4Q6FA

Crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'SVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4q6fA00
1RMDA 2PNXA 4YADA 2LGVA 3ZVYA 5C11A 4I7CA 1E4UA 3IHPA 5JG6A 4ZUXU 4P5OB 2VJEA 2Y1MA 3N9OA 2L0BA 3RTRB 3M99A 4FJCA 2MT5A 3ZYQA 3N9MA 1WILA 2MA5A 4AYCA 2KR4A 2MD8C 2YREA 5B76A 2CKLB 2YSJA 4NN2A 2MA6A 2ZETC 2KE1A 4BBQA 2VNFA 2VJFA 1JOCA 1MM2A 5LKTA 2RSDA 2DX8A 3GL6A 3LQJA 5LKXA 2ECJA 1K2FA 2JMIA 3MHHA 2YQMA 5TDRA 2C2LA 1WFKA 2PUYA 1DVPA 5FERA 3N9PA 1X4JA 1WEOA 3O70A 2YQLA 3ZPVE 5TBNA 4YC9A 3RPGB 4WA6A 1HYJA 4IC2A 2G45A 4AVXA 1WEWA 1WEQA 1VFYA 2VPGA 5KH3A 4AP4A 2LRIC 1JM7B 3NG2A 5G05B 4IC3A 4V3LC 5C13A 1X4IA 1Z60A 4A49A 2EA6A 4R8PK 4FK5A 5I3LA 4XI1A 3DPLR 2MD7B 5AIUA 2L75A 4I7DA 1BORA 2Y43A 4V3KC 4YATA 1Z2QA 2MIQA 1WIMA 3U5PA 4AUQB 4ZQLA 3C6WA 4L58A 4CA1A 3SHBA 2M1RA 2KIZA 1VYXA 3T7LA 4YBMA 2VPBA 2LV9A 2L43A 3LQIA 4PTBA 1X4UA 3FL2A 2MNYA 4WZ0A 2XB1A 1WENA 4L7XA 4WZ3B 4LADB 2D8SA 3V43A 3N9QA 4F52B 2FUUA 2H0DA 2LGKA 4AYCB 1N87A 4QF2A 4YBSA 5TABA 5H1UA 2ECNA 3LRQA 4A4CA 3GV4A 4MVTA 3O34A 2UZGA 1V87A 3DQVR 2FUIA 1WEEA 3O7AA 5D1LB 3EB5A 2YHNA 2ECVA 2L5UA 3KQIA 4A4BA 1T1HA 3PHDA 3EB6A 4N4FA 1FP0A 3ZVZB 2K16A 3O35A 2YURA 5B75A 2JMDA 2BAYA 2LDRA 4LJNA 3PURA 4S3OC 2Y1NA 3ZNIA 4CCGX 2F6JA 1Z6UA 4I7BA 5DKAA 3MHSA 3SOWA 4A0CD 5J3XA 3U5MA 1WGMA 2KWKA 4GNDA 5AITA 2LXPC 3SOXA 5G04B 4R7EA 4LKAA 3SOUA 1U6GB 2L80A 2YW8A 2ECIA 2KWJA 2MUMA 5D1MB 4YBTA 5FB1A 2KU3A 2YSMA 5TRBA 1CHCA 2YU4A 3T6RA 5KH9A 2CSYA 4N3WA 4BHWA 3L11A 5B8DA 3M63A 3N9LA 3N9NA 1WEVA 1WEPA 1JM7A 2QIZA 5FB0A 2YUCA 3PUQA 4MSXA 2H0DB 2LQ6A 2QJ0A 2XEUA 1MM3A 5EYAF 2VJEB 2ECTA 2YYRA 3U5NA 4LLBA 5LKZA 2E6RA 3HCTA 3O37A 4GNGA 3QZVA 2YHOA 4C9ZA 5H9MA 2KWNA 5D1KB 5DINA 3ZTGA 2RI7A 2M85A 3U5OA 1LDJB 2IDAA 4YABA 2VJFB 4B7YC 2LGGA 2E6SA 3KV6A 4W4UA 2YT5A 2G43A 4UP0A 3M62A 4UI9B 1WEUA 2K1JA 5B79A 3ASLA 4B86C 1G25A 3RPGC 2VPDA 4TKPB 4Q6FA 1VD4A 3KV5A 2CKLA 2MNZA 2KREA 1FBVA 3O36A 4O64A 4GNFA 2HYED 1XWHA 2LXHC 2M3HA 2EGPA 3HTKC 2CSZA 4YAXA 1F62A 2F42A 3LQHA 4UP5A 5LCWB 2C2VS 4X3GA 4GNEA 2ECGA 2KYUA 4FIPA 5B77A 2KWOA 2JMJA 2NAAA 5TDWA 1LDKC 5B78A 5H1TA 5H1VA 3VK6A 1WESA 3L1XA 5KH7A 3KNVA 5FEYA 2M6MA 3O33A 4FO9A 2LGLA 2HDPA 2JRJA 5LKUA 4QF3A 2VPEA 4WZ2A 2AN6A 2KGGA 2I50A 2EODA 5G0FA 1HYIA 2QICA 1IYMA 4PPEA 2FSAA 3L1ZB 2ECWA 1WE9A 2CT2A 4LK9A 2K17A 4S3OB 4R2YA 2KGIA 2VP7A 3ZPV1 4ZDTA 2OXQC 3HCUA 4GB0A 3I2DA 3HCSA 2KFTA 2F6NA 2K4DA 1WEMA 1ZBDB 2G6QA 2LN0A 3C5KA
chains in the Genus database with same CATH superfamily
1RMDA 2PNXA 4YADA 2LGVA 3ZVYA 5C11A 4I7CA 1E4UA 3IHPA 5JG6A 4ZUXU 4P5OB 2VJEA 2Y1MA 3N9OA 2L0BA 3RTRB 3M99A 4FJCA 2MT5A 3ZYQA 3N9MA 1WILA 2MA5A 4AYCA 2KR4A 2MD8C 2YREA 5B76A 2CKLB 2YSJA 5SVIB 4NN2A 3LJUX 3T9KA 2MA6A 2ZETC 2KE1A 4BBQA 2VNFA 2VJFA 2CONA 1JOCA 1MM2A 3FJUB 5LKTA 2RSDA 2DX8A 3GL6A 3LQJA 5LKXA 4OGEA 2ECJA 1K2FA 2B0OE 2JMIA 3MHHA 1MBMA 2YQMA 5TDRA 2C2LA 1WFKA 2PUYA 1DVPA 5FERA 3N9PA 1X4JA 1WEOA 3O70A 2YQLA 3ZPVE 2KKYA 5TBNA 3E2DA 4YC9A 3RPGB 4WA6A 1HYJA 4IC2A 2G45A 4AVXA 1WEWA 1WEQA 1VFYA 2VPGA 5KH3A 3M7KA 4AP4A 2LRIC 1JM7B 3NG2A 5G05B 4IC3A 4V3LC 5C13A 1X4IA 1Z60A 4A49A 2EA6A 4R8PK 4FK5A 5I3LA 4XI1A 3DPLR 2MD7B 5AIUA 2DSMA 2L75A 4I7DA 1BORA 2Y43A 4V3KC 4YATA 1Z2QA 2MIQA 1WIMA 3U5PA 4AUQB 4ZQLA 3C6WA 4L58A 4CA1A 3LVRE 3SHBA 1DCQA 2D8UA 3KDEC 2M1RA 2KIZA 1VYXA 3T7LA 2XOYA 3FANA 4YBMA 2VPBA 2LV9A 2L43A 3LQIA 4PTBA 1X4UA 3FL2A 2MNYA 4WZ0A 2XB1A 1WENA 4L7XA 4WZ3B 4LADB 2D8SA 3V43A 3N9QA 3O47A 4F52B 2FUUA 2H0DA 2EXUA 2LGKA 4AYCB 2M13A 2XP0A 1N87A 4QF2A 4QQ4A 4YBSA 5TABA 4OGCA 5H1UA 3SUBA 2ECNA 2JUNA 3LRQA 3H7HA 2RR4A 2KKXA 4A4CA 3GV4A 4MVTA 3O34A 2UZGA 1V87A 3DQVR 2FUIA 1WEEA 3O7AA 5D1LB 3EB5A 2YHNA 2IQJA 2ECVA 2L5UA 3KQIA 4A4BA 1T1HA 3PHDA 3EB6A 4Z0OA 4N4FA 1FP0A 3ZVZB 2K16A 3PLWA 3O35A 2FD4A 2YURA 5B75A 2JMDA 2BAYA 2LDRA 4LJNA 3PURA 4S3OC 2Y1NA 3ZNIA 4CCGX 2F6JA 1Z6UA 4I7BA 5DKAA 3MHSA 3SOWA 4A0CD 5J3XA 3U5MA 2XOZA 1WGMA 2CRRA 2KWKA 4GNDA 5AITA 2LXPC 3SOXA 5G04B 4R7EA 4LKAA 3SOUA 1U6GB 2L7PA 2L80A 3FM8C 2YW8A 2ECIA 2KWJA 2MUMA 5D1MB 2OWAA 4YBTA 5FB1A 2KU3A 2YSMA 5TRBA 1CHCA 2YU4A 3T6RA 5KH9A 2CSYA 4N3WA 4BHWA 3L11A 5B8DA 3M63A 3N9LA 3N9NA 1WEVA 1WEPA 4O62A 1JM7A 2QIZA 5FB0A 2YUCA 3PUQA 4MSXA 2CRWA 2H0DB 2LQ6A 2QJ0A 2XEUA 1MM3A 5EYAF 2VJEB 2ECTA 2LAUA 2YYRA 3U5NA 4LLBA 5LKZA 2E6RA 3HCTA 3O37A 4GNGA 3QZVA 2YHOA 2EGMA 4C9ZA 5H9MA 2KWNA 5D1KB 5DINA 3ZTGA 2RI7A 2M85A 5SVYA 3U5OA 1LDJB 2IDAA 4YABA 3LDYA 2XOCA 2VJFB 4B7YC 2LGGA 2E6SA 3KV6A 2JM3A 4W4UA 2YT5A 3MDBC 2G43A 2MKEA 4UP0A 3M62A 4UI9B 1WEUA 2K1JA 5B79A 3ASLA 3DWDA 4B86C 3RPGC 2VPDA 4TKPB 1G25A 4Q6FA 1VD4A 3KV5A 2FFWA 2CKLA 2CSVA 2MNZA 2KREA 1FBVA 3O36A 5SVIA 4O64A 4GNFA 2HYED 2YVRA 1XWHA 3LVQE 2LXHC 2M3HA 2EGPA 3HTKC 2CSZA 4YAXA 1F62A 2F42A 3LQHA 4UP5A 5LCWB 2C2VS 4X3GA 4GNEA 3DDTA 2ECGA 2KYUA 4H9DA 4FIPA 5B77A 2KWOA 3FAOA 4F1PA 2JMJA 2NAAA 5TDWA 1LDKC 5B78A 5H1TA 2DJAA 5H1VA 3VK6A 2P57A 1WESA 3L1XA 5KH7A 3KNVA 5FEYA 5K3QA 5SVXA 2M6MA 3O33A 4FO9A 3FEHA 2LGLA 2HDPA 2JRJA 5LKUA 4QF3A 2VPEA 4WZ2A 2AN6A 2KGGA 2I50A 2EODA 5G0FA 1HYIA 2QICA 1IYMA 4PPEA 2FSAA 3L1ZB 2ECWA 1WE9A 2CT2A 4LK9A 2K17A 4S3OB 4R2YA 2KGIA 2VP7A 3ZPV1 4ZDTA 2OXQC 3HCUA 4GB0A 3I2DA 3HCSA 3JUEA 2KFTA 2E61A 2F6NA 2K4DA 4Z0RA 1WEMA 1ZBDB 2G6QA 2LN0A 3Q1DA 3C5KA
chains in the Genus database with same CATH topology
1RMDA 2PNXA 4YADA 2LGVA 3ZVYA 5C11A 4I7CA 1E4UA 3IHPA 5JG6A 4ZUXU 4P5OB 2VJEA 2Y1MA 3N9OA 2L0BA 3RTRB 3M99A 4FJCA 2MT5A 3ZYQA 3N9MA 1WILA 2MA5A 4AYCA 2KR4A 2MD8C 2YREA 5B76A 2CKLB 2YSJA 4NN2A 2MA6A 2ZETC 2KE1A 4BBQA 2VNFA 2VJFA 1JOCA 1MM2A 5LKTA 2RSDA 2DX8A 3GL6A 3LQJA 5LKXA 2ECJA 1K2FA 2JMIA 3MHHA 2YQMA 5TDRA 2C2LA 1WFKA 2PUYA 1DVPA 5FERA 3N9PA 1X4JA 1WEOA 3O70A 2YQLA 3ZPVE 5TBNA 4YC9A 3RPGB 4WA6A 1HYJA 4IC2A 2G45A 4AVXA 1WEWA 1WEQA 1VFYA 2VPGA 5KH3A 4AP4A 2LRIC 1JM7B 3NG2A 5G05B 4IC3A 4V3LC 5C13A 1X4IA 1Z60A 4A49A 2EA6A 4R8PK 4FK5A 5I3LA 4XI1A 3DPLR 2MD7B 5AIUA 2L75A 4I7DA 1BORA 2Y43A 4V3KC 4YATA 1Z2QA 2MIQA 1WIMA 3U5PA 4AUQB 4ZQLA 3C6WA 4L58A 4CA1A 3SHBA 2M1RA 2KIZA 1VYXA 3T7LA 4YBMA 2VPBA 2LV9A 2L43A 3LQIA 4PTBA 1X4UA 3FL2A 2MNYA 4WZ0A 2XB1A 1WENA 4L7XA 4WZ3B 4LADB 2D8SA 3V43A 3N9QA 4F52B 2FUUA 2H0DA 2LGKA 4AYCB 1N87A 4QF2A 4YBSA 5TABA 5H1UA 2ECNA 3LRQA 4A4CA 3GV4A 4MVTA 3O34A 2UZGA 1V87A 3DQVR 2FUIA 1WEEA 3O7AA 5D1LB 3EB5A 2YHNA 2ECVA 2L5UA 3KQIA 4A4BA 1T1HA 3PHDA 3EB6A 4N4FA 1FP0A 3ZVZB 2K16A 3O35A 2YURA 5B75A 2JMDA 2BAYA 2LDRA 4LJNA 3PURA 4S3OC 2Y1NA 3ZNIA 4CCGX 2F6JA 1Z6UA 4I7BA 5DKAA 3MHSA 3SOWA 4A0CD 5J3XA 3U5MA 1WGMA 2KWKA 4GNDA 5AITA 2LXPC 3SOXA 5G04B 4R7EA 4LKAA 3SOUA 1U6GB 2L80A 2YW8A 2ECIA 2KWJA 2MUMA 5D1MB 4YBTA 5FB1A 2KU3A 2YSMA 5TRBA 1CHCA 2YU4A 3T6RA 5KH9A 2CSYA 4N3WA 4BHWA 3L11A 5B8DA 3M63A 3N9LA 3N9NA 1WEVA 1WEPA 1JM7A 2QIZA 5FB0A 2YUCA 3PUQA 4MSXA 2H0DB 2LQ6A 2QJ0A 2XEUA 1MM3A 5EYAF 2VJEB 2ECTA 2YYRA 3U5NA 4LLBA 5LKZA 2E6RA 3HCTA 3O37A 4GNGA 3QZVA 2YHOA 4C9ZA 5H9MA 2KWNA 5D1KB 5DINA 3ZTGA 2RI7A 2M85A 3U5OA 1LDJB 2IDAA 4YABA 2VJFB 4B7YC 2LGGA 2E6SA 3KV6A 4W4UA 2YT5A 2G43A 4UP0A 3M62A 4UI9B 1WEUA 2K1JA 5B79A 3ASLA 4B86C 1G25A 3RPGC 2VPDA 4TKPB 4Q6FA 1VD4A 3KV5A 2CKLA 2MNZA 2KREA 1FBVA 3O36A 4O64A 4GNFA 2HYED 1XWHA 2LXHC 2M3HA 2EGPA 3HTKC 2CSZA 4YAXA 1F62A 2F42A 3LQHA 4UP5A 5LCWB 2C2VS 4X3GA 4GNEA 2ECGA 2KYUA 4FIPA 5B77A 2KWOA 2JMJA 2NAAA 5TDWA 1LDKC 5B78A 5H1TA 5H1VA 3VK6A 1WESA 3L1XA 5KH7A 3KNVA 5FEYA 2M6MA 3O33A 4FO9A 2LGLA 2HDPA 2JRJA 5LKUA 4QF3A 2VPEA 4WZ2A 2AN6A 2KGGA 2I50A 2EODA 5G0FA 1HYIA 2QICA 1IYMA 4PPEA 2FSAA 3L1ZB 2ECWA 1WE9A 2CT2A 4LK9A 2K17A 4S3OB 4R2YA 2KGIA 2VP7A 3ZPV1 4ZDTA 2OXQC 3HCUA 4GB0A 3I2DA 3HCSA 2KFTA 2F6NA 2K4DA 1WEMA 1ZBDB 2G6QA 2LN0A 3C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  2PNX A;  4YAD A;  2LGV A;  3ZVY A;  5C11 A;  4I7C A;  1E4U A;  3IHP A;  5JG6 A;  4ZUX U;  4P5O B;  2VJE A;  2Y1M A;  3N9O A;  2L0B A;  3RTR B;  3M99 A;  4FJC A;  2MT5 A;  3ZYQ A;  3N9M A;  1WIL A;  2MA5 A;  4AYC A;  2KR4 A;  2MD8 C;  2YRE A;  5B76 A;  2CKL B;  2YSJ A;  4NN2 A;  2MA6 A;  2ZET C;  2KE1 A;  4BBQ A;  2VNF A;  2VJF A;  1JOC A;  1MM2 A;  5LKT A;  2RSD A;  2DX8 A;  3GL6 A;  3LQJ A;  5LKX A;  2ECJ A;  1K2F A;  2JMI A;  3MHH A;  2YQM A;  5TDR A;  2C2L A;  1WFK A;  2PUY A;  1DVP A;  5FER A;  3N9P A;  1X4J A;  1WEO A;  3O70 A;  2YQL A;  3ZPV E;  5TBN A;  4YC9 A;  3RPG B;  4WA6 A;  1HYJ A;  4IC2 A;  2G45 A;  4AVX A;  1WEW A;  1WEQ A;  1VFY A;  2VPG A;  5KH3 A;  4AP4 A;  2LRI C;  1JM7 B;  3NG2 A;  5G05 B;  4IC3 A;  4V3L C;  5C13 A;  1X4I A;  1Z60 A;  4A49 A;  2EA6 A;  4R8P K;  4FK5 A;  5I3L A;  4XI1 A;  3DPL R;  2MD7 B;  5AIU A;  2L75 A;  4I7D A;  1BOR A;  2Y43 A;  4V3K C;  4YAT A;  1Z2Q A;  2MIQ A;  1WIM A;  3U5P A;  4AUQ B;  4ZQL A;  3C6W A;  4L58 A;  4CA1 A;  3SHB A;  2M1R A;  2KIZ A;  1VYX A;  3T7L A;  4YBM A;  2VPB A;  2LV9 A;  2L43 A;  3LQI A;  4PTB A;  1X4U A;  3FL2 A;  2MNY A;  4WZ0 A;  2XB1 A;  1WEN A;  4L7X A;  4WZ3 B;  4LAD B;  2D8S A;  3V43 A;  3N9Q A;  4F52 B;  2FUU A;  2H0D A;  2LGK A;  4AYC B;  1N87 A;  4QF2 A;  4YBS A;  5TAB A;  5H1U A;  2ECN A;  3LRQ A;  4A4C A;  3GV4 A;  4MVT A;  3O34 A;  2UZG A;  1V87 A;  3DQV R;  2FUI A;  1WEE A;  3O7A A;  5D1L B;  3EB5 A;  2YHN A;  2ECV A;  2L5U A;  3KQI A;  4A4B A;  1T1H A;  3PHD A;  3EB6 A;  4N4F A;  1FP0 A;  3ZVZ B;  2K16 A;  3O35 A;  2YUR A;  5B75 A;  2JMD A;  2BAY A;  2LDR A;  4LJN A;  3PUR A;  4S3O C;  2Y1N A;  3ZNI A;  4CCG X;  2F6J A;  1Z6U A;  4I7B A;  5DKA A;  3MHS A;  3SOW A;  4A0C D;  5J3X A;  3U5M A;  1WGM A;  2KWK A;  4GND A;  5AIT A;  2LXP C;  3SOX A;  5G04 B;  4R7E A;  4LKA A;  3SOU A;  1U6G B;  2L80 A;  2YW8 A;  2ECI A;  2KWJ A;  2MUM A;  5D1M B;  4YBT A;  5FB1 A;  2KU3 A;  2YSM A;  5TRB A;  1CHC A;  2YU4 A;  3T6R A;  5KH9 A;  2CSY A;  4N3W A;  4BHW A;  3L11 A;  5B8D A;  3M63 A;  3N9L A;  3N9N A;  1WEV A;  1WEP A;  1JM7 A;  2QIZ A;  5FB0 A;  2YUC A;  3PUQ A;  4MSX A;  2H0D B;  2LQ6 A;  2QJ0 A;  2XEU A;  1MM3 A;  5EYA F;  2VJE B;  2ECT A;  2YYR A;  3U5N A;  4LLB A;  5LKZ A;  2E6R A;  3HCT A;  3O37 A;  4GNG A;  3QZV A;  2YHO A;  4C9Z A;  5H9M A;  2KWN A;  5D1K B;  5DIN A;  3ZTG A;  2RI7 A;  2M85 A;  3U5O A;  1LDJ B;  2IDA A;  4YAB A;  2VJF B;  4B7Y C;  2LGG A;  2E6S A;  3KV6 A;  4W4U A;  2YT5 A;  2G43 A;  4UP0 A;  3M62 A;  4UI9 B;  1WEU A;  2K1J A;  5B79 A;  3ASL A;  4B86 C;  1G25 A;  3RPG C;  2VPD A;  4TKP B;  4Q6F A;  1VD4 A;  3KV5 A;  2CKL A;  2MNZ A;  2KRE A;  1FBV A;  3O36 A;  4O64 A;  4GNF A;  2HYE D;  1XWH A;  2LXH C;  2M3H A;  2EGP A;  3HTK C;  2CSZ A;  4YAX A;  1F62 A;  2F42 A;  3LQH A;  4UP5 A;  5LCW B;  2C2V S;  4X3G A;  4GNE A;  2ECG A;  2KYU A;  4FIP A;  5B77 A;  2KWO A;  2JMJ A;  2NAA A;  5TDW A;  1LDK C;  5B78 A;  5H1T A;  5H1V A;  3VK6 A;  1WES A;  3L1X A;  5KH7 A;  3KNV A;  5FEY A;  2M6M A;  3O33 A;  4FO9 A;  2LGL A;  2HDP A;  2JRJ A;  5LKU A;  4QF3 A;  2VPE A;  4WZ2 A;  2AN6 A;  2KGG A;  2I50 A;  2EOD A;  5G0F A;  1HYI A;  2QIC A;  1IYM A;  4PPE A;  2FSA A;  3L1Z B;  2ECW A;  1WE9 A;  2CT2 A;  4LK9 A;  2K17 A;  4S3O B;  4R2Y A;  2KGI A;  2VP7 A;  3ZPV 1;  4ZDT A;  2OXQ C;  3HCU A;  4GB0 A;  3I2D A;  3HCS A;  2KFT A;  2F6N A;  2K4D A;  1WEM A;  1ZBD B;  2G6Q A;  2LN0 A;  3C5K A; 
#chains in the Genus database with same CATH topology
 1RMD A;  2PNX A;  4YAD A;  2LGV A;  3ZVY A;  5C11 A;  4I7C A;  1E4U A;  3IHP A;  5JG6 A;  4ZUX U;  4P5O B;  2VJE A;  2Y1M A;  3N9O A;  2L0B A;  3RTR B;  3M99 A;  4FJC A;  2MT5 A;  3ZYQ A;  3N9M A;  1WIL A;  2MA5 A;  4AYC A;  2KR4 A;  2MD8 C;  2YRE A;  5B76 A;  2CKL B;  2YSJ A;  5SVI B;  4NN2 A;  3LJU X;  3T9K A;  2MA6 A;  2ZET C;  2KE1 A;  4BBQ A;  2VNF A;  2VJF A;  2CON A;  1JOC A;  1MM2 A;  3FJU B;  5LKT A;  2RSD A;  2DX8 A;  3GL6 A;  3LQJ A;  5LKX A;  4OGE A;  2ECJ A;  1K2F A;  2B0O E;  2JMI A;  3MHH A;  1MBM A;  2YQM A;  5TDR A;  2C2L A;  1WFK A;  2PUY A;  1DVP A;  5FER A;  3N9P A;  1X4J A;  1WEO A;  3O70 A;  2YQL A;  3ZPV E;  2KKY A;  5TBN A;  3E2D A;  4YC9 A;  3RPG B;  4WA6 A;  1HYJ A;  4IC2 A;  2G45 A;  4AVX A;  1WEW A;  1WEQ A;  1VFY A;  2VPG A;  5KH3 A;  3M7K A;  4AP4 A;  2LRI C;  1JM7 B;  3NG2 A;  5G05 B;  4IC3 A;  4V3L C;  5C13 A;  1X4I A;  1Z60 A;  4A49 A;  2EA6 A;  4R8P K;  4FK5 A;  5I3L A;  4XI1 A;  3DPL R;  2MD7 B;  5AIU A;  2DSM A;  2L75 A;  4I7D A;  1BOR A;  2Y43 A;  4V3K C;  4YAT A;  1Z2Q A;  2MIQ A;  1WIM A;  3U5P A;  4AUQ B;  4ZQL A;  3C6W A;  4L58 A;  4CA1 A;  3LVR E;  3SHB A;  1DCQ A;  2D8U A;  3KDE C;  2M1R A;  2KIZ A;  1VYX A;  3T7L A;  2XOY A;  3FAN A;  4YBM A;  2VPB A;  2LV9 A;  2L43 A;  3LQI A;  4PTB A;  1X4U A;  3FL2 A;  2MNY A;  4WZ0 A;  2XB1 A;  1WEN A;  4L7X A;  4WZ3 B;  4LAD B;  2D8S A;  3V43 A;  3N9Q A;  3O47 A;  4F52 B;  2FUU A;  2H0D A;  2EXU A;  2LGK A;  4AYC B;  2M13 A;  2XP0 A;  1N87 A;  4QF2 A;  4QQ4 A;  4YBS A;  5TAB A;  4OGC A;  5H1U A;  3SUB A;  2ECN A;  2JUN A;  3LRQ A;  3H7H A;  2RR4 A;  2KKX A;  4A4C A;  3GV4 A;  4MVT A;  3O34 A;  2UZG A;  1V87 A;  3DQV R;  2FUI A;  1WEE A;  3O7A A;  5D1L B;  3EB5 A;  2YHN A;  2IQJ A;  2ECV A;  2L5U A;  3KQI A;  4A4B A;  1T1H A;  3PHD A;  3EB6 A;  4Z0O A;  4N4F A;  1FP0 A;  3ZVZ B;  2K16 A;  3PLW A;  3O35 A;  2FD4 A;  2YUR A;  5B75 A;  2JMD A;  2BAY A;  2LDR A;  4LJN A;  3PUR A;  4S3O C;  2Y1N A;  3ZNI A;  4CCG X;  2F6J A;  1Z6U A;  4I7B A;  5DKA A;  3MHS A;  3SOW A;  4A0C D;  5J3X A;  3U5M A;  2XOZ A;  1WGM A;  2CRR A;  2KWK A;  4GND A;  5AIT A;  2LXP C;  3SOX A;  5G04 B;  4R7E A;  4LKA A;  3SOU A;  1U6G B;  2L7P A;  2L80 A;  3FM8 C;  2YW8 A;  2ECI A;  2KWJ A;  2MUM A;  5D1M B;  2OWA A;  4YBT A;  5FB1 A;  2KU3 A;  2YSM A;  5TRB A;  1CHC A;  2YU4 A;  3T6R A;  5KH9 A;  2CSY A;  4N3W A;  4BHW A;  3L11 A;  5B8D A;  3M63 A;  3N9L A;  3N9N A;  1WEV A;  1WEP A;  4O62 A;  1JM7 A;  2QIZ A;  5FB0 A;  2YUC A;  3PUQ A;  4MSX A;  2CRW A;  2H0D B;  2LQ6 A;  2QJ0 A;  2XEU A;  1MM3 A;  5EYA F;  2VJE B;  2ECT A;  2LAU A;  2YYR A;  3U5N A;  4LLB A;  5LKZ A;  2E6R A;  3HCT A;  3O37 A;  4GNG A;  3QZV A;  2YHO A;  2EGM A;  4C9Z A;  5H9M A;  2KWN A;  5D1K B;  5DIN A;  3ZTG A;  2RI7 A;  2M85 A;  5SVY A;  3U5O A;  1LDJ B;  2IDA A;  4YAB A;  3LDY A;  2XOC A;  2VJF B;  4B7Y C;  2LGG A;  2E6S A;  3KV6 A;  2JM3 A;  4W4U A;  2YT5 A;  3MDB C;  2G43 A;  2MKE A;  4UP0 A;  3M62 A;  4UI9 B;  1WEU A;  2K1J A;  5B79 A;  3ASL A;  3DWD A;  4B86 C;  3RPG C;  2VPD A;  4TKP B;  1G25 A;  4Q6F A;  1VD4 A;  3KV5 A;  2FFW A;  2CKL A;  2CSV A;  2MNZ A;  2KRE A;  1FBV A;  3O36 A;  5SVI A;  4O64 A;  4GNF A;  2HYE D;  2YVR A;  1XWH A;  3LVQ E;  2LXH C;  2M3H A;  2EGP A;  3HTK C;  2CSZ A;  4YAX A;  1F62 A;  2F42 A;  3LQH A;  4UP5 A;  5LCW B;  2C2V S;  4X3G A;  4GNE A;  3DDT A;  2ECG A;  2KYU A;  4H9D A;  4FIP A;  5B77 A;  2KWO A;  3FAO A;  4F1P A;  2JMJ A;  2NAA A;  5TDW A;  1LDK C;  5B78 A;  5H1T A;  2DJA A;  5H1V A;  3VK6 A;  2P57 A;  1WES A;  3L1X A;  5KH7 A;  3KNV A;  5FEY A;  5K3Q A;  5SVX A;  2M6M A;  3O33 A;  4FO9 A;  3FEH A;  2LGL A;  2HDP A;  2JRJ A;  5LKU A;  4QF3 A;  2VPE A;  4WZ2 A;  2AN6 A;  2KGG A;  2I50 A;  2EOD A;  5G0F A;  1HYI A;  2QIC A;  1IYM A;  4PPE A;  2FSA A;  3L1Z B;  2ECW A;  1WE9 A;  2CT2 A;  4LK9 A;  2K17 A;  4S3O B;  4R2Y A;  2KGI A;  2VP7 A;  3ZPV 1;  4ZDT A;  2OXQ C;  3HCU A;  4GB0 A;  3I2D A;  3HCS A;  3JUE A;  2KFT A;  2E61 A;  2F6N A;  2K4D A;  4Z0R A;  1WEM A;  1ZBD B;  2G6Q A;  2LN0 A;  3Q1D A;  3C5K A; 
#chains in the Genus database with same CATH homology
 1RMD A;  2PNX A;  4YAD A;  2LGV A;  3ZVY A;  5C11 A;  4I7C A;  1E4U A;  3IHP A;  5JG6 A;  4ZUX U;  4P5O B;  2VJE A;  2Y1M A;  3N9O A;  2L0B A;  3RTR B;  3M99 A;  4FJC A;  2MT5 A;  3ZYQ A;  3N9M A;  1WIL A;  2MA5 A;  4AYC A;  2KR4 A;  2MD8 C;  2YRE A;  5B76 A;  2CKL B;  2YSJ A;  4NN2 A;  2MA6 A;  2ZET C;  2KE1 A;  4BBQ A;  2VNF A;  2VJF A;  1JOC A;  1MM2 A;  5LKT A;  2RSD A;  2DX8 A;  3GL6 A;  3LQJ A;  5LKX A;  2ECJ A;  1K2F A;  2JMI A;  3MHH A;  2YQM A;  5TDR A;  2C2L A;  1WFK A;  2PUY A;  1DVP A;  5FER A;  3N9P A;  1X4J A;  1WEO A;  3O70 A;  2YQL A;  3ZPV E;  5TBN A;  4YC9 A;  3RPG B;  4WA6 A;  1HYJ A;  4IC2 A;  2G45 A;  4AVX A;  1WEW A;  1WEQ A;  1VFY A;  2VPG A;  5KH3 A;  4AP4 A;  2LRI C;  1JM7 B;  3NG2 A;  5G05 B;  4IC3 A;  4V3L C;  5C13 A;  1X4I A;  1Z60 A;  4A49 A;  2EA6 A;  4R8P K;  4FK5 A;  5I3L A;  4XI1 A;  3DPL R;  2MD7 B;  5AIU A;  2L75 A;  4I7D A;  1BOR A;  2Y43 A;  4V3K C;  4YAT A;  1Z2Q A;  2MIQ A;  1WIM A;  3U5P A;  4AUQ B;  4ZQL A;  3C6W A;  4L58 A;  4CA1 A;  3SHB A;  2M1R A;  2KIZ A;  1VYX A;  3T7L A;  4YBM A;  2VPB A;  2LV9 A;  2L43 A;  3LQI A;  4PTB A;  1X4U A;  3FL2 A;  2MNY A;  4WZ0 A;  2XB1 A;  1WEN A;  4L7X A;  4WZ3 B;  4LAD B;  2D8S A;  3V43 A;  3N9Q A;  4F52 B;  2FUU A;  2H0D A;  2LGK A;  4AYC B;  1N87 A;  4QF2 A;  4YBS A;  5TAB A;  5H1U A;  2ECN A;  3LRQ A;  4A4C A;  3GV4 A;  4MVT A;  3O34 A;  2UZG A;  1V87 A;  3DQV R;  2FUI A;  1WEE A;  3O7A A;  5D1L B;  3EB5 A;  2YHN A;  2ECV A;  2L5U A;  3KQI A;  4A4B A;  1T1H A;  3PHD A;  3EB6 A;  4N4F A;  1FP0 A;  3ZVZ B;  2K16 A;  3O35 A;  2YUR A;  5B75 A;  2JMD A;  2BAY A;  2LDR A;  4LJN A;  3PUR A;  4S3O C;  2Y1N A;  3ZNI A;  4CCG X;  2F6J A;  1Z6U A;  4I7B A;  5DKA A;  3MHS A;  3SOW A;  4A0C D;  5J3X A;  3U5M A;  1WGM A;  2KWK A;  4GND A;  5AIT A;  2LXP C;  3SOX A;  5G04 B;  4R7E A;  4LKA A;  3SOU A;  1U6G B;  2L80 A;  2YW8 A;  2ECI A;  2KWJ A;  2MUM A;  5D1M B;  4YBT A;  5FB1 A;  2KU3 A;  2YSM A;  5TRB A;  1CHC A;  2YU4 A;  3T6R A;  5KH9 A;  2CSY A;  4N3W A;  4BHW A;  3L11 A;  5B8D A;  3M63 A;  3N9L A;  3N9N A;  1WEV A;  1WEP A;  1JM7 A;  2QIZ A;  5FB0 A;  2YUC A;  3PUQ A;  4MSX A;  2H0D B;  2LQ6 A;  2QJ0 A;  2XEU A;  1MM3 A;  5EYA F;  2VJE B;  2ECT A;  2YYR A;  3U5N A;  4LLB A;  5LKZ A;  2E6R A;  3HCT A;  3O37 A;  4GNG A;  3QZV A;  2YHO A;  4C9Z A;  5H9M A;  2KWN A;  5D1K B;  5DIN A;  3ZTG A;  2RI7 A;  2M85 A;  3U5O A;  1LDJ B;  2IDA A;  4YAB A;  2VJF B;  4B7Y C;  2LGG A;  2E6S A;  3KV6 A;  4W4U A;  2YT5 A;  2G43 A;  4UP0 A;  3M62 A;  4UI9 B;  1WEU A;  2K1J A;  5B79 A;  3ASL A;  4B86 C;  1G25 A;  3RPG C;  2VPD A;  4TKP B;  4Q6F A;  1VD4 A;  3KV5 A;  2CKL A;  2MNZ A;  2KRE A;  1FBV A;  3O36 A;  4O64 A;  4GNF A;  2HYE D;  1XWH A;  2LXH C;  2M3H A;  2EGP A;  3HTK C;  2CSZ A;  4YAX A;  1F62 A;  2F42 A;  3LQH A;  4UP5 A;  5LCW B;  2C2V S;  4X3G A;  4GNE A;  2ECG A;  2KYU A;  4FIP A;  5B77 A;  2KWO A;  2JMJ A;  2NAA A;  5TDW A;  1LDK C;  5B78 A;  5H1T A;  5H1V A;  3VK6 A;  1WES A;  3L1X A;  5KH7 A;  3KNV A;  5FEY A;  2M6M A;  3O33 A;  4FO9 A;  2LGL A;  2HDP A;  2JRJ A;  5LKU A;  4QF3 A;  2VPE A;  4WZ2 A;  2AN6 A;  2KGG A;  2I50 A;  2EOD A;  5G0F A;  1HYI A;  2QIC A;  1IYM A;  4PPE A;  2FSA A;  3L1Z B;  2ECW A;  1WE9 A;  2CT2 A;  4LK9 A;  2K17 A;  4S3O B;  4R2Y A;  2KGI A;  2VP7 A;  3ZPV 1;  4ZDT A;  2OXQ C;  3HCU A;  4GB0 A;  3I2D A;  3HCS A;  2KFT A;  2F6N A;  2K4D A;  1WEM A;  1ZBD B;  2G6Q A;  2LN0 A;  3C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...