4Q6FA

Crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
SVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
total genus 9
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4q6fA00
4YBSA 2HYED 5TDWA 3ZVZB 2K17A 4X3GA 2VJFB 3O35A 1Z60A 4AYCB 2KREA 2VP7A 3IHPA 2C2LA 2K16A 5FERA 1JOCA 2OXQC 1Z6UA 2H0DB 5KH9A 4YBMA 2AN6A 1LDJB 1WE9A 5TDRA 2YREA 1WEVA 3LQHA 3GV4A 3O7AA 3HCUA 4P5OB 1E4UA 3HCSA 5AITA 3QZVA 2MA5A 2LRIC 1WEPA 3O36A 5LKZA 5FB1A 1ZBDB 4F52B 3HCTA 2DX8A 3O33A 2ECIA 4UP5A 2Y1NA 4LKAA 4R7EA 2YHNA 4ZQLA 5D1MB 4CA1A 3U5NA 5B76A 1VFYA 3PUQA 1WEQA 3KQIA 1Z2QA 3ZPV1 4R8PK 3ZVYA 2ECGA 3O70A 4YBTA 3SOUA 1JM7A 4B7YC 5DINA 3L1ZB 3I2DA 4WZ2A 2CT2A 2KR4A 1FP0A 2YSMA 2KWOA 4FO9A 3L1XA 3N9QA 2MUMA 5B79A 2L43A 2MIQA 1HYJA 3LRQA 4V3LC 5B78A 3FL2A 2L75A 4LLBA 2LXHC 2RI7A 3KV5A 2EODA 1DVPA 5H1VA 4FIPA 4QF3A 2JMJA 3EB6A 4LK9A 4ZDTA 2PUYA 1WENA 2VPBA 3ZNIA 2YW8A 2CKLA 4L58A 3NG2A 2E6RA 5DKAA 2ECJA 1WEWA 4I7DA 3U5PA 5EYAF 4GNEA 2M3HA 4N4FA 5C11A 5LKXA 2KE1A 4AP4A 4AVXA 3LQJA 4PPEA 2MNYA 2PNXA 2KGGA 4WA6A 2M6MA 2NAAA 3SHBA 2VJEA 5G05B 2YHOA 2YT5A 2CKLB 3N9LA 2KFTA 2YU4A 1CHCA 1WEMA 5AIUA 5H1UA 2HDPA 1F62A 4V3KC 2VNFA 2L80A 3ZPVE 4AUQB 1K2FA 2LQ6A 3N9MA 1X4IA 2YQLA 3M62A 2C2VS 5B8DA 1U6GB 4S3OB 2XEUA 1JM7B 1BORA 4GB0A 5LKUA 1WILA 2F42A 1LDKC 2ECVA 2YURA 2M1RA 4ZUXU 1WEUA 5D1LB 2K4DA 4WZ3B 5KH7A 3U5MA 3DQVR 4FJCA 5C13A 2KU3A 3N9OA 4XI1A 2QICA 4QF2A 4YABA 3MHSA 1RMDA 5LKTA 2VJFA 2IDAA 1T1HA 1WEEA 2FUUA 4YATA 5D1KB 2JMDA 3KNVA 2ECTA 4MVTA 3N9NA 3PHDA 4A0CD 2EA6A 5TABA 3M63A 1VD4A 1WFKA 4W4UA 2MD7B 3MHHA 5J3XA 3V43A 4LADB 2ECWA 5H9MA 5TBNA 3ZTGA 2LGKA 1WEOA 1X4UA 2YUCA 4YADA 4A4CA 4C9ZA 2YSJA 4I7CA 5TRBA 4IC2A 2KWJA 4I7BA 2LN0A 4UP0A 3RPGC 2I50A 5G04B 4PTBA 5G0FA 2MT5A 2XB1A 2JRJA 3U5OA 4YAXA 2MNZA 3M99A 2RSDA 3GL6A 2L0BA 4GNFA 2Y1MA 2LGVA 3PURA 1XWHA 5FB0A 3L11A 4BHWA 3C6WA 2Y43A 3EB5A 4Q6FA 2MD8C 1X4JA 2QIZA 4L7XA 2BAYA 2MA6A 2KWNA 4A4BA 3O34A 3O37A 2LGGA 2L5UA 2EGPA 5B77A 1MM2A 2CSZA 2VPEA 2ECNA 2F6NA 2YQMA 3KV6A 2LV9A 1WESA 4AYCA 4IC3A 2K1JA 2E6SA 2LDRA 4CCGX 5FEYA 2QJ0A 4S3OC 5LCWB 2YYRA 4B86C 4O64A 1VYXA 2KIZA 2VJEB 2G6QA 2F6JA 4N3WA 4A49A 3ASLA 2FSAA 4R2YA 4BBQA 4MSXA 3T6RA 4FK5A 5B75A 3RTRB 2FUIA 3ZYQA 2KYUA 5KH3A 4YC9A 2VPGA 5H1TA 3C5KA 4GNDA 2KGIA 2KWKA 2M85A 2VPDA 1MM3A 3DPLR 1N87A 5I3LA 1V87A 1FBVA 4NN2A 4UI9B 1WGMA 3RPGB 1HYIA 3SOWA 3HTKC 2LXPC 2LGLA 2H0DA 4GNGA 2UZGA 2G45A 4WZ0A 1IYMA 4LJNA 3N9PA 1WIMA 3T7LA 5JG6A 3SOXA 2JMIA 2ZETC 3VK6A 2CSYA 2G43A 2D8SA 4TKPB 1G25A 3LQIA
chains in the Genus database with same CATH superfamily
5SVXA 4YBSA 2HYED 5TDWA 3ZVZB 2K17A 4X3GA 2VJFB 2XOZA 3O35A 1Z60A 4AYCB 2KREA 2VP7A 3IHPA 2C2LA 2K16A 5FERA 1JOCA 2OXQC 1Z6UA 2H0DB 5KH9A 4YBMA 2AN6A 1LDJB 2FD4A 1WE9A 3LVQE 5TDRA 2YREA 1WEVA 3LQHA 3GV4A 2LAUA 3DWDA 3O7AA 3HCUA 4P5OB 1E4UA 3HCSA 2CRRA 5AITA 3QZVA 2EGMA 2MA5A 2LRIC 1WEPA 3O36A 5LKZA 5FB1A 1ZBDB 4F52B 3HCTA 2DX8A 3O33A 2ECIA 4UP5A 5SVYA 3O47A 2Y1NA 3Q1DA 4LKAA 4R7EA 2YHNA 4ZQLA 3SUBA 5D1MB 2IQJA 4CA1A 3U5NA 5SVIB 5B76A 1VFYA 3PUQA 1WEQA 3KQIA 1Z2QA 3ZPV1 4R8PK 3ZVYA 4OGEA 2ECGA 3O70A 4YBTA 3FANA 3SOUA 1JM7A 4B7YC 5DINA 3L1ZB 3I2DA 4WZ2A 2CT2A 2KR4A 1FP0A 2YSMA 2KWOA 4Z0RA 4FO9A 3L1XA 3N9QA 2MUMA 5B79A 2L43A 2MIQA 1HYJA 3LRQA 4V3LC 4Z0OA 5B78A 3FL2A 2L75A 4LLBA 2LXHC 2RI7A 3KV5A 2EODA 1DVPA 5H1VA 4FIPA 4QF3A 2JMJA 3EB6A 4LK9A 4ZDTA 2XP0A 2PUYA 1WENA 2VPBA 3ZNIA 2YW8A 2CKLA 4L58A 3NG2A 2E6RA 5DKAA 2ECJA 1WEWA 4I7DA 3U5PA 5EYAF 4GNEA 2M3HA 4N4FA 2CSVA 5C11A 5LKXA 2KE1A 4AP4A 4AVXA 3DDTA 3LQJA 4PPEA 2MNYA 2PNXA 2KGGA 2M13A 4WA6A 2M6MA 2E61A 2NAAA 3SHBA 2VJEA 5G05B 2YHOA 2YT5A 2P57A 2CKLB 3N9LA 2KFTA 2YU4A 1CHCA 2RR4A 1WEMA 2D8UA 5AIUA 5H1UA 2HDPA 1F62A 4V3KC 2VNFA 2L80A 3T9KA 3ZPVE 2DSMA 3LJUX 4AUQB 1K2FA 2LQ6A 3N9MA 1X4IA 2YQLA 3M62A 2C2VS 5B8DA 1U6GB 4S3OB 2XEUA 1JM7B 1BORA 4GB0A 5LKUA 2JM3A 1WILA 2F42A 1LDKC 2ECVA 2YURA 2M1RA 4ZUXU 1WEUA 5D1LB 2K4DA 4WZ3B 5KH7A 3U5MA 3DQVR 2FFWA 4FJCA 5C13A 2KU3A 3N9OA 3PLWA 2QICA 4XI1A 4QF2A 4YABA 3E2DA 3MHSA 1RMDA 2OWAA 5LKTA 2VJFA 2IDAA 1T1HA 1WEEA 2FUUA 5D1KB 4YATA 2JMDA 2YVRA 3KNVA 2ECTA 2B0OE 4MVTA 3N9NA 3PHDA 4A0CD 2EA6A 5TABA 3M63A 3M7KA 1VD4A 1WFKA 4W4UA 2MD7B 3MHHA 5J3XA 3V43A 4LADB 2ECWA 5H9MA 5TBNA 3ZTGA 2LGKA 1WEOA 1X4UA 2YUCA 4YADA 4A4CA 4C9ZA 2YSJA 4I7CA 5TRBA 4IC2A 2KWJA 4I7BA 2LN0A 4UP0A 3RPGC 2I50A 5G04B 4PTBA 5G0FA 4OGCA 2XOYA 2MT5A 3FM8C 2XB1A 1MBMA 2JRJA 3U5OA 4YAXA 2MNZA 3M99A 2RSDA 3FJUB 3GL6A 2L0BA 4GNFA 2Y1MA 2LGVA 3PURA 1XWHA 5FB0A 3L11A 4BHWA 3C6WA 2Y43A 3EB5A 4Q6FA 2MD8C 1X4JA 2QIZA 4L7XA 2BAYA 2MA6A 2KWNA 2MKEA 4A4BA 2CRWA 3O34A 1DCQA 2KKXA 3O37A 2LGGA 3LDYA 2L5UA 2EGPA 5B77A 1MM2A 2DJAA 2CSZA 2L7PA 2VPEA 2ECNA 2F6NA 2YQMA 3KDEC 3KV6A 2LV9A 1WESA 4AYCA 4IC3A 4O62A 2K1JA 2E6SA 2LDRA 4CCGX 5FEYA 2QJ0A 4S3OC 5LCWB 2YYRA 4B86C 4O64A 1VYXA 2KIZA 2VJEB 2JUNA 2G6QA 2F6JA 4N3WA 4A49A 2KKYA 3ASLA 2FSAA 4R2YA 4BBQA 4MSXA 5SVIA 3T6RA 4FK5A 5B75A 4H9DA 3RTRB 2FUIA 3FEHA 3ZYQA 2KYUA 5KH3A 4YC9A 2VPGA 5H1TA 4F1PA 3MDBC 3C5KA 4GNDA 2CONA 2XOCA 3JUEA 2KGIA 2EXUA 2KWKA 2M85A 3FAOA 2VPDA 1MM3A 3DPLR 1N87A 5I3LA 1V87A 1FBVA 4QQ4A 3LVRE 4NN2A 4UI9B 1WGMA 3RPGB 1HYIA 3SOWA 3HTKC 2LXPC 2LGLA 2H0DA 4GNGA 2UZGA 2G45A 3H7HA 4WZ0A 1IYMA 5K3QA 4LJNA 3N9PA 1WIMA 3T7LA 5JG6A 3SOXA 2JMIA 2ZETC 3VK6A 2CSYA 2G43A 2D8SA 4TKPB 1G25A 3LQIA
chains in the Genus database with same CATH topology
4YBSA 2HYED 5TDWA 3ZVZB 2K17A 4X3GA 2VJFB 3O35A 1Z60A 4AYCB 2KREA 2VP7A 3IHPA 2C2LA 2K16A 5FERA 1JOCA 2OXQC 1Z6UA 2H0DB 5KH9A 4YBMA 2AN6A 1LDJB 1WE9A 5TDRA 2YREA 1WEVA 3LQHA 3GV4A 3O7AA 3HCUA 4P5OB 1E4UA 3HCSA 5AITA 3QZVA 2MA5A 2LRIC 1WEPA 3O36A 5LKZA 5FB1A 1ZBDB 4F52B 3HCTA 2DX8A 3O33A 2ECIA 4UP5A 2Y1NA 4LKAA 4R7EA 2YHNA 4ZQLA 5D1MB 4CA1A 3U5NA 5B76A 1VFYA 3PUQA 1WEQA 3KQIA 1Z2QA 3ZPV1 4R8PK 3ZVYA 2ECGA 3O70A 4YBTA 3SOUA 1JM7A 4B7YC 5DINA 3L1ZB 3I2DA 4WZ2A 2CT2A 2KR4A 1FP0A 2YSMA 2KWOA 4FO9A 3L1XA 3N9QA 2MUMA 5B79A 2L43A 2MIQA 1HYJA 3LRQA 4V3LC 5B78A 3FL2A 2L75A 4LLBA 2LXHC 2RI7A 3KV5A 2EODA 1DVPA 5H1VA 4FIPA 4QF3A 2JMJA 3EB6A 4LK9A 4ZDTA 2PUYA 1WENA 2VPBA 3ZNIA 2YW8A 2CKLA 4L58A 3NG2A 2E6RA 5DKAA 2ECJA 1WEWA 4I7DA 3U5PA 5EYAF 4GNEA 2M3HA 4N4FA 5C11A 5LKXA 2KE1A 4AP4A 4AVXA 3LQJA 4PPEA 2MNYA 2PNXA 2KGGA 4WA6A 2M6MA 2NAAA 3SHBA 2VJEA 5G05B 2YHOA 2YT5A 2CKLB 3N9LA 2KFTA 2YU4A 1CHCA 1WEMA 5AIUA 5H1UA 2HDPA 1F62A 4V3KC 2VNFA 2L80A 3ZPVE 4AUQB 1K2FA 2LQ6A 3N9MA 1X4IA 2YQLA 3M62A 2C2VS 5B8DA 1U6GB 4S3OB 2XEUA 1JM7B 1BORA 4GB0A 5LKUA 1WILA 2F42A 1LDKC 2ECVA 2YURA 2M1RA 4ZUXU 1WEUA 5D1LB 2K4DA 4WZ3B 5KH7A 3U5MA 3DQVR 4FJCA 5C13A 2KU3A 3N9OA 4XI1A 2QICA 4QF2A 4YABA 3MHSA 1RMDA 5LKTA 2VJFA 2IDAA 1T1HA 1WEEA 2FUUA 4YATA 5D1KB 2JMDA 3KNVA 2ECTA 4MVTA 3N9NA 3PHDA 4A0CD 2EA6A 5TABA 3M63A 1VD4A 1WFKA 4W4UA 2MD7B 3MHHA 5J3XA 3V43A 4LADB 2ECWA 5H9MA 5TBNA 3ZTGA 2LGKA 1WEOA 1X4UA 2YUCA 4YADA 4A4CA 4C9ZA 2YSJA 4I7CA 5TRBA 4IC2A 2KWJA 4I7BA 2LN0A 4UP0A 3RPGC 2I50A 5G04B 4PTBA 5G0FA 2MT5A 2XB1A 2JRJA 3U5OA 4YAXA 2MNZA 3M99A 2RSDA 3GL6A 2L0BA 4GNFA 2Y1MA 2LGVA 3PURA 1XWHA 5FB0A 3L11A 4BHWA 3C6WA 2Y43A 3EB5A 4Q6FA 2MD8C 1X4JA 2QIZA 4L7XA 2BAYA 2MA6A 2KWNA 4A4BA 3O34A 3O37A 2LGGA 2L5UA 2EGPA 5B77A 1MM2A 2CSZA 2VPEA 2ECNA 2F6NA 2YQMA 3KV6A 2LV9A 1WESA 4AYCA 4IC3A 2K1JA 2E6SA 2LDRA 4CCGX 5FEYA 2QJ0A 4S3OC 5LCWB 2YYRA 4B86C 4O64A 1VYXA 2KIZA 2VJEB 2G6QA 2F6JA 4N3WA 4A49A 3ASLA 2FSAA 4R2YA 4BBQA 4MSXA 3T6RA 4FK5A 5B75A 3RTRB 2FUIA 3ZYQA 2KYUA 5KH3A 4YC9A 2VPGA 5H1TA 3C5KA 4GNDA 2KGIA 2KWKA 2M85A 2VPDA 1MM3A 3DPLR 1N87A 5I3LA 1V87A 1FBVA 4NN2A 4UI9B 1WGMA 3RPGB 1HYIA 3SOWA 3HTKC 2LXPC 2LGLA 2H0DA 4GNGA 2UZGA 2G45A 4WZ0A 1IYMA 4LJNA 3N9PA 1WIMA 3T7LA 5JG6A 3SOXA 2JMIA 2ZETC 3VK6A 2CSYA 2G43A 2D8SA 4TKPB 1G25A 3LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBS A;  2HYE D;  5TDW A;  3ZVZ B;  2K17 A;  4X3G A;  2VJF B;  3O35 A;  1Z60 A;  4AYC B;  2KRE A;  2VP7 A;  3IHP A;  2C2L A;  2K16 A;  5FER A;  1JOC A;  2OXQ C;  1Z6U A;  2H0D B;  5KH9 A;  4YBM A;  2AN6 A;  1LDJ B;  1WE9 A;  5TDR A;  2YRE A;  1WEV A;  3LQH A;  3GV4 A;  3O7A A;  3HCU A;  4P5O B;  1E4U A;  3HCS A;  5AIT A;  3QZV A;  2MA5 A;  2LRI C;  1WEP A;  3O36 A;  5LKZ A;  5FB1 A;  1ZBD B;  4F52 B;  3HCT A;  2DX8 A;  3O33 A;  2ECI A;  4UP5 A;  2Y1N A;  4LKA A;  4R7E A;  2YHN A;  4ZQL A;  5D1M B;  4CA1 A;  3U5N A;  5B76 A;  1VFY A;  3PUQ A;  1WEQ A;  3KQI A;  1Z2Q A;  3ZPV 1;  4R8P K;  3ZVY A;  2ECG A;  3O70 A;  4YBT A;  3SOU A;  1JM7 A;  4B7Y C;  5DIN A;  3L1Z B;  3I2D A;  4WZ2 A;  2CT2 A;  2KR4 A;  1FP0 A;  2YSM A;  2KWO A;  4FO9 A;  3L1X A;  3N9Q A;  2MUM A;  5B79 A;  2L43 A;  2MIQ A;  1HYJ A;  3LRQ A;  4V3L C;  5B78 A;  3FL2 A;  2L75 A;  4LLB A;  2LXH C;  2RI7 A;  3KV5 A;  2EOD A;  1DVP A;  5H1V A;  4FIP A;  4QF3 A;  2JMJ A;  3EB6 A;  4LK9 A;  4ZDT A;  2PUY A;  1WEN A;  2VPB A;  3ZNI A;  2YW8 A;  2CKL A;  4L58 A;  3NG2 A;  2E6R A;  5DKA A;  2ECJ A;  1WEW A;  4I7D A;  3U5P A;  5EYA F;  4GNE A;  2M3H A;  4N4F A;  5C11 A;  5LKX A;  2KE1 A;  4AP4 A;  4AVX A;  3LQJ A;  4PPE A;  2MNY A;  2PNX A;  2KGG A;  4WA6 A;  2M6M A;  2NAA A;  3SHB A;  2VJE A;  5G05 B;  2YHO A;  2YT5 A;  2CKL B;  3N9L A;  2KFT A;  2YU4 A;  1CHC A;  1WEM A;  5AIU A;  5H1U A;  2HDP A;  1F62 A;  4V3K C;  2VNF A;  2L80 A;  3ZPV E;  4AUQ B;  1K2F A;  2LQ6 A;  3N9M A;  1X4I A;  2YQL A;  3M62 A;  2C2V S;  5B8D A;  1U6G B;  4S3O B;  2XEU A;  1JM7 B;  1BOR A;  4GB0 A;  5LKU A;  1WIL A;  2F42 A;  1LDK C;  2ECV A;  2YUR A;  2M1R A;  4ZUX U;  1WEU A;  5D1L B;  2K4D A;  4WZ3 B;  5KH7 A;  3U5M A;  3DQV R;  4FJC A;  5C13 A;  2KU3 A;  3N9O A;  4XI1 A;  2QIC A;  4QF2 A;  4YAB A;  3MHS A;  1RMD A;  5LKT A;  2VJF A;  2IDA A;  1T1H A;  1WEE A;  2FUU A;  4YAT A;  5D1K B;  2JMD A;  3KNV A;  2ECT A;  4MVT A;  3N9N A;  3PHD A;  4A0C D;  2EA6 A;  5TAB A;  3M63 A;  1VD4 A;  1WFK A;  4W4U A;  2MD7 B;  3MHH A;  5J3X A;  3V43 A;  4LAD B;  2ECW A;  5H9M A;  5TBN A;  3ZTG A;  2LGK A;  1WEO A;  1X4U A;  2YUC A;  4YAD A;  4A4C A;  4C9Z A;  2YSJ A;  4I7C A;  5TRB A;  4IC2 A;  2KWJ A;  4I7B A;  2LN0 A;  4UP0 A;  3RPG C;  2I50 A;  5G04 B;  4PTB A;  5G0F A;  2MT5 A;  2XB1 A;  2JRJ A;  3U5O A;  4YAX A;  2MNZ A;  3M99 A;  2RSD A;  3GL6 A;  2L0B A;  4GNF A;  2Y1M A;  2LGV A;  3PUR A;  1XWH A;  5FB0 A;  3L11 A;  4BHW A;  3C6W A;  2Y43 A;  3EB5 A;  4Q6F A;  2MD8 C;  1X4J A;  2QIZ A;  4L7X A;  2BAY A;  2MA6 A;  2KWN A;  4A4B A;  3O34 A;  3O37 A;  2LGG A;  2L5U A;  2EGP A;  5B77 A;  1MM2 A;  2CSZ A;  2VPE A;  2ECN A;  2F6N A;  2YQM A;  3KV6 A;  2LV9 A;  1WES A;  4AYC A;  4IC3 A;  2K1J A;  2E6S A;  2LDR A;  4CCG X;  5FEY A;  2QJ0 A;  4S3O C;  5LCW B;  2YYR A;  4B86 C;  4O64 A;  1VYX A;  2KIZ A;  2VJE B;  2G6Q A;  2F6J A;  4N3W A;  4A49 A;  3ASL A;  2FSA A;  4R2Y A;  4BBQ A;  4MSX A;  3T6R A;  4FK5 A;  5B75 A;  3RTR B;  2FUI A;  3ZYQ A;  2KYU A;  5KH3 A;  4YC9 A;  2VPG A;  5H1T A;  3C5K A;  4GND A;  2KGI A;  2KWK A;  2M85 A;  2VPD A;  1MM3 A;  3DPL R;  1N87 A;  5I3L A;  1V87 A;  1FBV A;  4NN2 A;  4UI9 B;  1WGM A;  3RPG B;  1HYI A;  3SOW A;  3HTK C;  2LXP C;  2LGL A;  2H0D A;  4GNG A;  2UZG A;  2G45 A;  4WZ0 A;  1IYM A;  4LJN A;  3N9P A;  1WIM A;  3T7L A;  5JG6 A;  3SOX A;  2JMI A;  2ZET C;  3VK6 A;  2CSY A;  2G43 A;  2D8S A;  4TKP B;  1G25 A;  3LQI A; 
#chains in the Genus database with same CATH topology
 5SVX A;  4YBS A;  2HYE D;  5TDW A;  3ZVZ B;  2K17 A;  4X3G A;  2VJF B;  2XOZ A;  3O35 A;  1Z60 A;  4AYC B;  2KRE A;  2VP7 A;  3IHP A;  2C2L A;  2K16 A;  5FER A;  1JOC A;  2OXQ C;  1Z6U A;  2H0D B;  5KH9 A;  4YBM A;  2AN6 A;  1LDJ B;  2FD4 A;  1WE9 A;  3LVQ E;  5TDR A;  2YRE A;  1WEV A;  3LQH A;  3GV4 A;  2LAU A;  3DWD A;  3O7A A;  3HCU A;  4P5O B;  1E4U A;  3HCS A;  2CRR A;  5AIT A;  3QZV A;  2EGM A;  2MA5 A;  2LRI C;  1WEP A;  3O36 A;  5LKZ A;  5FB1 A;  1ZBD B;  4F52 B;  3HCT A;  2DX8 A;  3O33 A;  2ECI A;  4UP5 A;  5SVY A;  3O47 A;  2Y1N A;  3Q1D A;  4LKA A;  4R7E A;  2YHN A;  4ZQL A;  3SUB A;  5D1M B;  2IQJ A;  4CA1 A;  3U5N A;  5SVI B;  5B76 A;  1VFY A;  3PUQ A;  1WEQ A;  3KQI A;  1Z2Q A;  3ZPV 1;  4R8P K;  3ZVY A;  4OGE A;  2ECG A;  3O70 A;  4YBT A;  3FAN A;  3SOU A;  1JM7 A;  4B7Y C;  5DIN A;  3L1Z B;  3I2D A;  4WZ2 A;  2CT2 A;  2KR4 A;  1FP0 A;  2YSM A;  2KWO A;  4Z0R A;  4FO9 A;  3L1X A;  3N9Q A;  2MUM A;  5B79 A;  2L43 A;  2MIQ A;  1HYJ A;  3LRQ A;  4V3L C;  4Z0O A;  5B78 A;  3FL2 A;  2L75 A;  4LLB A;  2LXH C;  2RI7 A;  3KV5 A;  2EOD A;  1DVP A;  5H1V A;  4FIP A;  4QF3 A;  2JMJ A;  3EB6 A;  4LK9 A;  4ZDT A;  2XP0 A;  2PUY A;  1WEN A;  2VPB A;  3ZNI A;  2YW8 A;  2CKL A;  4L58 A;  3NG2 A;  2E6R A;  5DKA A;  2ECJ A;  1WEW A;  4I7D A;  3U5P A;  5EYA F;  4GNE A;  2M3H A;  4N4F A;  2CSV A;  5C11 A;  5LKX A;  2KE1 A;  4AP4 A;  4AVX A;  3DDT A;  3LQJ A;  4PPE A;  2MNY A;  2PNX A;  2KGG A;  2M13 A;  4WA6 A;  2M6M A;  2E61 A;  2NAA A;  3SHB A;  2VJE A;  5G05 B;  2YHO A;  2YT5 A;  2P57 A;  2CKL B;  3N9L A;  2KFT A;  2YU4 A;  1CHC A;  2RR4 A;  1WEM A;  2D8U A;  5AIU A;  5H1U A;  2HDP A;  1F62 A;  4V3K C;  2VNF A;  2L80 A;  3T9K A;  3ZPV E;  2DSM A;  3LJU X;  4AUQ B;  1K2F A;  2LQ6 A;  3N9M A;  1X4I A;  2YQL A;  3M62 A;  2C2V S;  5B8D A;  1U6G B;  4S3O B;  2XEU A;  1JM7 B;  1BOR A;  4GB0 A;  5LKU A;  2JM3 A;  1WIL A;  2F42 A;  1LDK C;  2ECV A;  2YUR A;  2M1R A;  4ZUX U;  1WEU A;  5D1L B;  2K4D A;  4WZ3 B;  5KH7 A;  3U5M A;  3DQV R;  2FFW A;  4FJC A;  5C13 A;  2KU3 A;  3N9O A;  3PLW A;  2QIC A;  4XI1 A;  4QF2 A;  4YAB A;  3E2D A;  3MHS A;  1RMD A;  2OWA A;  5LKT A;  2VJF A;  2IDA A;  1T1H A;  1WEE A;  2FUU A;  5D1K B;  4YAT A;  2JMD A;  2YVR A;  3KNV A;  2ECT A;  2B0O E;  4MVT A;  3N9N A;  3PHD A;  4A0C D;  2EA6 A;  5TAB A;  3M63 A;  3M7K A;  1VD4 A;  1WFK A;  4W4U A;  2MD7 B;  3MHH A;  5J3X A;  3V43 A;  4LAD B;  2ECW A;  5H9M A;  5TBN A;  3ZTG A;  2LGK A;  1WEO A;  1X4U A;  2YUC A;  4YAD A;  4A4C A;  4C9Z A;  2YSJ A;  4I7C A;  5TRB A;  4IC2 A;  2KWJ A;  4I7B A;  2LN0 A;  4UP0 A;  3RPG C;  2I50 A;  5G04 B;  4PTB A;  5G0F A;  4OGC A;  2XOY A;  2MT5 A;  3FM8 C;  2XB1 A;  1MBM A;  2JRJ A;  3U5O A;  4YAX A;  2MNZ A;  3M99 A;  2RSD A;  3FJU B;  3GL6 A;  2L0B A;  4GNF A;  2Y1M A;  2LGV A;  3PUR A;  1XWH A;  5FB0 A;  3L11 A;  4BHW A;  3C6W A;  2Y43 A;  3EB5 A;  4Q6F A;  2MD8 C;  1X4J A;  2QIZ A;  4L7X A;  2BAY A;  2MA6 A;  2KWN A;  2MKE A;  4A4B A;  2CRW A;  3O34 A;  1DCQ A;  2KKX A;  3O37 A;  2LGG A;  3LDY A;  2L5U A;  2EGP A;  5B77 A;  1MM2 A;  2DJA A;  2CSZ A;  2L7P A;  2VPE A;  2ECN A;  2F6N A;  2YQM A;  3KDE C;  3KV6 A;  2LV9 A;  1WES A;  4AYC A;  4IC3 A;  4O62 A;  2K1J A;  2E6S A;  2LDR A;  4CCG X;  5FEY A;  2QJ0 A;  4S3O C;  5LCW B;  2YYR A;  4B86 C;  4O64 A;  1VYX A;  2KIZ A;  2VJE B;  2JUN A;  2G6Q A;  2F6J A;  4N3W A;  4A49 A;  2KKY A;  3ASL A;  2FSA A;  4R2Y A;  4BBQ A;  4MSX A;  5SVI A;  3T6R A;  4FK5 A;  5B75 A;  4H9D A;  3RTR B;  2FUI A;  3FEH A;  3ZYQ A;  2KYU A;  5KH3 A;  4YC9 A;  2VPG A;  5H1T A;  4F1P A;  3MDB C;  3C5K A;  4GND A;  2CON A;  2XOC A;  3JUE A;  2KGI A;  2EXU A;  2KWK A;  2M85 A;  3FAO A;  2VPD A;  1MM3 A;  3DPL R;  1N87 A;  5I3L A;  1V87 A;  1FBV A;  4QQ4 A;  3LVR E;  4NN2 A;  4UI9 B;  1WGM A;  3RPG B;  1HYI A;  3SOW A;  3HTK C;  2LXP C;  2LGL A;  2H0D A;  4GNG A;  2UZG A;  2G45 A;  3H7H A;  4WZ0 A;  1IYM A;  5K3Q A;  4LJN A;  3N9P A;  1WIM A;  3T7L A;  5JG6 A;  3SOX A;  2JMI A;  2ZET C;  3VK6 A;  2CSY A;  2G43 A;  2D8S A;  4TKP B;  1G25 A;  3LQI A; 
#chains in the Genus database with same CATH homology
 4YBS A;  2HYE D;  5TDW A;  3ZVZ B;  2K17 A;  4X3G A;  2VJF B;  3O35 A;  1Z60 A;  4AYC B;  2KRE A;  2VP7 A;  3IHP A;  2C2L A;  2K16 A;  5FER A;  1JOC A;  2OXQ C;  1Z6U A;  2H0D B;  5KH9 A;  4YBM A;  2AN6 A;  1LDJ B;  1WE9 A;  5TDR A;  2YRE A;  1WEV A;  3LQH A;  3GV4 A;  3O7A A;  3HCU A;  4P5O B;  1E4U A;  3HCS A;  5AIT A;  3QZV A;  2MA5 A;  2LRI C;  1WEP A;  3O36 A;  5LKZ A;  5FB1 A;  1ZBD B;  4F52 B;  3HCT A;  2DX8 A;  3O33 A;  2ECI A;  4UP5 A;  2Y1N A;  4LKA A;  4R7E A;  2YHN A;  4ZQL A;  5D1M B;  4CA1 A;  3U5N A;  5B76 A;  1VFY A;  3PUQ A;  1WEQ A;  3KQI A;  1Z2Q A;  3ZPV 1;  4R8P K;  3ZVY A;  2ECG A;  3O70 A;  4YBT A;  3SOU A;  1JM7 A;  4B7Y C;  5DIN A;  3L1Z B;  3I2D A;  4WZ2 A;  2CT2 A;  2KR4 A;  1FP0 A;  2YSM A;  2KWO A;  4FO9 A;  3L1X A;  3N9Q A;  2MUM A;  5B79 A;  2L43 A;  2MIQ A;  1HYJ A;  3LRQ A;  4V3L C;  5B78 A;  3FL2 A;  2L75 A;  4LLB A;  2LXH C;  2RI7 A;  3KV5 A;  2EOD A;  1DVP A;  5H1V A;  4FIP A;  4QF3 A;  2JMJ A;  3EB6 A;  4LK9 A;  4ZDT A;  2PUY A;  1WEN A;  2VPB A;  3ZNI A;  2YW8 A;  2CKL A;  4L58 A;  3NG2 A;  2E6R A;  5DKA A;  2ECJ A;  1WEW A;  4I7D A;  3U5P A;  5EYA F;  4GNE A;  2M3H A;  4N4F A;  5C11 A;  5LKX A;  2KE1 A;  4AP4 A;  4AVX A;  3LQJ A;  4PPE A;  2MNY A;  2PNX A;  2KGG A;  4WA6 A;  2M6M A;  2NAA A;  3SHB A;  2VJE A;  5G05 B;  2YHO A;  2YT5 A;  2CKL B;  3N9L A;  2KFT A;  2YU4 A;  1CHC A;  1WEM A;  5AIU A;  5H1U A;  2HDP A;  1F62 A;  4V3K C;  2VNF A;  2L80 A;  3ZPV E;  4AUQ B;  1K2F A;  2LQ6 A;  3N9M A;  1X4I A;  2YQL A;  3M62 A;  2C2V S;  5B8D A;  1U6G B;  4S3O B;  2XEU A;  1JM7 B;  1BOR A;  4GB0 A;  5LKU A;  1WIL A;  2F42 A;  1LDK C;  2ECV A;  2YUR A;  2M1R A;  4ZUX U;  1WEU A;  5D1L B;  2K4D A;  4WZ3 B;  5KH7 A;  3U5M A;  3DQV R;  4FJC A;  5C13 A;  2KU3 A;  3N9O A;  4XI1 A;  2QIC A;  4QF2 A;  4YAB A;  3MHS A;  1RMD A;  5LKT A;  2VJF A;  2IDA A;  1T1H A;  1WEE A;  2FUU A;  4YAT A;  5D1K B;  2JMD A;  3KNV A;  2ECT A;  4MVT A;  3N9N A;  3PHD A;  4A0C D;  2EA6 A;  5TAB A;  3M63 A;  1VD4 A;  1WFK A;  4W4U A;  2MD7 B;  3MHH A;  5J3X A;  3V43 A;  4LAD B;  2ECW A;  5H9M A;  5TBN A;  3ZTG A;  2LGK A;  1WEO A;  1X4U A;  2YUC A;  4YAD A;  4A4C A;  4C9Z A;  2YSJ A;  4I7C A;  5TRB A;  4IC2 A;  2KWJ A;  4I7B A;  2LN0 A;  4UP0 A;  3RPG C;  2I50 A;  5G04 B;  4PTB A;  5G0F A;  2MT5 A;  2XB1 A;  2JRJ A;  3U5O A;  4YAX A;  2MNZ A;  3M99 A;  2RSD A;  3GL6 A;  2L0B A;  4GNF A;  2Y1M A;  2LGV A;  3PUR A;  1XWH A;  5FB0 A;  3L11 A;  4BHW A;  3C6W A;  2Y43 A;  3EB5 A;  4Q6F A;  2MD8 C;  1X4J A;  2QIZ A;  4L7X A;  2BAY A;  2MA6 A;  2KWN A;  4A4B A;  3O34 A;  3O37 A;  2LGG A;  2L5U A;  2EGP A;  5B77 A;  1MM2 A;  2CSZ A;  2VPE A;  2ECN A;  2F6N A;  2YQM A;  3KV6 A;  2LV9 A;  1WES A;  4AYC A;  4IC3 A;  2K1J A;  2E6S A;  2LDR A;  4CCG X;  5FEY A;  2QJ0 A;  4S3O C;  5LCW B;  2YYR A;  4B86 C;  4O64 A;  1VYX A;  2KIZ A;  2VJE B;  2G6Q A;  2F6J A;  4N3W A;  4A49 A;  3ASL A;  2FSA A;  4R2Y A;  4BBQ A;  4MSX A;  3T6R A;  4FK5 A;  5B75 A;  3RTR B;  2FUI A;  3ZYQ A;  2KYU A;  5KH3 A;  4YC9 A;  2VPG A;  5H1T A;  3C5K A;  4GND A;  2KGI A;  2KWK A;  2M85 A;  2VPD A;  1MM3 A;  3DPL R;  1N87 A;  5I3L A;  1V87 A;  1FBV A;  4NN2 A;  4UI9 B;  1WGM A;  3RPG B;  1HYI A;  3SOW A;  3HTK C;  2LXP C;  2LGL A;  2H0D A;  4GNG A;  2UZG A;  2G45 A;  4WZ0 A;  1IYM A;  4LJN A;  3N9P A;  1WIM A;  3T7L A;  5JG6 A;  3SOX A;  2JMI A;  2ZET C;  3VK6 A;  2CSY A;  2G43 A;  2D8S A;  4TKP B;  1G25 A;  3LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...