RPGC 5LKXA 2Y43A 4GNFA 2NAAA 4PTBA 2JMDA 5G0FA 3ZPV1 4BHWA 2HYED 4IC2A 5D1LB 2ECWA 2L43A 1G25A 5FB0A 1VD4A 2EGPA 1WENA 1WEOA 1BORA 5TABA 4WZ3B 2M85A 5FB1A 1JM7A 2VJEB 5H1UA 4O64A 2DX8A 2Y1MA 4N4FA 2FSAA 2LGKA 3GV4A 4GNGA 3V43A 3EB6A 3O70A 1K2FA 2YREA 1MM2A 4AUQB 2VPBA 2HDPA 2JMIA 3M62A 5LKTA 2MA6A 4MSXA 5G04B 3HCSA 2F42A 3VK6A 2KYUA 4UP5A 1FBVA 2JMJA 5B8DA 2MD7B 2KWJA 4XI1A 5DKAA 4S3OC 3KNVA 4N3WA 4FJCA 5TRBA 4FO9A 4R7EA 1RMDA 3C6WA 4UP0A 4X3GA 3T7LA 3M99A 2YHNA 4P5OB 5LKUA 5H1VA 4QF2A 2M3HA 2G6QA 2E6RA 1WEWA 5DINA 4V3KC 3O37A 2VPGA 2VPDA 4F52B 1F62A 4V3LC 3LQHA 2I50A 2KFTA 2QIZA 3N9QA 2ZETC 3ZTGA 4FIPA 2VPEA 4YBSA 3L1ZB 3U5OA 2ECNA 2KWKA 3KQIA 2BAYA 2EA6A 1WEEA 2KGGA 4LK9A 2K4DA 2LXPC 1VYXA 1IYMA 2CT2A 1WEMA 2L75A 2YQLA 5TBNA 2IDAA 5B75A 2KE1A 2M6MA 2KGIA 4YBMA 2H0DA 5FEYA 1N87A 5AITA 1V87A 2MUMA 3DQVR 5KH9A 3LRQA 1X4IA 2QJ0A 3O33A 5D1MB 2FUUA 3EB5A 5JG6A 2LDRA 1CHCA 3HCTA 3RPGB 3U5NA 4LLBA 4GNDA 1WGMA 5C13A 4AYCB 3SHBA 2K1JA 4YBTA 2OXQC 3FL2A 5TDWA 3N9LA 1XWHA 2MNYA 2C2LA 2E6SA 2XB1A 2VJEA 4YAXA 1Z6UA 2AN6A 3ZPVE 2K17A 2LV9A 4A4BA 2QICA 2Y1NA 1X4JA 1WESA 4B7YC 5G05B
chains in the Genus database with same CATH superfamily
2RSDA 2G43A 2RI7A 2ECTA 3O36A 4GB0A 3ZNIA 2F6NA 2E61A 4I7DA 1X4UA 5LKZA 2LGLA 2ECJA 1LDJB 1WE9A 2C2VS 4B86C 4Q6FA 3PUQA 2YW8A 4WZ0A 4S3OB 4A4CA 2KIZA 2EODA 2M13A 5KH7A 2LAUA 1VFYA 4L58A 2CKLB 2YT5A 2CSYA 3N9PA 4R8PK 3KV6A 3QZVA 4W4UA 5K3QA 5J3XA 1WEQA 3O7AA 3PURA 5FERA 4CCGX 4I7BA 3M63A 1HYIA 3IHPA 4MVTA 3U5PA 2CSZA 3N9NA 3LDYA 2VP7A 5SVIA 5B76A 2MNZA 2YUCA 4ZUXU 2MT5A 3I2DA 5I3LA 2KR4A 2RR4A 5B77A 5B79A 5EYAF 4AVXA 3SOXA 1WEPA 2K16A 3ZYQA 2LRIC 4L7XA 4YATA 2D8SA 2ECVA 4UI9B 3N9OA 2LQ6A 3SOWA 3RTRB 1FP0A 3H7HA 2YSMA 3DDTA 5LCWB 2L5UA 3U5MA 1LDKC 4A0CD 2ECGA 2YU4A 2KWOA 3O34A 3M7KA 1DVPA 2PNXA 3LQJA 1WIMA 3HTKC 2VJFB 3GL6A 4WZ2A 4NN2A 4CA1A 3HCUA 2KU3A 2LGGA 4F1PA 3PHDA 4IC3A 1ZBDB 2F6JA 4QF3A 3FAOA 2MIQA 4PPEA 2LXHC 4OGCA 3L1XA 2ECIA 3E2DA 2KREA 4AP4A 2L80A 1Z2QA 5TDRA 4OGEA 4AYCA 2VJFA 4YC9A 3L11A 1WEVA 4WA6A 3DPLR 2YYRA 5C11A 3KV5A 5SVXA 3SOUA 5H1TA 4ZDTA 2G45A 3O35A 3ZVYA 5SVYA 3ASLA 2YQMA 3N9MA 3T6RA 2D8UA 2YURA 4LJNA 4YADA 1JOCA 2VNFA 2JM3A 1MBMA 4BBQA 2FUIA 2XOZA 1U6GB 4FK5A 2LGVA 2IQJA 5D1KB 1T1HA 2PUYA 3C5KA 3MDBC 2YVRA 1E4UA 2MA5A 4C9ZA 4R2YA 2XEUA 2XOYA 4LKAA 3MHHA 2KKXA 2KWNA 2FD4A 5B78A 4I7CA 3NG2A 1WFKA 4GNEA 2YHOA 4Z0OA 2M1RA 1Z60A 2YSJA 1HYJA 4ZQLA 4YABA 2DJAA 2CKLA 2H0DB 5H9MA 3MHSA 5KH3A 1WEUA 2CRRA 3LQIA 1WILA 2MD8C 2LN0A 5AIUA 1MM3A 3DWDA 2UZGA 2JRJA 2L0BA 4TKPB 3ZVZB 4O62A 4LADB 4A49A 1JM7B 3KDEC 3LJUX 3RPGC 2OWAA 5LKXA 2Y43A 4GNFA 2NAAA 4PTBA 2JMDA 5G0FA 3ZPV1 4BHWA 2HYED 4IC2A 5D1LB 2ECWA 2KKYA 2L43A 1G25A 5FB0A 1VD4A 2EGPA 1WENA 1WEOA 1BORA 5TABA 4WZ3B 2M85A 4Z0RA 5FB1A 1JM7A 2VJEB 5H1UA 4O64A 2DX8A 3FJUB 2Y1MA 4N4FA 2FSAA 2LGKA 2CONA 3GV4A 4GNGA 3V43A 3EB6A 3O70A 1K2FA 2YREA 2XP0A 1MM2A 3SUBA 4AUQB 2VPBA 2CSVA 2HDPA 2JMIA 3M62A 5LKTA 3PLWA 2MA6A 4MSXA 5G04B 3HCSA 2F42A 3VK6A 3FM8C 2B0OE 2KYUA 4UP5A 1FBVA 2JMJA 5B8DA 2MD7B 2KWJA 4XI1A 5DKAA 4S3OC 3KNVA 2MKEA 4N3WA 4FJCA 5TRBA 4FO9A 4R7EA 1RMDA 3C6WA 4UP0A 4X3GA 3T7LA 2P57A 2JUNA 3FEHA 3FANA 3M99A 2YHNA 4P5OB 5LKUA 5H1VA 4QF2A 2M3HA 4H9DA 2G6QA 2E6RA 1WEWA 3JUEA 2FFWA 5DINA 4V3KC 3O37A 2VPGA 2VPDA 4F52B 1DCQA 1F62A 4V3LC 3LQHA 2I50A 5SVIB 3LVQE 2KFTA 2EGMA 2QIZA 3N9QA 2ZETC 3ZTGA 4FIPA 2VPEA 4YBSA 3L1ZB 2CRWA 3T9KA 3U5OA 2ECNA 2KWKA 3KQIA 2BAYA 2EA6A 1WEEA 2KGGA 3O47A 4LK9A 2K4DA 2LXPC 1VYXA 1IYMA 2CT2A 1WEMA 2L75A 2YQLA 5TBNA 2IDAA 5B75A 2KE1A 2M6MA 2KGIA 4YBMA 2H0DA 2XOCA 5FEYA 1N87A 5AITA 2L7PA 1V87A 2MUMA 3DQVR 5KH9A 3LRQA 1X4IA 2QJ0A 3O33A 5D1MB 2FUUA 3EB5A 3Q1DA 5JG6A 2LDRA 1CHCA 3HCTA 4QQ4A 3RPGB 3U5NA 4LLBA 4GNDA 1WGMA 3LVRE 5C13A 4AYCB 3SHBA 2K1JA 2EXUA 4YBTA 2OXQC 3FL2A 5TDWA 3N9LA 1XWHA 2MNYA 2C2LA 2E6SA 2XB1A 2VJEA 4YAXA 1Z6UA 2AN6A 3ZPVE 2K17A 2LV9A 4A4BA 2QICA 2DSMA 2Y1NA 1X4JA 1WESA 4B7YC 5G05B
chains in the Genus database with same CATH topology
2RSDA 2G43A 2RI7A 2ECTA 3O36A 4GB0A 3ZNIA 2F6NA 4I7DA 1X4UA 5LKZA 2LGLA 2ECJA 1LDJB 1WE9A 2C2VS 4B86C 4Q6FA 3PUQA 2YW8A 4WZ0A 4S3OB 4A4CA 2KIZA 2EODA 5KH7A 1VFYA 4L58A 2CKLB 2YT5A 2CSYA 3N9PA 4R8PK 3KV6A 3QZVA 4W4UA 5J3XA 1WEQA 3O7AA 3PURA 5FERA 4CCGX 4I7BA 3M63A 1HYIA 3IHPA 4MVTA 3U5PA 2CSZA 3N9NA 2VP7A 5B76A 2MNZA 2YUCA 4ZUXU 2MT5A 3I2DA 5I3LA 2KR4A 5B77A 5B79A 5EYAF 4AVXA 3SOXA 1WEPA 2K16A 3ZYQA 2LRIC 4L7XA 4YATA 2D8SA 2ECVA 4UI9B 3N9OA 2LQ6A 3SOWA 3RTRB 1FP0A 2YSMA 5LCWB 2L5UA 3U5MA 1LDKC 4A0CD 2ECGA 2YU4A 2KWOA 3O34A 1DVPA 2PNXA 3LQJA 1WIMA 3HTKC 2VJFB 3GL6A 4WZ2A 4NN2A 4CA1A 3HCUA 2KU3A 2LGGA 3PHDA 4IC3A 1ZBDB 2F6JA 4QF3A 2MIQA 4PPEA 2LXHC 3L1XA 2ECIA 2KREA 4AP4A 2L80A 1Z2QA 5TDRA 4AYCA 2VJFA 4YC9A 3L11A 1WEVA 4WA6A 3DPLR 2YYRA 5C11A 3KV5A 3SOUA 5H1TA 4ZDTA 2G45A 3O35A 3ZVYA 3ASLA 2YQMA 3N9MA 3T6RA 2YURA 4LJNA 4YADA 1JOCA 2VNFA 4BBQA 2FUIA 1U6GB 4FK5A 2LGVA 5D1KB 1T1HA 2PUYA 3C5KA 1E4UA 2MA5A 4C9ZA 4R2YA 2XEUA 4LKAA 3MHHA 2KWNA 5B78A 4I7CA 3NG2A 1WFKA 4GNEA 2YHOA 2M1RA 1Z60A 2YSJA 1HYJA 4ZQLA 4YABA 2CKLA 2H0DB 5H9MA 3MHSA 5KH3A 1WEUA 3LQIA 1WILA 2MD8C 2LN0A 5AIUA 1MM3A 2UZGA 2JRJA 2L0BA 4TKPB 3ZVZB 4LADB 4A49A 1JM7B 3RPGC 5LKXA 2Y43A 4GNFA 2NAAA 4PTBA 2JMDA 5G0FA 3ZPV1 4BHWA 2HYED 4IC2A 5D1LB 2ECWA 2L43A 1G25A 5FB0A 1VD4A 2EGPA 1WENA 1WEOA 1BORA 5TABA 4WZ3B 2M85A 5FB1A 1JM7A 2VJEB 5H1UA 4O64A 2DX8A 2Y1MA 4N4FA 2FSAA 2LGKA 3GV4A 4GNGA 3V43A 3EB6A 3O70A 1K2FA 2YREA 1MM2A 4AUQB 2VPBA 2HDPA 2JMIA 3M62A 5LKTA 2MA6A 4MSXA 5G04B 3HCSA 2F42A 3VK6A 2KYUA 4UP5A 1FBVA 2JMJA 5B8DA 2MD7B 2KWJA 4XI1A 5DKAA 4S3OC 3KNVA 4N3WA 4FJCA 5TRBA 4FO9A 4R7EA 1RMDA 3C6WA 4UP0A 4X3GA 3T7LA 3M99A 2YHNA 4P5OB 5LKUA 5H1VA 4QF2A 2M3HA 2G6QA 2E6RA 1WEWA 5DINA 4V3KC 3O37A 2VPGA 2VPDA 4F52B 1F62A 4V3LC 3LQHA 2I50A 2KFTA 2QIZA 3N9QA 2ZETC 3ZTGA 4FIPA 2VPEA 4YBSA 3L1ZB 3U5OA 2ECNA 2KWKA 3KQIA 2BAYA 2EA6A 1WEEA 2KGGA 4LK9A 2K4DA 2LXPC 1VYXA 1IYMA 2CT2A 1WEMA 2L75A 2YQLA 5TBNA 2IDAA 5B75A 2KE1A 2M6MA 2KGIA 4YBMA 2H0DA 5FEYA 1N87A 5AITA 1V87A 2MUMA 3DQVR 5KH9A 3LRQA 1X4IA 2QJ0A 3O33A 5D1MB 2FUUA 3EB5A 5JG6A 2LDRA 1CHCA 3HCTA 3RPGB 3U5NA 4LLBA 4GNDA 1WGMA 5C13A 4AYCB 3SHBA 2K1JA 4YBTA 2OXQC 3FL2A 5TDWA 3N9LA 1XWHA 2MNYA 2C2LA 2E6SA 2XB1A 2VJEA 4YAXA 1Z6UA 2AN6A 3ZPVE 2K17A 2LV9A 4A4BA 2QICA 2Y1NA 1X4JA 1WESA 4B7YC 5G05B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSD A;  2G43 A;  2RI7 A;  2ECT A;  3O36 A;  4GB0 A;  3ZNI A;  2F6N A;  4I7D A;  1X4U A;  5LKZ A;  2LGL A;  2ECJ A;  1LDJ B;  1WE9 A;  2C2V S;  4B86 C;  4Q6F A;  3PUQ A;  2YW8 A;  4WZ0 A;  4S3O B;  4A4C A;  2KIZ A;  2EOD A;  5KH7 A;  1VFY A;  4L58 A;  2CKL B;  2YT5 A;  2CSY A;  3N9P A;  4R8P K;  3KV6 A;  3QZV A;  4W4U A;  5J3X A;  1WEQ A;  3O7A A;  3PUR A;  5FER A;  4CCG X;  4I7B A;  3M63 A;  1HYI A;  3IHP A;  4MVT A;  3U5P A;  2CSZ A;  3N9N A;  2VP7 A;  5B76 A;  2MNZ A;  2YUC A;  4ZUX U;  2MT5 A;  3I2D A;  5I3L A;  2KR4 A;  5B77 A;  5B79 A;  5EYA F;  4AVX A;  3SOX A;  1WEP A;  2K16 A;  3ZYQ A;  2LRI C;  4L7X A;  4YAT A;  2D8S A;  2ECV A;  4UI9 B;  3N9O A;  2LQ6 A;  3SOW A;  3RTR B;  1FP0 A;  2YSM A;  5LCW B;  2L5U A;  3U5M A;  1LDK C;  4A0C D;  2ECG A;  2YU4 A;  2KWO A;  3O34 A;  1DVP A;  2PNX A;  3LQJ A;  1WIM A;  3HTK C;  2VJF B;  3GL6 A;  4WZ2 A;  4NN2 A;  4CA1 A;  3HCU A;  2KU3 A;  2LGG A;  3PHD A;  4IC3 A;  1ZBD B;  2F6J A;  4QF3 A;  2MIQ A;  4PPE A;  2LXH C;  3L1X A;  2ECI A;  2KRE A;  4AP4 A;  2L80 A;  1Z2Q A;  5TDR A;  4AYC A;  2VJF A;  4YC9 A;  3L11 A;  1WEV A;  4WA6 A;  3DPL R;  2YYR A;  5C11 A;  3KV5 A;  3SOU A;  5H1T A;  4ZDT A;  2G45 A;  3O35 A;  3ZVY A;  3ASL A;  2YQM A;  3N9M A;  3T6R A;  2YUR A;  4LJN A;  4YAD A;  1JOC A;  2VNF A;  4BBQ A;  2FUI A;  1U6G B;  4FK5 A;  2LGV A;  5D1K B;  1T1H A;  2PUY A;  3C5K A;  1E4U A;  2MA5 A;  4C9Z A;  4R2Y A;  2XEU A;  4LKA A;  3MHH A;  2KWN A;  5B78 A;  4I7C A;  3NG2 A;  1WFK A;  4GNE A;  2YHO A;  2M1R A;  1Z60 A;  2YSJ A;  1HYJ A;  4ZQL A;  4YAB A;  2CKL A;  2H0D B;  5H9M A;  3MHS A;  5KH3 A;  1WEU A;  3LQI A;  1WIL A;  2MD8 C;  2LN0 A;  5AIU A;  1MM3 A;  2UZG A;  2JRJ A;  2L0B A;  4TKP B;  3ZVZ B;  4LAD B;  4A49 A;  1JM7 B;  3RPG C;  5LKX A;  2Y43 A;  4GNF A;  2NAA A;  4PTB A;  2JMD A;  5G0F A;  3ZPV 1;  4BHW A;  2HYE D;  4IC2 A;  5D1L B;  2ECW A;  2L43 A;  1G25 A;  5FB0 A;  1VD4 A;  2EGP A;  1WEN A;  1WEO A;  1BOR A;  5TAB A;  4WZ3 B;  2M85 A;  5FB1 A;  1JM7 A;  2VJE B;  5H1U A;  4O64 A;  2DX8 A;  2Y1M A;  4N4F A;  2FSA A;  2LGK A;  3GV4 A;  4GNG A;  3V43 A;  3EB6 A;  3O70 A;  1K2F A;  2YRE A;  1MM2 A;  4AUQ B;  2VPB A;  2HDP A;  2JMI A;  3M62 A;  5LKT A;  2MA6 A;  4MSX A;  5G04 B;  3HCS A;  2F42 A;  3VK6 A;  2KYU A;  4UP5 A;  1FBV A;  2JMJ A;  5B8D A;  2MD7 B;  2KWJ A;  4XI1 A;  5DKA A;  4S3O C;  3KNV A;  4N3W A;  4FJC A;  5TRB A;  4FO9 A;  4R7E A;  1RMD A;  3C6W A;  4UP0 A;  4X3G A;  3T7L A;  3M99 A;  2YHN A;  4P5O B;  5LKU A;  5H1V A;  4QF2 A;  2M3H A;  2G6Q A;  2E6R A;  1WEW A;  5DIN A;  4V3K C;  3O37 A;  2VPG A;  2VPD A;  4F52 B;  1F62 A;  4V3L C;  3LQH A;  2I50 A;  2KFT A;  2QIZ A;  3N9Q A;  2ZET C;  3ZTG A;  4FIP A;  2VPE A;  4YBS A;  3L1Z B;  3U5O A;  2ECN A;  2KWK A;  3KQI A;  2BAY A;  2EA6 A;  1WEE A;  2KGG A;  4LK9 A;  2K4D A;  2LXP C;  1VYX A;  1IYM A;  2CT2 A;  1WEM A;  2L75 A;  2YQL A;  5TBN A;  2IDA A;  5B75 A;  2KE1 A;  2M6M A;  2KGI A;  4YBM A;  2H0D A;  5FEY A;  1N87 A;  5AIT A;  1V87 A;  2MUM A;  3DQV R;  5KH9 A;  3LRQ A;  1X4I A;  2QJ0 A;  3O33 A;  5D1M B;  2FUU A;  3EB5 A;  5JG6 A;  2LDR A;  1CHC A;  3HCT A;  3RPG B;  3U5N A;  4LLB A;  4GND A;  1WGM A;  5C13 A;  4AYC B;  3SHB A;  2K1J A;  4YBT A;  2OXQ C;  3FL2 A;  5TDW A;  3N9L A;  1XWH A;  2MNY A;  2C2L A;  2E6S A;  2XB1 A;  2VJE A;  4YAX A;  1Z6U A;  2AN6 A;  3ZPV E;  2K17 A;  2LV9 A;  4A4B A;  2QIC A;  2Y1N A;  1X4J A;  1WES A;  4B7Y C;  5G05 B; 
#chains in the Genus database with same CATH topology
 2RSD A;  2G43 A;  2RI7 A;  2ECT A;  3O36 A;  4GB0 A;  3ZNI A;  2F6N A;  2E61 A;  4I7D A;  1X4U A;  5LKZ A;  2LGL A;  2ECJ A;  1LDJ B;  1WE9 A;  2C2V S;  4B86 C;  4Q6F A;  3PUQ A;  2YW8 A;  4WZ0 A;  4S3O B;  4A4C A;  2KIZ A;  2EOD A;  2M13 A;  5KH7 A;  2LAU A;  1VFY A;  4L58 A;  2CKL B;  2YT5 A;  2CSY A;  3N9P A;  4R8P K;  3KV6 A;  3QZV A;  4W4U A;  5K3Q A;  5J3X A;  1WEQ A;  3O7A A;  3PUR A;  5FER A;  4CCG X;  4I7B A;  3M63 A;  1HYI A;  3IHP A;  4MVT A;  3U5P A;  2CSZ A;  3N9N A;  3LDY A;  2VP7 A;  5SVI A;  5B76 A;  2MNZ A;  2YUC A;  4ZUX U;  2MT5 A;  3I2D A;  5I3L A;  2KR4 A;  2RR4 A;  5B77 A;  5B79 A;  5EYA F;  4AVX A;  3SOX A;  1WEP A;  2K16 A;  3ZYQ A;  2LRI C;  4L7X A;  4YAT A;  2D8S A;  2ECV A;  4UI9 B;  3N9O A;  2LQ6 A;  3SOW A;  3RTR B;  1FP0 A;  3H7H A;  2YSM A;  3DDT A;  5LCW B;  2L5U A;  3U5M A;  1LDK C;  4A0C D;  2ECG A;  2YU4 A;  2KWO A;  3O34 A;  3M7K A;  1DVP A;  2PNX A;  3LQJ A;  1WIM A;  3HTK C;  2VJF B;  3GL6 A;  4WZ2 A;  4NN2 A;  4CA1 A;  3HCU A;  2KU3 A;  2LGG A;  4F1P A;  3PHD A;  4IC3 A;  1ZBD B;  2F6J A;  4QF3 A;  3FAO A;  2MIQ A;  4PPE A;  2LXH C;  4OGC A;  3L1X A;  2ECI A;  3E2D A;  2KRE A;  4AP4 A;  2L80 A;  1Z2Q A;  5TDR A;  4OGE A;  4AYC A;  2VJF A;  4YC9 A;  3L11 A;  1WEV A;  4WA6 A;  3DPL R;  2YYR A;  5C11 A;  3KV5 A;  5SVX A;  3SOU A;  5H1T A;  4ZDT A;  2G45 A;  3O35 A;  3ZVY A;  5SVY A;  3ASL A;  2YQM A;  3N9M A;  3T6R A;  2D8U A;  2YUR A;  4LJN A;  4YAD A;  1JOC A;  2VNF A;  2JM3 A;  1MBM A;  4BBQ A;  2FUI A;  2XOZ A;  1U6G B;  4FK5 A;  2LGV A;  2IQJ A;  5D1K B;  1T1H A;  2PUY A;  3C5K A;  3MDB C;  2YVR A;  1E4U A;  2MA5 A;  4C9Z A;  4R2Y A;  2XEU A;  2XOY A;  4LKA A;  3MHH A;  2KKX A;  2KWN A;  2FD4 A;  5B78 A;  4I7C A;  3NG2 A;  1WFK A;  4GNE A;  2YHO A;  4Z0O A;  2M1R A;  1Z60 A;  2YSJ A;  1HYJ A;  4ZQL A;  4YAB A;  2DJA A;  2CKL A;  2H0D B;  5H9M A;  3MHS A;  5KH3 A;  1WEU A;  2CRR A;  3LQI A;  1WIL A;  2MD8 C;  2LN0 A;  5AIU A;  1MM3 A;  3DWD A;  2UZG A;  2JRJ A;  2L0B A;  4TKP B;  3ZVZ B;  4O62 A;  4LAD B;  4A49 A;  1JM7 B;  3KDE C;  3LJU X;  3RPG C;  2OWA A;  5LKX A;  2Y43 A;  4GNF A;  2NAA A;  4PTB A;  2JMD A;  5G0F A;  3ZPV 1;  4BHW A;  2HYE D;  4IC2 A;  5D1L B;  2ECW A;  2KKY A;  2L43 A;  1G25 A;  5FB0 A;  1VD4 A;  2EGP A;  1WEN A;  1WEO A;  1BOR A;  5TAB A;  4WZ3 B;  2M85 A;  4Z0R A;  5FB1 A;  1JM7 A;  2VJE B;  5H1U A;  4O64 A;  2DX8 A;  3FJU B;  2Y1M A;  4N4F A;  2FSA A;  2LGK A;  2CON A;  3GV4 A;  4GNG A;  3V43 A;  3EB6 A;  3O70 A;  1K2F A;  2YRE A;  2XP0 A;  1MM2 A;  3SUB A;  4AUQ B;  2VPB A;  2CSV A;  2HDP A;  2JMI A;  3M62 A;  5LKT A;  3PLW A;  2MA6 A;  4MSX A;  5G04 B;  3HCS A;  2F42 A;  3VK6 A;  3FM8 C;  2B0O E;  2KYU A;  4UP5 A;  1FBV A;  2JMJ A;  5B8D A;  2MD7 B;  2KWJ A;  4XI1 A;  5DKA A;  4S3O C;  3KNV A;  2MKE A;  4N3W A;  4FJC A;  5TRB A;  4FO9 A;  4R7E A;  1RMD A;  3C6W A;  4UP0 A;  4X3G A;  3T7L A;  2P57 A;  2JUN A;  3FEH A;  3FAN A;  3M99 A;  2YHN A;  4P5O B;  5LKU A;  5H1V A;  4QF2 A;  2M3H A;  4H9D A;  2G6Q A;  2E6R A;  1WEW A;  3JUE A;  2FFW A;  5DIN A;  4V3K C;  3O37 A;  2VPG A;  2VPD A;  4F52 B;  1DCQ A;  1F62 A;  4V3L C;  3LQH A;  2I50 A;  5SVI B;  3LVQ E;  2KFT A;  2EGM A;  2QIZ A;  3N9Q A;  2ZET C;  3ZTG A;  4FIP A;  2VPE A;  4YBS A;  3L1Z B;  2CRW A;  3T9K A;  3U5O A;  2ECN A;  2KWK A;  3KQI A;  2BAY A;  2EA6 A;  1WEE A;  2KGG A;  3O47 A;  4LK9 A;  2K4D A;  2LXP C;  1VYX A;  1IYM A;  2CT2 A;  1WEM A;  2L75 A;  2YQL A;  5TBN A;  2IDA A;  5B75 A;  2KE1 A;  2M6M A;  2KGI A;  4YBM A;  2H0D A;  2XOC A;  5FEY A;  1N87 A;  5AIT A;  2L7P A;  1V87 A;  2MUM A;  3DQV R;  5KH9 A;  3LRQ A;  1X4I A;  2QJ0 A;  3O33 A;  5D1M B;  2FUU A;  3EB5 A;  3Q1D A;  5JG6 A;  2LDR A;  1CHC A;  3HCT A;  4QQ4 A;  3RPG B;  3U5N A;  4LLB A;  4GND A;  1WGM A;  3LVR E;  5C13 A;  4AYC B;  3SHB A;  2K1J A;  2EXU A;  4YBT A;  2OXQ C;  3FL2 A;  5TDW A;  3N9L A;  1XWH A;  2MNY A;  2C2L A;  2E6S A;  2XB1 A;  2VJE A;  4YAX A;  1Z6U A;  2AN6 A;  3ZPV E;  2K17 A;  2LV9 A;  4A4B A;  2QIC A;  2DSM A;  2Y1N A;  1X4J A;  1WES A;  4B7Y C;  5G05 B; 
#chains in the Genus database with same CATH homology
 2RSD A;  2G43 A;  2RI7 A;  2ECT A;  3O36 A;  4GB0 A;  3ZNI A;  2F6N A;  4I7D A;  1X4U A;  5LKZ A;  2LGL A;  2ECJ A;  1LDJ B;  1WE9 A;  2C2V S;  4B86 C;  4Q6F A;  3PUQ A;  2YW8 A;  4WZ0 A;  4S3O B;  4A4C A;  2KIZ A;  2EOD A;  5KH7 A;  1VFY A;  4L58 A;  2CKL B;  2YT5 A;  2CSY A;  3N9P A;  4R8P K;  3KV6 A;  3QZV A;  4W4U A;  5J3X A;  1WEQ A;  3O7A A;  3PUR A;  5FER A;  4CCG X;  4I7B A;  3M63 A;  1HYI A;  3IHP A;  4MVT A;  3U5P A;  2CSZ A;  3N9N A;  2VP7 A;  5B76 A;  2MNZ A;  2YUC A;  4ZUX U;  2MT5 A;  3I2D A;  5I3L A;  2KR4 A;  5B77 A;  5B79 A;  5EYA F;  4AVX A;  3SOX A;  1WEP A;  2K16 A;  3ZYQ A;  2LRI C;  4L7X A;  4YAT A;  2D8S A;  2ECV A;  4UI9 B;  3N9O A;  2LQ6 A;  3SOW A;  3RTR B;  1FP0 A;  2YSM A;  5LCW B;  2L5U A;  3U5M A;  1LDK C;  4A0C D;  2ECG A;  2YU4 A;  2KWO A;  3O34 A;  1DVP A;  2PNX A;  3LQJ A;  1WIM A;  3HTK C;  2VJF B;  3GL6 A;  4WZ2 A;  4NN2 A;  4CA1 A;  3HCU A;  2KU3 A;  2LGG A;  3PHD A;  4IC3 A;  1ZBD B;  2F6J A;  4QF3 A;  2MIQ A;  4PPE A;  2LXH C;  3L1X A;  2ECI A;  2KRE A;  4AP4 A;  2L80 A;  1Z2Q A;  5TDR A;  4AYC A;  2VJF A;  4YC9 A;  3L11 A;  1WEV A;  4WA6 A;  3DPL R;  2YYR A;  5C11 A;  3KV5 A;  3SOU A;  5H1T A;  4ZDT A;  2G45 A;  3O35 A;  3ZVY A;  3ASL A;  2YQM A;  3N9M A;  3T6R A;  2YUR A;  4LJN A;  4YAD A;  1JOC A;  2VNF A;  4BBQ A;  2FUI A;  1U6G B;  4FK5 A;  2LGV A;  5D1K B;  1T1H A;  2PUY A;  3C5K A;  1E4U A;  2MA5 A;  4C9Z A;  4R2Y A;  2XEU A;  4LKA A;  3MHH A;  2KWN A;  5B78 A;  4I7C A;  3NG2 A;  1WFK A;  4GNE A;  2YHO A;  2M1R A;  1Z60 A;  2YSJ A;  1HYJ A;  4ZQL A;  4YAB A;  2CKL A;  2H0D B;  5H9M A;  3MHS A;  5KH3 A;  1WEU A;  3LQI A;  1WIL A;  2MD8 C;  2LN0 A;  5AIU A;  1MM3 A;  2UZG A;  2JRJ A;  2L0B A;  4TKP B;  3ZVZ B;  4LAD B;  4A49 A;  1JM7 B;  3RPG C;  5LKX A;  2Y43 A;  4GNF A;  2NAA A;  4PTB A;  2JMD A;  5G0F A;  3ZPV 1;  4BHW A;  2HYE D;  4IC2 A;  5D1L B;  2ECW A;  2L43 A;  1G25 A;  5FB0 A;  1VD4 A;  2EGP A;  1WEN A;  1WEO A;  1BOR A;  5TAB A;  4WZ3 B;  2M85 A;  5FB1 A;  1JM7 A;  2VJE B;  5H1U A;  4O64 A;  2DX8 A;  2Y1M A;  4N4F A;  2FSA A;  2LGK A;  3GV4 A;  4GNG A;  3V43 A;  3EB6 A;  3O70 A;  1K2F A;  2YRE A;  1MM2 A;  4AUQ B;  2VPB A;  2HDP A;  2JMI A;  3M62 A;  5LKT A;  2MA6 A;  4MSX A;  5G04 B;  3HCS A;  2F42 A;  3VK6 A;  2KYU A;  4UP5 A;  1FBV A;  2JMJ A;  5B8D A;  2MD7 B;  2KWJ A;  4XI1 A;  5DKA A;  4S3O C;  3KNV A;  4N3W A;  4FJC A;  5TRB A;  4FO9 A;  4R7E A;  1RMD A;  3C6W A;  4UP0 A;  4X3G A;  3T7L A;  3M99 A;  2YHN A;  4P5O B;  5LKU A;  5H1V A;  4QF2 A;  2M3H A;  2G6Q A;  2E6R A;  1WEW A;  5DIN A;  4V3K C;  3O37 A;  2VPG A;  2VPD A;  4F52 B;  1F62 A;  4V3L C;  3LQH A;  2I50 A;  2KFT A;  2QIZ A;  3N9Q A;  2ZET C;  3ZTG A;  4FIP A;  2VPE A;  4YBS A;  3L1Z B;  3U5O A;  2ECN A;  2KWK A;  3KQI A;  2BAY A;  2EA6 A;  1WEE A;  2KGG A;  4LK9 A;  2K4D A;  2LXP C;  1VYX A;  1IYM A;  2CT2 A;  1WEM A;  2L75 A;  2YQL A;  5TBN A;  2IDA A;  5B75 A;  2KE1 A;  2M6M A;  2KGI A;  4YBM A;  2H0D A;  5FEY A;  1N87 A;  5AIT A;  1V87 A;  2MUM A;  3DQV R;  5KH9 A;  3LRQ A;  1X4I A;  2QJ0 A;  3O33 A;  5D1M B;  2FUU A;  3EB5 A;  5JG6 A;  2LDR A;  1CHC A;  3HCT A;  3RPG B;  3U5N A;  4LLB A;  4GND A;  1WGM A;  5C13 A;  4AYC B;  3SHB A;  2K1J A;  4YBT A;  2OXQ C;  3FL2 A;  5TDW A;  3N9L A;  1XWH A;  2MNY A;  2C2L A;  2E6S A;  2XB1 A;  2VJE A;  4YAX A;  1Z6U A;  2AN6 A;  3ZPV E;  2K17 A;  2LV9 A;  4A4B A;  2QIC A;  2Y1N A;  1X4J A;  1WES A;  4B7Y C;  5G05 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...