4Q6FA

Crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
SVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4q6fA00
5B77A 1MM3A 4B86C 5KH9A 2YREA 3O70A 4W4UA 3T6RA 4A4CA 1T1HA 3KNVA 3M62A 5AIUA 5TDRA 1WESA 4P5OB 2KR4A 5B76A 4QF2A 2HDPA 2I50A 2MA5A 4UI9B 2MD7B 2YSMA 2YT5A 2QICA 5FB0A 4MVTA 1VFYA 3I2DA 4AVXA 4YAXA 3GV4A 5B8DA 3HCUA 2G43A 4R8PK 2KWNA 1WGMA 3SOUA 1WEPA 2M3HA 1CHCA 4I7DA 5JG6A 4YBTA 2BAYA 2Y1MA 2KYUA 2G45A 3HTKC 3LQJA 5TDWA 5D1MB 4R7EA 2M85A 2K16A 2LN0A 2YHNA 5LKUA 1Z6UA 2ECWA 4ZUXU 4Q6FA 2VP7A 2LGKA 4LJNA 4R2YA 5H1VA 4WZ2A 2YQLA 5B78A 2YYRA 2L43A 2AN6A 1U6GB 3O37A 5G04B 4PTBA 2ECIA 3ZTGA 2M6MA 2EODA 3N9NA 3M63A 4AYCA 1XWHA 5AITA 1N87A 2KU3A 4CA1A 3N9LA 2JMIA 3KV5A 4YABA 4UP0A 5LKTA 2F42A 4A4BA 5H9MA 5J3XA 5H1UA 4QF3A 4LADB 2CSZA 2ECTA 1HYJA 5LKXA 3EB5A 3DQVR 2L0BA 2LQ6A 2K4DA 3RPGC 2KGGA 2LDRA 4XI1A 3GL6A 2MT5A 4YBMA 1JM7A 1LDJB 4MSXA 4CCGX 3QZVA 1WENA 3PUQA 2MNYA 2YHOA 1VD4A 5LCWB 4YADA 2JRJA 3RPGB 2K1JA 3IHPA 3V43A 3L1ZB 3LRQA 3U5PA 3MHHA 2IDAA 2MNZA 5C11A 2C2VS 1IYMA 2F6NA 3T7LA 2RSDA 2DX8A 2LGGA 2ECNA 1X4JA 1FBVA 2UZGA 4IC3A 5C13A 2YSJA 2VPDA 4WA6A 4F52B 4I7BA 3RTRB 1WEOA 2FUIA 4LKAA 4A0CD 4PPEA 2VPEA 5G05B 2LRIC 2KWOA 1WEWA 1BORA 5FEYA 4AYCB 2L5UA 4GNDA 5B79A 3SOXA 3ZVYA 4BHWA 4L7XA 2EGPA 4WZ3B 2FUUA 4IC2A 3O33A 2HYED 2JMJA 1ZBDB 2MUMA 3SHBA 2XEUA 4BBQA 3PHDA 2YQMA 2CT2A 2Y1NA 1FP0A 4FK5A 3U5OA 4ZDTA 5EYAF 2H0DA 4L58A 4C9ZA 1JM7B 1WIMA 3N9PA 5D1KB 2MD8C 2LGLA 5DINA 2Y43A 1WILA 2VNFA 5G0FA 1WEUA 2D8SA 3N9MA 2K17A 4NN2A 3O35A 1E4UA 2M1RA 3ZVZB 3HCSA 1VYXA 3M99A 2G6QA 4GNFA 4UP5A 3SOWA 5I3LA 5FB1A 2FSAA 4GNEA 4ZQLA 2LV9A 4LK9A 3LQHA 5KH7A 3L1XA 2YU4A 3ZPV1 2ECGA 2PUYA 4V3KC 2KGIA 1K2FA 4LLBA 1Z2QA 4A49A 2E6RA 4WZ0A 5H1TA 3ASLA 4YATA 5D1LB 3O7AA 3NG2A 4YC9A 1WFKA 1F62A 3L11A 2VJFA 4GNGA 2CSYA 1RMDA 3ZYQA 2CKLA 2L80A 3ZNIA 5TBNA 2VJEA 1JOCA 5TABA 5KH3A 4YBSA 1LDKC 5DKAA 4N3WA 1HYIA 4N4FA 2KWKA 2H0DB 4AUQB 4B7YC 2MIQA 1MM2A 2MA6A 4AP4A 2YUCA 2QIZA 3EB6A 1WEVA 3C5KA 2PNXA 2RI7A 3U5NA 2KFTA 2EA6A 1Z60A 4TKPB 3VK6A 2XB1A 3U5MA 4V3LC 1WEEA 3FL2A 2VPBA 4O64A 5FERA 3LQIA 4S3OC 1DVPA 3C6WA 2KWJA 1G25A 2LXPC 3MHSA 2NAAA 4GB0A 1WEMA 3HCTA 1X4IA 3DPLR 3ZPVE 5B75A 2JMDA 2KREA 4I7CA 3N9OA 2YURA 2ZETC 2C2LA 2F6JA 2VPGA 2LXHC 1V87A 2KE1A 4S3OB 5TRBA 2E6SA 4FO9A 1WEQA 3O34A 3PURA 2ECJA 2VJFB 2ECVA 4X3GA 1X4UA 2YW8A 2CKLB 3O36A 4FIPA 2LGVA 2QJ0A 2VJEB 5LKZA 2OXQC 4FJCA 3N9QA 2L75A 3KQIA 3KV6A 1WE9A 2KIZA
chains in the Genus database with same CATH superfamily
5B77A 1MM3A 3DDTA 5KH9A 4B86C 2YREA 3O70A 4W4UA 3T6RA 4A4CA 1T1HA 3KNVA 3M62A 5AIUA 5TDRA 2EGMA 1WESA 4P5OB 2KR4A 5B76A 4QF2A 2HDPA 2I50A 2MA5A 4UI9B 4F1PA 2MD7B 2YSMA 2YT5A 2QICA 5FB0A 4MVTA 1VFYA 3I2DA 3T9KA 4AVXA 4YAXA 3GV4A 5B8DA 3HCUA 2G43A 4R8PK 2KWNA 1WGMA 3SOUA 1WEPA 3LVQE 2M3HA 1CHCA 4I7DA 3O47A 5JG6A 4YBTA 2BAYA 2Y1MA 2KYUA 2G45A 3HTKC 3LQJA 5TDWA 5D1MB 4R7EA 2M85A 2K16A 2LN0A 2YHNA 5LKUA 1Z6UA 2ECWA 4ZUXU 4Q6FA 2VP7A 2LGKA 4LJNA 4R2YA 5H1VA 4WZ2A 2YQLA 5B78A 2JUNA 2YYRA 4Z0OA 2L43A 2AN6A 1U6GB 3O37A 5G04B 4PTBA 2ECIA 3ZTGA 2M6MA 2EODA 3N9NA 4OGEA 3M63A 4AYCA 1XWHA 5AITA 1N87A 2KU3A 4CA1A 3N9LA 2M13A 4O62A 2JMIA 3KV5A 4YABA 2E61A 4UP0A 5LKTA 2F42A 4A4BA 5H9MA 5J3XA 5H1UA 4QF3A 4LADB 2CSZA 2ECTA 1HYJA 5LKXA 3EB5A 3DQVR 2L0BA 2LQ6A 2K4DA 3RPGC 2KGGA 2LDRA 4XI1A 3GL6A 2MT5A 4YBMA 3FEHA 1JM7A 1LDJB 4MSXA 4CCGX 5SVIA 3QZVA 4Z0RA 1WENA 3FANA 3PUQA 2MNYA 2YHOA 1VD4A 5LCWB 4YADA 2JRJA 3RPGB 2K1JA 3IHPA 5SVXA 3V43A 3L1ZB 3LRQA 3U5PA 3FAOA 3MHHA 2IDAA 2MNZA 5C11A 2C2VS 1IYMA 2F6NA 3T7LA 2RSDA 2CSVA 2DX8A 2LGGA 2ECNA 1X4JA 1FBVA 2UZGA 4IC3A 5C13A 2YSJA 2MKEA 2VPDA 4WA6A 4F52B 4I7BA 3RTRB 1WEOA 2FUIA 4LKAA 4A0CD 4PPEA 2YVRA 2VPEA 5G05B 2LRIC 3E2DA 2KWOA 1WEWA 1BORA 5FEYA 4AYCB 2L5UA 3MDBC 4GNDA 5B79A 3SOXA 2IQJA 3Q1DA 2D8UA 3ZVYA 4BHWA 4L7XA 2EGPA 4WZ3B 2XOYA 2FUUA 4IC2A 3FJUB 3O33A 2HYED 2JMJA 1ZBDB 2MUMA 3SHBA 2XEUA 4BBQA 3PHDA 2XP0A 2YQMA 2CT2A 2Y1NA 1FP0A 4FK5A 3U5OA 4ZDTA 5EYAF 2H0DA 3M7KA 4L58A 4C9ZA 4OGCA 1JM7B 1WIMA 3N9PA 5SVIB 2KKYA 1MBMA 5D1KB 2MD8C 2LGLA 5DINA 2Y43A 1WILA 2VNFA 5G0FA 1WEUA 3LJUX 2D8SA 3PLWA 3N9MA 2K17A 4NN2A 3LDYA 3O35A 1E4UA 2M1RA 3ZVZB 2OWAA 1VYXA 3HCSA 3M99A 2G6QA 4GNFA 4UP5A 3SOWA 5I3LA 5FB1A 2FSAA 4GNEA 3FM8C 4ZQLA 2CONA 2LV9A 2L7PA 2DSMA 4LK9A 3LQHA 5KH7A 3L1XA 2XOCA 2YU4A 3ZPV1 2LAUA 2ECGA 2PUYA 4V3KC 2KGIA 1K2FA 4LLBA 1Z2QA 4A49A 2E6RA 4WZ0A 5H1TA 3ASLA 2KKXA 4YATA 5D1LB 2FD4A 3O7AA 3NG2A 4YC9A 1WFKA 3H7HA 1F62A 3L11A 2VJFA 4GNGA 2CSYA 1RMDA 3ZYQA 2CKLA 2L80A 3ZNIA 5TBNA 2VJEA 1JOCA 5TABA 5KH3A 4YBSA 1LDKC 4N3WA 5DKAA 2B0OE 4N4FA 1HYIA 2KWKA 2H0DB 4AUQB 4B7YC 2MIQA 3JUEA 1MM2A 2MA6A 4AP4A 2YUCA 2QIZA 3EB6A 5K3QA 2EXUA 1WEVA 3C5KA 2RR4A 2PNXA 2RI7A 3U5NA 2KFTA 2EA6A 3LVRE 3SUBA 1Z60A 4TKPB 3VK6A 2XB1A 3U5MA 4V3LC 1WEEA 4QQ4A 3FL2A 2VPBA 4O64A 5FERA 3LQIA 2JM3A 4S3OC 1DVPA 3C6WA 2KWJA 1G25A 2CRRA 2LXPC 3MHSA 2NAAA 4GB0A 1DCQA 1WEMA 3HCTA 1X4IA 3DPLR 3ZPVE 5B75A 2JMDA 2KREA 4I7CA 3N9OA 2CRWA 3DWDA 5SVYA 2YURA 2ZETC 2C2LA 2F6JA 2VPGA 2LXHC 1V87A 2KE1A 4S3OB 3KDEC 5TRBA 2XOZA 2E6SA 4FO9A 1WEQA 3O34A 3PURA 2ECJA 2VJFB 2ECVA 4X3GA 1X4UA 2YW8A 2CKLB 3O36A 4FIPA 2LGVA 2DJAA 2QJ0A 2VJEB 5LKZA 2OXQC 4FJCA 4H9DA 3N9QA 2L75A 2P57A 3KQIA 3KV6A 1WE9A 2FFWA 2KIZA
chains in the Genus database with same CATH topology
5B77A 1MM3A 4B86C 5KH9A 2YREA 3O70A 4W4UA 3T6RA 4A4CA 1T1HA 3KNVA 3M62A 5AIUA 5TDRA 1WESA 4P5OB 2KR4A 5B76A 4QF2A 2HDPA 2I50A 2MA5A 4UI9B 2MD7B 2YSMA 2YT5A 2QICA 5FB0A 4MVTA 1VFYA 3I2DA 4AVXA 4YAXA 3GV4A 5B8DA 3HCUA 2G43A 4R8PK 2KWNA 1WGMA 3SOUA 1WEPA 2M3HA 1CHCA 4I7DA 5JG6A 4YBTA 2BAYA 2Y1MA 2KYUA 2G45A 3HTKC 3LQJA 5TDWA 5D1MB 4R7EA 2M85A 2K16A 2LN0A 2YHNA 5LKUA 1Z6UA 2ECWA 4ZUXU 4Q6FA 2VP7A 2LGKA 4LJNA 4R2YA 5H1VA 4WZ2A 2YQLA 5B78A 2YYRA 2L43A 2AN6A 1U6GB 3O37A 5G04B 4PTBA 2ECIA 3ZTGA 2M6MA 2EODA 3N9NA 3M63A 4AYCA 1XWHA 5AITA 1N87A 2KU3A 4CA1A 3N9LA 2JMIA 3KV5A 4YABA 4UP0A 5LKTA 2F42A 4A4BA 5H9MA 5J3XA 5H1UA 4QF3A 4LADB 2CSZA 2ECTA 1HYJA 5LKXA 3EB5A 3DQVR 2L0BA 2LQ6A 2K4DA 3RPGC 2KGGA 2LDRA 4XI1A 3GL6A 2MT5A 4YBMA 1JM7A 1LDJB 4MSXA 4CCGX 3QZVA 1WENA 3PUQA 2MNYA 2YHOA 1VD4A 5LCWB 4YADA 2JRJA 3RPGB 2K1JA 3IHPA 3V43A 3L1ZB 3LRQA 3U5PA 3MHHA 2IDAA 2MNZA 5C11A 2C2VS 1IYMA 2F6NA 3T7LA 2RSDA 2DX8A 2LGGA 2ECNA 1X4JA 1FBVA 2UZGA 4IC3A 5C13A 2YSJA 2VPDA 4WA6A 4F52B 4I7BA 3RTRB 1WEOA 2FUIA 4LKAA 4A0CD 4PPEA 2VPEA 5G05B 2LRIC 2KWOA 1WEWA 1BORA 5FEYA 4AYCB 2L5UA 4GNDA 5B79A 3SOXA 3ZVYA 4BHWA 4L7XA 2EGPA 4WZ3B 2FUUA 4IC2A 3O33A 2HYED 2JMJA 1ZBDB 2MUMA 3SHBA 2XEUA 4BBQA 3PHDA 2YQMA 2CT2A 2Y1NA 1FP0A 4FK5A 3U5OA 4ZDTA 5EYAF 2H0DA 4L58A 4C9ZA 1JM7B 1WIMA 3N9PA 5D1KB 2MD8C 2LGLA 5DINA 2Y43A 1WILA 2VNFA 5G0FA 1WEUA 2D8SA 3N9MA 2K17A 4NN2A 3O35A 1E4UA 2M1RA 3ZVZB 3HCSA 1VYXA 3M99A 2G6QA 4GNFA 4UP5A 3SOWA 5I3LA 5FB1A 2FSAA 4GNEA 4ZQLA 2LV9A 4LK9A 3LQHA 5KH7A 3L1XA 2YU4A 3ZPV1 2ECGA 2PUYA 4V3KC 2KGIA 1K2FA 4LLBA 1Z2QA 4A49A 2E6RA 4WZ0A 5H1TA 3ASLA 4YATA 5D1LB 3O7AA 3NG2A 4YC9A 1WFKA 1F62A 3L11A 2VJFA 4GNGA 2CSYA 1RMDA 3ZYQA 2CKLA 2L80A 3ZNIA 5TBNA 2VJEA 1JOCA 5TABA 5KH3A 4YBSA 1LDKC 5DKAA 4N3WA 1HYIA 4N4FA 2KWKA 2H0DB 4AUQB 4B7YC 2MIQA 1MM2A 2MA6A 4AP4A 2YUCA 2QIZA 3EB6A 1WEVA 3C5KA 2PNXA 2RI7A 3U5NA 2KFTA 2EA6A 1Z60A 4TKPB 3VK6A 2XB1A 3U5MA 4V3LC 1WEEA 3FL2A 2VPBA 4O64A 5FERA 3LQIA 4S3OC 1DVPA 3C6WA 2KWJA 1G25A 2LXPC 3MHSA 2NAAA 4GB0A 1WEMA 3HCTA 1X4IA 3DPLR 3ZPVE 5B75A 2JMDA 2KREA 4I7CA 3N9OA 2YURA 2ZETC 2C2LA 2F6JA 2VPGA 2LXHC 1V87A 2KE1A 4S3OB 5TRBA 2E6SA 4FO9A 1WEQA 3O34A 3PURA 2ECJA 2VJFB 2ECVA 4X3GA 1X4UA 2YW8A 2CKLB 3O36A 4FIPA 2LGVA 2QJ0A 2VJEB 5LKZA 2OXQC 4FJCA 3N9QA 2L75A 3KQIA 3KV6A 1WE9A 2KIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B77 A;  1MM3 A;  4B86 C;  5KH9 A;  2YRE A;  3O70 A;  4W4U A;  3T6R A;  4A4C A;  1T1H A;  3KNV A;  3M62 A;  5AIU A;  5TDR A;  1WES A;  4P5O B;  2KR4 A;  5B76 A;  4QF2 A;  2HDP A;  2I50 A;  2MA5 A;  4UI9 B;  2MD7 B;  2YSM A;  2YT5 A;  2QIC A;  5FB0 A;  4MVT A;  1VFY A;  3I2D A;  4AVX A;  4YAX A;  3GV4 A;  5B8D A;  3HCU A;  2G43 A;  4R8P K;  2KWN A;  1WGM A;  3SOU A;  1WEP A;  2M3H A;  1CHC A;  4I7D A;  5JG6 A;  4YBT A;  2BAY A;  2Y1M A;  2KYU A;  2G45 A;  3HTK C;  3LQJ A;  5TDW A;  5D1M B;  4R7E A;  2M85 A;  2K16 A;  2LN0 A;  2YHN A;  5LKU A;  1Z6U A;  2ECW A;  4ZUX U;  4Q6F A;  2VP7 A;  2LGK A;  4LJN A;  4R2Y A;  5H1V A;  4WZ2 A;  2YQL A;  5B78 A;  2YYR A;  2L43 A;  2AN6 A;  1U6G B;  3O37 A;  5G04 B;  4PTB A;  2ECI A;  3ZTG A;  2M6M A;  2EOD A;  3N9N A;  3M63 A;  4AYC A;  1XWH A;  5AIT A;  1N87 A;  2KU3 A;  4CA1 A;  3N9L A;  2JMI A;  3KV5 A;  4YAB A;  4UP0 A;  5LKT A;  2F42 A;  4A4B A;  5H9M A;  5J3X A;  5H1U A;  4QF3 A;  4LAD B;  2CSZ A;  2ECT A;  1HYJ A;  5LKX A;  3EB5 A;  3DQV R;  2L0B A;  2LQ6 A;  2K4D A;  3RPG C;  2KGG A;  2LDR A;  4XI1 A;  3GL6 A;  2MT5 A;  4YBM A;  1JM7 A;  1LDJ B;  4MSX A;  4CCG X;  3QZV A;  1WEN A;  3PUQ A;  2MNY A;  2YHO A;  1VD4 A;  5LCW B;  4YAD A;  2JRJ A;  3RPG B;  2K1J A;  3IHP A;  3V43 A;  3L1Z B;  3LRQ A;  3U5P A;  3MHH A;  2IDA A;  2MNZ A;  5C11 A;  2C2V S;  1IYM A;  2F6N A;  3T7L A;  2RSD A;  2DX8 A;  2LGG A;  2ECN A;  1X4J A;  1FBV A;  2UZG A;  4IC3 A;  5C13 A;  2YSJ A;  2VPD A;  4WA6 A;  4F52 B;  4I7B A;  3RTR B;  1WEO A;  2FUI A;  4LKA A;  4A0C D;  4PPE A;  2VPE A;  5G05 B;  2LRI C;  2KWO A;  1WEW A;  1BOR A;  5FEY A;  4AYC B;  2L5U A;  4GND A;  5B79 A;  3SOX A;  3ZVY A;  4BHW A;  4L7X A;  2EGP A;  4WZ3 B;  2FUU A;  4IC2 A;  3O33 A;  2HYE D;  2JMJ A;  1ZBD B;  2MUM A;  3SHB A;  2XEU A;  4BBQ A;  3PHD A;  2YQM A;  2CT2 A;  2Y1N A;  1FP0 A;  4FK5 A;  3U5O A;  4ZDT A;  5EYA F;  2H0D A;  4L58 A;  4C9Z A;  1JM7 B;  1WIM A;  3N9P A;  5D1K B;  2MD8 C;  2LGL A;  5DIN A;  2Y43 A;  1WIL A;  2VNF A;  5G0F A;  1WEU A;  2D8S A;  3N9M A;  2K17 A;  4NN2 A;  3O35 A;  1E4U A;  2M1R A;  3ZVZ B;  3HCS A;  1VYX A;  3M99 A;  2G6Q A;  4GNF A;  4UP5 A;  3SOW A;  5I3L A;  5FB1 A;  2FSA A;  4GNE A;  4ZQL A;  2LV9 A;  4LK9 A;  3LQH A;  5KH7 A;  3L1X A;  2YU4 A;  3ZPV 1;  2ECG A;  2PUY A;  4V3K C;  2KGI A;  1K2F A;  4LLB A;  1Z2Q A;  4A49 A;  2E6R A;  4WZ0 A;  5H1T A;  3ASL A;  4YAT A;  5D1L B;  3O7A A;  3NG2 A;  4YC9 A;  1WFK A;  1F62 A;  3L11 A;  2VJF A;  4GNG A;  2CSY A;  1RMD A;  3ZYQ A;  2CKL A;  2L80 A;  3ZNI A;  5TBN A;  2VJE A;  1JOC A;  5TAB A;  5KH3 A;  4YBS A;  1LDK C;  5DKA A;  4N3W A;  1HYI A;  4N4F A;  2KWK A;  2H0D B;  4AUQ B;  4B7Y C;  2MIQ A;  1MM2 A;  2MA6 A;  4AP4 A;  2YUC A;  2QIZ A;  3EB6 A;  1WEV A;  3C5K A;  2PNX A;  2RI7 A;  3U5N A;  2KFT A;  2EA6 A;  1Z60 A;  4TKP B;  3VK6 A;  2XB1 A;  3U5M A;  4V3L C;  1WEE A;  3FL2 A;  2VPB A;  4O64 A;  5FER A;  3LQI A;  4S3O C;  1DVP A;  3C6W A;  2KWJ A;  1G25 A;  2LXP C;  3MHS A;  2NAA A;  4GB0 A;  1WEM A;  3HCT A;  1X4I A;  3DPL R;  3ZPV E;  5B75 A;  2JMD A;  2KRE A;  4I7C A;  3N9O A;  2YUR A;  2ZET C;  2C2L A;  2F6J A;  2VPG A;  2LXH C;  1V87 A;  2KE1 A;  4S3O B;  5TRB A;  2E6S A;  4FO9 A;  1WEQ A;  3O34 A;  3PUR A;  2ECJ A;  2VJF B;  2ECV A;  4X3G A;  1X4U A;  2YW8 A;  2CKL B;  3O36 A;  4FIP A;  2LGV A;  2QJ0 A;  2VJE B;  5LKZ A;  2OXQ C;  4FJC A;  3N9Q A;  2L75 A;  3KQI A;  3KV6 A;  1WE9 A;  2KIZ A; 
#chains in the Genus database with same CATH topology
 5B77 A;  1MM3 A;  3DDT A;  5KH9 A;  4B86 C;  2YRE A;  3O70 A;  4W4U A;  3T6R A;  4A4C A;  1T1H A;  3KNV A;  3M62 A;  5AIU A;  5TDR A;  2EGM A;  1WES A;  4P5O B;  2KR4 A;  5B76 A;  4QF2 A;  2HDP A;  2I50 A;  2MA5 A;  4UI9 B;  4F1P A;  2MD7 B;  2YSM A;  2YT5 A;  2QIC A;  5FB0 A;  4MVT A;  1VFY A;  3I2D A;  3T9K A;  4AVX A;  4YAX A;  3GV4 A;  5B8D A;  3HCU A;  2G43 A;  4R8P K;  2KWN A;  1WGM A;  3SOU A;  1WEP A;  3LVQ E;  2M3H A;  1CHC A;  4I7D A;  3O47 A;  5JG6 A;  4YBT A;  2BAY A;  2Y1M A;  2KYU A;  2G45 A;  3HTK C;  3LQJ A;  5TDW A;  5D1M B;  4R7E A;  2M85 A;  2K16 A;  2LN0 A;  2YHN A;  5LKU A;  1Z6U A;  2ECW A;  4ZUX U;  4Q6F A;  2VP7 A;  2LGK A;  4LJN A;  4R2Y A;  5H1V A;  4WZ2 A;  2YQL A;  5B78 A;  2JUN A;  2YYR A;  4Z0O A;  2L43 A;  2AN6 A;  1U6G B;  3O37 A;  5G04 B;  4PTB A;  2ECI A;  3ZTG A;  2M6M A;  2EOD A;  3N9N A;  4OGE A;  3M63 A;  4AYC A;  1XWH A;  5AIT A;  1N87 A;  2KU3 A;  4CA1 A;  3N9L A;  2M13 A;  4O62 A;  2JMI A;  3KV5 A;  4YAB A;  2E61 A;  4UP0 A;  5LKT A;  2F42 A;  4A4B A;  5H9M A;  5J3X A;  5H1U A;  4QF3 A;  4LAD B;  2CSZ A;  2ECT A;  1HYJ A;  5LKX A;  3EB5 A;  3DQV R;  2L0B A;  2LQ6 A;  2K4D A;  3RPG C;  2KGG A;  2LDR A;  4XI1 A;  3GL6 A;  2MT5 A;  4YBM A;  3FEH A;  1JM7 A;  1LDJ B;  4MSX A;  4CCG X;  5SVI A;  3QZV A;  4Z0R A;  1WEN A;  3FAN A;  3PUQ A;  2MNY A;  2YHO A;  1VD4 A;  5LCW B;  4YAD A;  2JRJ A;  3RPG B;  2K1J A;  3IHP A;  5SVX A;  3V43 A;  3L1Z B;  3LRQ A;  3U5P A;  3FAO A;  3MHH A;  2IDA A;  2MNZ A;  5C11 A;  2C2V S;  1IYM A;  2F6N A;  3T7L A;  2RSD A;  2CSV A;  2DX8 A;  2LGG A;  2ECN A;  1X4J A;  1FBV A;  2UZG A;  4IC3 A;  5C13 A;  2YSJ A;  2MKE A;  2VPD A;  4WA6 A;  4F52 B;  4I7B A;  3RTR B;  1WEO A;  2FUI A;  4LKA A;  4A0C D;  4PPE A;  2YVR A;  2VPE A;  5G05 B;  2LRI C;  3E2D A;  2KWO A;  1WEW A;  1BOR A;  5FEY A;  4AYC B;  2L5U A;  3MDB C;  4GND A;  5B79 A;  3SOX A;  2IQJ A;  3Q1D A;  2D8U A;  3ZVY A;  4BHW A;  4L7X A;  2EGP A;  4WZ3 B;  2XOY A;  2FUU A;  4IC2 A;  3FJU B;  3O33 A;  2HYE D;  2JMJ A;  1ZBD B;  2MUM A;  3SHB A;  2XEU A;  4BBQ A;  3PHD A;  2XP0 A;  2YQM A;  2CT2 A;  2Y1N A;  1FP0 A;  4FK5 A;  3U5O A;  4ZDT A;  5EYA F;  2H0D A;  3M7K A;  4L58 A;  4C9Z A;  4OGC A;  1JM7 B;  1WIM A;  3N9P A;  5SVI B;  2KKY A;  1MBM A;  5D1K B;  2MD8 C;  2LGL A;  5DIN A;  2Y43 A;  1WIL A;  2VNF A;  5G0F A;  1WEU A;  3LJU X;  2D8S A;  3PLW A;  3N9M A;  2K17 A;  4NN2 A;  3LDY A;  3O35 A;  1E4U A;  2M1R A;  3ZVZ B;  2OWA A;  1VYX A;  3HCS A;  3M99 A;  2G6Q A;  4GNF A;  4UP5 A;  3SOW A;  5I3L A;  5FB1 A;  2FSA A;  4GNE A;  3FM8 C;  4ZQL A;  2CON A;  2LV9 A;  2L7P A;  2DSM A;  4LK9 A;  3LQH A;  5KH7 A;  3L1X A;  2XOC A;  2YU4 A;  3ZPV 1;  2LAU A;  2ECG A;  2PUY A;  4V3K C;  2KGI A;  1K2F A;  4LLB A;  1Z2Q A;  4A49 A;  2E6R A;  4WZ0 A;  5H1T A;  3ASL A;  2KKX A;  4YAT A;  5D1L B;  2FD4 A;  3O7A A;  3NG2 A;  4YC9 A;  1WFK A;  3H7H A;  1F62 A;  3L11 A;  2VJF A;  4GNG A;  2CSY A;  1RMD A;  3ZYQ A;  2CKL A;  2L80 A;  3ZNI A;  5TBN A;  2VJE A;  1JOC A;  5TAB A;  5KH3 A;  4YBS A;  1LDK C;  4N3W A;  5DKA A;  2B0O E;  4N4F A;  1HYI A;  2KWK A;  2H0D B;  4AUQ B;  4B7Y C;  2MIQ A;  3JUE A;  1MM2 A;  2MA6 A;  4AP4 A;  2YUC A;  2QIZ A;  3EB6 A;  5K3Q A;  2EXU A;  1WEV A;  3C5K A;  2RR4 A;  2PNX A;  2RI7 A;  3U5N A;  2KFT A;  2EA6 A;  3LVR E;  3SUB A;  1Z60 A;  4TKP B;  3VK6 A;  2XB1 A;  3U5M A;  4V3L C;  1WEE A;  4QQ4 A;  3FL2 A;  2VPB A;  4O64 A;  5FER A;  3LQI A;  2JM3 A;  4S3O C;  1DVP A;  3C6W A;  2KWJ A;  1G25 A;  2CRR A;  2LXP C;  3MHS A;  2NAA A;  4GB0 A;  1DCQ A;  1WEM A;  3HCT A;  1X4I A;  3DPL R;  3ZPV E;  5B75 A;  2JMD A;  2KRE A;  4I7C A;  3N9O A;  2CRW A;  3DWD A;  5SVY A;  2YUR A;  2ZET C;  2C2L A;  2F6J A;  2VPG A;  2LXH C;  1V87 A;  2KE1 A;  4S3O B;  3KDE C;  5TRB A;  2XOZ A;  2E6S A;  4FO9 A;  1WEQ A;  3O34 A;  3PUR A;  2ECJ A;  2VJF B;  2ECV A;  4X3G A;  1X4U A;  2YW8 A;  2CKL B;  3O36 A;  4FIP A;  2LGV A;  2DJA A;  2QJ0 A;  2VJE B;  5LKZ A;  2OXQ C;  4FJC A;  4H9D A;  3N9Q A;  2L75 A;  2P57 A;  3KQI A;  3KV6 A;  1WE9 A;  2FFW A;  2KIZ A; 
#chains in the Genus database with same CATH homology
 5B77 A;  1MM3 A;  4B86 C;  5KH9 A;  2YRE A;  3O70 A;  4W4U A;  3T6R A;  4A4C A;  1T1H A;  3KNV A;  3M62 A;  5AIU A;  5TDR A;  1WES A;  4P5O B;  2KR4 A;  5B76 A;  4QF2 A;  2HDP A;  2I50 A;  2MA5 A;  4UI9 B;  2MD7 B;  2YSM A;  2YT5 A;  2QIC A;  5FB0 A;  4MVT A;  1VFY A;  3I2D A;  4AVX A;  4YAX A;  3GV4 A;  5B8D A;  3HCU A;  2G43 A;  4R8P K;  2KWN A;  1WGM A;  3SOU A;  1WEP A;  2M3H A;  1CHC A;  4I7D A;  5JG6 A;  4YBT A;  2BAY A;  2Y1M A;  2KYU A;  2G45 A;  3HTK C;  3LQJ A;  5TDW A;  5D1M B;  4R7E A;  2M85 A;  2K16 A;  2LN0 A;  2YHN A;  5LKU A;  1Z6U A;  2ECW A;  4ZUX U;  4Q6F A;  2VP7 A;  2LGK A;  4LJN A;  4R2Y A;  5H1V A;  4WZ2 A;  2YQL A;  5B78 A;  2YYR A;  2L43 A;  2AN6 A;  1U6G B;  3O37 A;  5G04 B;  4PTB A;  2ECI A;  3ZTG A;  2M6M A;  2EOD A;  3N9N A;  3M63 A;  4AYC A;  1XWH A;  5AIT A;  1N87 A;  2KU3 A;  4CA1 A;  3N9L A;  2JMI A;  3KV5 A;  4YAB A;  4UP0 A;  5LKT A;  2F42 A;  4A4B A;  5H9M A;  5J3X A;  5H1U A;  4QF3 A;  4LAD B;  2CSZ A;  2ECT A;  1HYJ A;  5LKX A;  3EB5 A;  3DQV R;  2L0B A;  2LQ6 A;  2K4D A;  3RPG C;  2KGG A;  2LDR A;  4XI1 A;  3GL6 A;  2MT5 A;  4YBM A;  1JM7 A;  1LDJ B;  4MSX A;  4CCG X;  3QZV A;  1WEN A;  3PUQ A;  2MNY A;  2YHO A;  1VD4 A;  5LCW B;  4YAD A;  2JRJ A;  3RPG B;  2K1J A;  3IHP A;  3V43 A;  3L1Z B;  3LRQ A;  3U5P A;  3MHH A;  2IDA A;  2MNZ A;  5C11 A;  2C2V S;  1IYM A;  2F6N A;  3T7L A;  2RSD A;  2DX8 A;  2LGG A;  2ECN A;  1X4J A;  1FBV A;  2UZG A;  4IC3 A;  5C13 A;  2YSJ A;  2VPD A;  4WA6 A;  4F52 B;  4I7B A;  3RTR B;  1WEO A;  2FUI A;  4LKA A;  4A0C D;  4PPE A;  2VPE A;  5G05 B;  2LRI C;  2KWO A;  1WEW A;  1BOR A;  5FEY A;  4AYC B;  2L5U A;  4GND A;  5B79 A;  3SOX A;  3ZVY A;  4BHW A;  4L7X A;  2EGP A;  4WZ3 B;  2FUU A;  4IC2 A;  3O33 A;  2HYE D;  2JMJ A;  1ZBD B;  2MUM A;  3SHB A;  2XEU A;  4BBQ A;  3PHD A;  2YQM A;  2CT2 A;  2Y1N A;  1FP0 A;  4FK5 A;  3U5O A;  4ZDT A;  5EYA F;  2H0D A;  4L58 A;  4C9Z A;  1JM7 B;  1WIM A;  3N9P A;  5D1K B;  2MD8 C;  2LGL A;  5DIN A;  2Y43 A;  1WIL A;  2VNF A;  5G0F A;  1WEU A;  2D8S A;  3N9M A;  2K17 A;  4NN2 A;  3O35 A;  1E4U A;  2M1R A;  3ZVZ B;  3HCS A;  1VYX A;  3M99 A;  2G6Q A;  4GNF A;  4UP5 A;  3SOW A;  5I3L A;  5FB1 A;  2FSA A;  4GNE A;  4ZQL A;  2LV9 A;  4LK9 A;  3LQH A;  5KH7 A;  3L1X A;  2YU4 A;  3ZPV 1;  2ECG A;  2PUY A;  4V3K C;  2KGI A;  1K2F A;  4LLB A;  1Z2Q A;  4A49 A;  2E6R A;  4WZ0 A;  5H1T A;  3ASL A;  4YAT A;  5D1L B;  3O7A A;  3NG2 A;  4YC9 A;  1WFK A;  1F62 A;  3L11 A;  2VJF A;  4GNG A;  2CSY A;  1RMD A;  3ZYQ A;  2CKL A;  2L80 A;  3ZNI A;  5TBN A;  2VJE A;  1JOC A;  5TAB A;  5KH3 A;  4YBS A;  1LDK C;  5DKA A;  4N3W A;  1HYI A;  4N4F A;  2KWK A;  2H0D B;  4AUQ B;  4B7Y C;  2MIQ A;  1MM2 A;  2MA6 A;  4AP4 A;  2YUC A;  2QIZ A;  3EB6 A;  1WEV A;  3C5K A;  2PNX A;  2RI7 A;  3U5N A;  2KFT A;  2EA6 A;  1Z60 A;  4TKP B;  3VK6 A;  2XB1 A;  3U5M A;  4V3L C;  1WEE A;  3FL2 A;  2VPB A;  4O64 A;  5FER A;  3LQI A;  4S3O C;  1DVP A;  3C6W A;  2KWJ A;  1G25 A;  2LXP C;  3MHS A;  2NAA A;  4GB0 A;  1WEM A;  3HCT A;  1X4I A;  3DPL R;  3ZPV E;  5B75 A;  2JMD A;  2KRE A;  4I7C A;  3N9O A;  2YUR A;  2ZET C;  2C2L A;  2F6J A;  2VPG A;  2LXH C;  1V87 A;  2KE1 A;  4S3O B;  5TRB A;  2E6S A;  4FO9 A;  1WEQ A;  3O34 A;  3PUR A;  2ECJ A;  2VJF B;  2ECV A;  4X3G A;  1X4U A;  2YW8 A;  2CKL B;  3O36 A;  4FIP A;  2LGV A;  2QJ0 A;  2VJE B;  5LKZ A;  2OXQ C;  4FJC A;  3N9Q A;  2L75 A;  3KQI A;  3KV6 A;  1WE9 A;  2KIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...