5TABA

Crystal structure of the phd finger of phf20
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
GPLGSEVVRCICEVQEENDFMIQCEECQSWQHGVCMGLLEENVPEKYTCYVCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20
publication title PHF20 Readers Link Methylation of Histone H3K4 and p53 with H4K16 Acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tabA00
2L0BA 2ZETC 1WEEA 2KWOA 3L1XA 1JOCA 2VJFB 2LGVA 4UP5A 5LKUA 3GL6A 4X3GA 3HCUA 4N4FA 3GV4A 1LDJB 4LJNA 5TBNA 2VPDA 2MIQA 1V87A 1FBVA 4F52B 2QICA 3SOXA 5C11A 1N87A 4GNGA 5G05B 2Y1MA 4A49A 2QIZA 2H0DA 5FB1A 5JG6A 3C6WA 2LN0A 2D8SA 2MA5A 5TDRA 4LADB 4NN2A 2LDRA 3MHSA 4GNEA 5C13A 3O34A 4R8PK 2KYUA 4YBTA 2M1RA 5KH7A 3LRQA 5H1VA 4GNFA 2HYED 4YAXA 2KWKA 2VPEA 4UP0A 2VJFA 4IC3A 1X4UA 3ZVZB 5B76A 1WENA 3L1ZB 2ECIA 5FB0A 4GNDA 3RPGC 4A4BA 3HCSA 2K4DA 5KH3A 1VFYA 2KGIA 3O33A 2F42A 3PURA 4MSXA 1BORA 2YSMA 2KR4A 3V43A 4I7BA 2CKLA 2MA6A 4A0CD 4L58A 4FK5A 5LCWB 3N9QA 4FJCA 3PUQA 2XB1A 2EODA 4B7YC 3N9LA 4IC2A 5AIUA 4XI1A 3PHDA 5AITA 3U5PA 4BBQA 3HCTA 3O36A 5TABA 2YSJA 1K2FA 4ZDTA 1WEUA 1MM2A 3RTRB 2F6JA 3T6RA 4UI9B 1FP0A 1Z2QA 3SHBA 3L11A 2FUUA 1U6GB 4AUQB 5TRBA 4V3LC 2JMJA 3U5NA 3HTKC 1WEVA 2M85A 5H1TA 1Z60A 2G43A 2LXPC 2IDAA 4GB0A 5D1LB 2YURA 4WA6A 2MT5A 2L5UA 2LV9A 2YUCA 3N9MA 2YQLA 2JMDA 3I2DA 5G0FA 3SOWA 4C9ZA 1HYJA 4YADA 2Y43A 2KWJA 1WGMA 3O7AA 2LRIC 1WFKA 2BAYA 4YC9A 4TKPB 2EGPA 4LLBA 2L75A 5DINA 2ECTA 2YQMA 3ZPVE 4A4CA 2KWNA 1WEQA 5KH9A 3LQIA 4YABA 1CHCA 5H9MA 4WZ2A 2PUYA 3DPLR 4R7EA 2HDPA 2YHOA 1E4UA 5G04B 4FO9A 1G25A 1X4JA 1Z6UA 3VK6A 3ZTGA 4YATA 3U5MA 2E6RA 4S3OB 2RSDA 4AP4A 5D1KB 5DKAA 1ZBDB 4AYCB 1VYXA 2YHNA 3EB5A 2MD7B 1VD4A 2KE1A 4CA1A 3N9PA 2ECVA 2JRJA 3O70A 2PNXA 4N3WA 2LXHC 1XWHA 2FUIA 3O37A 2C2LA 4ZQLA 4W4UA 3KNVA 2F6NA 4P5OB 4V3KC 1X4IA 4CCGX 1WEPA 4AVXA 1DVPA 1LDKC 3ASLA 3ZPV1 2KU3A 4I7DA 3T7LA 2AN6A 4ZUXU 2L43A 2YW8A 3C5KA 2FSAA 2LGLA 1WEMA 2YT5A 4WZ0A 4PPEA 2VNFA 4YBMA 3SOUA 2VPGA 4S3OC 4AYCA 2KFTA 3ZYQA 2KGGA 2KREA 5I3LA 2Y1NA 1HYIA 3N9NA 3LQJA 2ECGA 5B8DA 3KQIA 2JMIA 4FIPA 2L80A 3N9OA 5LKTA 3RPGB 5B78A 2XEUA 1MM3A 3QZVA 5H1UA 3IHPA 4PTBA 1F62A 2LGKA 2DX8A 3ZNIA 2M6MA 3LQHA 2ECNA 2K16A 1WEWA 2MNYA 5B79A 1IYMA 2CKLB 2QJ0A 2ECWA 5EYAF 2C2VS 3M99A 4I7CA 2I50A 2VJEB 3O35A 4O64A 2VP7A 2CSZA 4B86C 1RMDA 2YU4A 3EB6A 2CT2A 4R2YA 3NG2A 4Q6FA 4LKAA 2UZGA 2MD8C 3ZVYA 4YBSA 2K17A 1JM7B 3FL2A 1WEOA 4QF2A 3MHHA 4MVTA 5D1MB 3M63A 2EA6A 2VPBA 5LKXA 2G6QA 3KV5A 3U5OA 5FEYA 2M3HA 5B75A 2K1JA 2KIZA 2MNZA 2VJEA 5J3XA 3M62A 2YREA 1WESA 2MUMA 3DQVR 5B77A 5LKZA 2RI7A 2E6SA 2NAAA 4L7XA 5FERA 2H0DB 4WZ3B 2G45A 4QF3A 1WE9A 4LK9A 2LGGA 1T1HA 1WILA 1JM7A 2YYRA 2OXQC 1WIMA 3KV6A 5TDWA 2CSYA 4BHWA 2LQ6A 2ECJA
chains in the Genus database with same CATH superfamily
2L0BA 2ZETC 1WEEA 2KWOA 3L1XA 1JOCA 2VJFB 2LGVA 4UP5A 5LKUA 3GL6A 4X3GA 3HCUA 4N4FA 3GV4A 1LDJB 4LJNA 5TBNA 2VPDA 2MIQA 2E61A 1V87A 1FBVA 3MDBC 4F52B 2QICA 3SOXA 2KKYA 5C11A 1N87A 4GNGA 5G05B 2Y1MA 4A49A 3FM8C 2QIZA 2H0DA 5FB1A 5JG6A 3C6WA 2LN0A 2D8SA 2MA5A 5TDRA 4LADB 4NN2A 2LDRA 3MHSA 4GNEA 5C13A 3O34A 4R8PK 2KYUA 2FFWA 4YBTA 2M1RA 5KH7A 3LRQA 5H1VA 4GNFA 2HYED 3FAOA 4YAXA 2KWKA 2VPEA 4UP0A 2VJFA 4IC3A 1X4UA 3ZVZB 5B76A 1WENA 3L1ZB 2ECIA 5FB0A 2L7PA 3M7KA 4GNDA 3RPGC 3LDYA 4A4BA 3HCSA 2JM3A 2K4DA 5KH3A 1VFYA 2KGIA 3O33A 2F42A 3PURA 4MSXA 1BORA 2YSMA 2KR4A 3V43A 1DCQA 1MBMA 4I7BA 2CKLA 2MA6A 4A0CD 4L58A 4FK5A 5LCWB 2CRWA 2D8UA 3N9QA 4FJCA 3PUQA 2XB1A 2EODA 4B7YC 3N9LA 4IC2A 5AIUA 4XI1A 3PLWA 3PHDA 5AITA 3U5PA 4BBQA 3HCTA 3O36A 5TABA 2YSJA 1K2FA 4ZDTA 1WEUA 4F1PA 1MM2A 3RTRB 2F6JA 3KDEC 3T6RA 4UI9B 2LAUA 1FP0A 1Z2QA 3SHBA 3L11A 2FUUA 1U6GB 4AUQB 5SVIB 5TRBA 4V3LC 2JMJA 2B0OE 3U5NA 3HTKC 1WEVA 2M85A 5H1TA 1Z60A 2EGMA 2G43A 2LXPC 3O47A 2IDAA 4GB0A 5D1LB 2YURA 4WA6A 2MT5A 2L5UA 2LV9A 2YUCA 3N9MA 2RR4A 2YQLA 2JMDA 3LVQE 3I2DA 5G0FA 2DSMA 3SOWA 4C9ZA 1HYJA 4YADA 2Y43A 2KWJA 4OGCA 1WGMA 3O7AA 2LRIC 1WFKA 2BAYA 4YC9A 4TKPB 5SVIA 2EGPA 4LLBA 2L75A 5DINA 2ECTA 2YQMA 3ZPVE 4A4CA 2KWNA 3FEHA 1WEQA 5KH9A 3LQIA 4YABA 1CHCA 5H9MA 2XOYA 4WZ2A 2PUYA 3DPLR 3JUEA 2CSVA 4R7EA 2HDPA 2YHOA 1E4UA 5G04B 4Z0RA 2IQJA 4FO9A 2CRRA 1G25A 1X4JA 1Z6UA 3VK6A 3ZTGA 4O62A 4YATA 3U5MA 2E6RA 4S3OB 2RSDA 4AP4A 5D1KB 5DKAA 2OWAA 1ZBDB 4AYCB 1VYXA 2YHNA 3EB5A 2MD7B 1VD4A 2KE1A 4CA1A 3N9PA 2ECVA 3SUBA 2JRJA 3O70A 2PNXA 3Q1DA 4N3WA 2LXHC 1XWHA 2FUIA 2EXUA 3O37A 2C2LA 4ZQLA 4W4UA 3KNVA 2F6NA 2P57A 4P5OB 4V3KC 1X4IA 4CCGX 1WEPA 4AVXA 1DVPA 1LDKC 3ASLA 3T9KA 3ZPV1 2KU3A 4I7DA 3T7LA 2AN6A 2M13A 4ZUXU 2L43A 2YW8A 3C5KA 2CONA 2FSAA 2LGLA 1WEMA 2YT5A 4H9DA 4WZ0A 4PPEA 2VNFA 4OGEA 4YBMA 3SOUA 2MKEA 2VPGA 4S3OC 2FD4A 4AYCA 2KFTA 3FJUB 3ZYQA 2KGGA 2KREA 5I3LA 2Y1NA 1HYIA 3N9NA 3LQJA 2ECGA 5B8DA 3KQIA 2JMIA 4FIPA 2L80A 4QQ4A 3N9OA 5LKTA 3RPGB 5B78A 2XEUA 1MM3A 3QZVA 5H1UA 3IHPA 4PTBA 1F62A 2LGKA 2DX8A 3ZNIA 2M6MA 3LQHA 2ECNA 3DDTA 2K16A 1WEWA 5SVXA 3FANA 2JUNA 2MNYA 5B79A 1IYMA 2CKLB 2QJ0A 2ECWA 5EYAF 2C2VS 3M99A 3E2DA 2I50A 4I7CA 2VJEB 3O35A 4O64A 2XOZA 3LJUX 2VP7A 2CSZA 2XOCA 4B86C 1RMDA 2YU4A 3EB6A 2CT2A 2DJAA 4R2YA 3NG2A 4Q6FA 4LKAA 2UZGA 2MD8C 3ZVYA 4YBSA 2K17A 2YVRA 4Z0OA 1JM7B 3FL2A 3DWDA 1WEOA 4QF2A 3MHHA 4MVTA 5D1MB 3M63A 2EA6A 2VPBA 5LKXA 2G6QA 3KV5A 3U5OA 5FEYA 2M3HA 5B75A 2K1JA 2KIZA 2KKXA 2MNZA 2VJEA 5J3XA 3M62A 2YREA 5K3QA 1WESA 2MUMA 3DQVR 5B77A 5LKZA 2RI7A 3LVRE 2E6SA 2NAAA 4L7XA 5FERA 2H0DB 4WZ3B 2G45A 4QF3A 1WE9A 4LK9A 2LGGA 1T1HA 5SVYA 1WILA 2XP0A 1JM7A 2YYRA 2OXQC 1WIMA 3KV6A 5TDWA 3H7HA 2CSYA 4BHWA 2LQ6A 2ECJA
chains in the Genus database with same CATH topology
2L0BA 2ZETC 1WEEA 2KWOA 3L1XA 1JOCA 2VJFB 2LGVA 4UP5A 5LKUA 3GL6A 4X3GA 3HCUA 4N4FA 3GV4A 1LDJB 4LJNA 5TBNA 2VPDA 2MIQA 1V87A 1FBVA 4F52B 2QICA 3SOXA 5C11A 1N87A 4GNGA 5G05B 2Y1MA 4A49A 2QIZA 2H0DA 5FB1A 5JG6A 3C6WA 2LN0A 2D8SA 2MA5A 5TDRA 4LADB 4NN2A 2LDRA 3MHSA 4GNEA 5C13A 3O34A 4R8PK 2KYUA 4YBTA 2M1RA 5KH7A 3LRQA 5H1VA 4GNFA 2HYED 4YAXA 2KWKA 2VPEA 4UP0A 2VJFA 4IC3A 1X4UA 3ZVZB 5B76A 1WENA 3L1ZB 2ECIA 5FB0A 4GNDA 3RPGC 4A4BA 3HCSA 2K4DA 5KH3A 1VFYA 2KGIA 3O33A 2F42A 3PURA 4MSXA 1BORA 2YSMA 2KR4A 3V43A 4I7BA 2CKLA 2MA6A 4A0CD 4L58A 4FK5A 5LCWB 3N9QA 4FJCA 3PUQA 2XB1A 2EODA 4B7YC 3N9LA 4IC2A 5AIUA 4XI1A 3PHDA 5AITA 3U5PA 4BBQA 3HCTA 3O36A 5TABA 2YSJA 1K2FA 4ZDTA 1WEUA 1MM2A 3RTRB 2F6JA 3T6RA 4UI9B 1FP0A 1Z2QA 3SHBA 3L11A 2FUUA 1U6GB 4AUQB 5TRBA 4V3LC 2JMJA 3U5NA 3HTKC 1WEVA 2M85A 5H1TA 1Z60A 2G43A 2LXPC 2IDAA 4GB0A 5D1LB 2YURA 4WA6A 2MT5A 2L5UA 2LV9A 2YUCA 3N9MA 2YQLA 2JMDA 3I2DA 5G0FA 3SOWA 4C9ZA 1HYJA 4YADA 2Y43A 2KWJA 1WGMA 3O7AA 2LRIC 1WFKA 2BAYA 4YC9A 4TKPB 2EGPA 4LLBA 2L75A 5DINA 2ECTA 2YQMA 3ZPVE 4A4CA 2KWNA 1WEQA 5KH9A 3LQIA 4YABA 1CHCA 5H9MA 4WZ2A 2PUYA 3DPLR 4R7EA 2HDPA 2YHOA 1E4UA 5G04B 4FO9A 1G25A 1X4JA 1Z6UA 3VK6A 3ZTGA 4YATA 3U5MA 2E6RA 4S3OB 2RSDA 4AP4A 5D1KB 5DKAA 1ZBDB 4AYCB 1VYXA 2YHNA 3EB5A 2MD7B 1VD4A 2KE1A 4CA1A 3N9PA 2ECVA 2JRJA 3O70A 2PNXA 4N3WA 2LXHC 1XWHA 2FUIA 3O37A 2C2LA 4ZQLA 4W4UA 3KNVA 2F6NA 4P5OB 4V3KC 1X4IA 4CCGX 1WEPA 4AVXA 1DVPA 1LDKC 3ASLA 3ZPV1 2KU3A 4I7DA 3T7LA 2AN6A 4ZUXU 2L43A 2YW8A 3C5KA 2FSAA 2LGLA 1WEMA 2YT5A 4WZ0A 4PPEA 2VNFA 4YBMA 3SOUA 2VPGA 4S3OC 4AYCA 2KFTA 3ZYQA 2KGGA 2KREA 5I3LA 2Y1NA 1HYIA 3N9NA 3LQJA 2ECGA 5B8DA 3KQIA 2JMIA 4FIPA 2L80A 3N9OA 5LKTA 3RPGB 5B78A 2XEUA 1MM3A 3QZVA 5H1UA 3IHPA 4PTBA 1F62A 2LGKA 2DX8A 3ZNIA 2M6MA 3LQHA 2ECNA 2K16A 1WEWA 2MNYA 5B79A 1IYMA 2CKLB 2QJ0A 2ECWA 5EYAF 2C2VS 3M99A 4I7CA 2I50A 2VJEB 3O35A 4O64A 2VP7A 2CSZA 4B86C 1RMDA 2YU4A 3EB6A 2CT2A 4R2YA 3NG2A 4Q6FA 4LKAA 2UZGA 2MD8C 3ZVYA 4YBSA 2K17A 1JM7B 3FL2A 1WEOA 4QF2A 3MHHA 4MVTA 5D1MB 3M63A 2EA6A 2VPBA 5LKXA 2G6QA 3KV5A 3U5OA 5FEYA 2M3HA 5B75A 2K1JA 2KIZA 2MNZA 2VJEA 5J3XA 3M62A 2YREA 1WESA 2MUMA 3DQVR 5B77A 5LKZA 2RI7A 2E6SA 2NAAA 4L7XA 5FERA 2H0DB 4WZ3B 2G45A 4QF3A 1WE9A 4LK9A 2LGGA 1T1HA 1WILA 1JM7A 2YYRA 2OXQC 1WIMA 3KV6A 5TDWA 2CSYA 4BHWA 2LQ6A 2ECJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0B A;  2ZET C;  1WEE A;  2KWO A;  3L1X A;  1JOC A;  2VJF B;  2LGV A;  4UP5 A;  5LKU A;  3GL6 A;  4X3G A;  3HCU A;  4N4F A;  3GV4 A;  1LDJ B;  4LJN A;  5TBN A;  2VPD A;  2MIQ A;  1V87 A;  1FBV A;  4F52 B;  2QIC A;  3SOX A;  5C11 A;  1N87 A;  4GNG A;  5G05 B;  2Y1M A;  4A49 A;  2QIZ A;  2H0D A;  5FB1 A;  5JG6 A;  3C6W A;  2LN0 A;  2D8S A;  2MA5 A;  5TDR A;  4LAD B;  4NN2 A;  2LDR A;  3MHS A;  4GNE A;  5C13 A;  3O34 A;  4R8P K;  2KYU A;  4YBT A;  2M1R A;  5KH7 A;  3LRQ A;  5H1V A;  4GNF A;  2HYE D;  4YAX A;  2KWK A;  2VPE A;  4UP0 A;  2VJF A;  4IC3 A;  1X4U A;  3ZVZ B;  5B76 A;  1WEN A;  3L1Z B;  2ECI A;  5FB0 A;  4GND A;  3RPG C;  4A4B A;  3HCS A;  2K4D A;  5KH3 A;  1VFY A;  2KGI A;  3O33 A;  2F42 A;  3PUR A;  4MSX A;  1BOR A;  2YSM A;  2KR4 A;  3V43 A;  4I7B A;  2CKL A;  2MA6 A;  4A0C D;  4L58 A;  4FK5 A;  5LCW B;  3N9Q A;  4FJC A;  3PUQ A;  2XB1 A;  2EOD A;  4B7Y C;  3N9L A;  4IC2 A;  5AIU A;  4XI1 A;  3PHD A;  5AIT A;  3U5P A;  4BBQ A;  3HCT A;  3O36 A;  5TAB A;  2YSJ A;  1K2F A;  4ZDT A;  1WEU A;  1MM2 A;  3RTR B;  2F6J A;  3T6R A;  4UI9 B;  1FP0 A;  1Z2Q A;  3SHB A;  3L11 A;  2FUU A;  1U6G B;  4AUQ B;  5TRB A;  4V3L C;  2JMJ A;  3U5N A;  3HTK C;  1WEV A;  2M85 A;  5H1T A;  1Z60 A;  2G43 A;  2LXP C;  2IDA A;  4GB0 A;  5D1L B;  2YUR A;  4WA6 A;  2MT5 A;  2L5U A;  2LV9 A;  2YUC A;  3N9M A;  2YQL A;  2JMD A;  3I2D A;  5G0F A;  3SOW A;  4C9Z A;  1HYJ A;  4YAD A;  2Y43 A;  2KWJ A;  1WGM A;  3O7A A;  2LRI C;  1WFK A;  2BAY A;  4YC9 A;  4TKP B;  2EGP A;  4LLB A;  2L75 A;  5DIN A;  2ECT A;  2YQM A;  3ZPV E;  4A4C A;  2KWN A;  1WEQ A;  5KH9 A;  3LQI A;  4YAB A;  1CHC A;  5H9M A;  4WZ2 A;  2PUY A;  3DPL R;  4R7E A;  2HDP A;  2YHO A;  1E4U A;  5G04 B;  4FO9 A;  1G25 A;  1X4J A;  1Z6U A;  3VK6 A;  3ZTG A;  4YAT A;  3U5M A;  2E6R A;  4S3O B;  2RSD A;  4AP4 A;  5D1K B;  5DKA A;  1ZBD B;  4AYC B;  1VYX A;  2YHN A;  3EB5 A;  2MD7 B;  1VD4 A;  2KE1 A;  4CA1 A;  3N9P A;  2ECV A;  2JRJ A;  3O70 A;  2PNX A;  4N3W A;  2LXH C;  1XWH A;  2FUI A;  3O37 A;  2C2L A;  4ZQL A;  4W4U A;  3KNV A;  2F6N A;  4P5O B;  4V3K C;  1X4I A;  4CCG X;  1WEP A;  4AVX A;  1DVP A;  1LDK C;  3ASL A;  3ZPV 1;  2KU3 A;  4I7D A;  3T7L A;  2AN6 A;  4ZUX U;  2L43 A;  2YW8 A;  3C5K A;  2FSA A;  2LGL A;  1WEM A;  2YT5 A;  4WZ0 A;  4PPE A;  2VNF A;  4YBM A;  3SOU A;  2VPG A;  4S3O C;  4AYC A;  2KFT A;  3ZYQ A;  2KGG A;  2KRE A;  5I3L A;  2Y1N A;  1HYI A;  3N9N A;  3LQJ A;  2ECG A;  5B8D A;  3KQI A;  2JMI A;  4FIP A;  2L80 A;  3N9O A;  5LKT A;  3RPG B;  5B78 A;  2XEU A;  1MM3 A;  3QZV A;  5H1U A;  3IHP A;  4PTB A;  1F62 A;  2LGK A;  2DX8 A;  3ZNI A;  2M6M A;  3LQH A;  2ECN A;  2K16 A;  1WEW A;  2MNY A;  5B79 A;  1IYM A;  2CKL B;  2QJ0 A;  2ECW A;  5EYA F;  2C2V S;  3M99 A;  4I7C A;  2I50 A;  2VJE B;  3O35 A;  4O64 A;  2VP7 A;  2CSZ A;  4B86 C;  1RMD A;  2YU4 A;  3EB6 A;  2CT2 A;  4R2Y A;  3NG2 A;  4Q6F A;  4LKA A;  2UZG A;  2MD8 C;  3ZVY A;  4YBS A;  2K17 A;  1JM7 B;  3FL2 A;  1WEO A;  4QF2 A;  3MHH A;  4MVT A;  5D1M B;  3M63 A;  2EA6 A;  2VPB A;  5LKX A;  2G6Q A;  3KV5 A;  3U5O A;  5FEY A;  2M3H A;  5B75 A;  2K1J A;  2KIZ A;  2MNZ A;  2VJE A;  5J3X A;  3M62 A;  2YRE A;  1WES A;  2MUM A;  3DQV R;  5B77 A;  5LKZ A;  2RI7 A;  2E6S A;  2NAA A;  4L7X A;  5FER A;  2H0D B;  4WZ3 B;  2G45 A;  4QF3 A;  1WE9 A;  4LK9 A;  2LGG A;  1T1H A;  1WIL A;  1JM7 A;  2YYR A;  2OXQ C;  1WIM A;  3KV6 A;  5TDW A;  2CSY A;  4BHW A;  2LQ6 A;  2ECJ A; 
#chains in the Genus database with same CATH topology
 2L0B A;  2ZET C;  1WEE A;  2KWO A;  3L1X A;  1JOC A;  2VJF B;  2LGV A;  4UP5 A;  5LKU A;  3GL6 A;  4X3G A;  3HCU A;  4N4F A;  3GV4 A;  1LDJ B;  4LJN A;  5TBN A;  2VPD A;  2MIQ A;  2E61 A;  1V87 A;  1FBV A;  3MDB C;  4F52 B;  2QIC A;  3SOX A;  2KKY A;  5C11 A;  1N87 A;  4GNG A;  5G05 B;  2Y1M A;  4A49 A;  3FM8 C;  2QIZ A;  2H0D A;  5FB1 A;  5JG6 A;  3C6W A;  2LN0 A;  2D8S A;  2MA5 A;  5TDR A;  4LAD B;  4NN2 A;  2LDR A;  3MHS A;  4GNE A;  5C13 A;  3O34 A;  4R8P K;  2KYU A;  2FFW A;  4YBT A;  2M1R A;  5KH7 A;  3LRQ A;  5H1V A;  4GNF A;  2HYE D;  3FAO A;  4YAX A;  2KWK A;  2VPE A;  4UP0 A;  2VJF A;  4IC3 A;  1X4U A;  3ZVZ B;  5B76 A;  1WEN A;  3L1Z B;  2ECI A;  5FB0 A;  2L7P A;  3M7K A;  4GND A;  3RPG C;  3LDY A;  4A4B A;  3HCS A;  2JM3 A;  2K4D A;  5KH3 A;  1VFY A;  2KGI A;  3O33 A;  2F42 A;  3PUR A;  4MSX A;  1BOR A;  2YSM A;  2KR4 A;  3V43 A;  1DCQ A;  1MBM A;  4I7B A;  2CKL A;  2MA6 A;  4A0C D;  4L58 A;  4FK5 A;  5LCW B;  2CRW A;  2D8U A;  3N9Q A;  4FJC A;  3PUQ A;  2XB1 A;  2EOD A;  4B7Y C;  3N9L A;  4IC2 A;  5AIU A;  4XI1 A;  3PLW A;  3PHD A;  5AIT A;  3U5P A;  4BBQ A;  3HCT A;  3O36 A;  5TAB A;  2YSJ A;  1K2F A;  4ZDT A;  1WEU A;  4F1P A;  1MM2 A;  3RTR B;  2F6J A;  3KDE C;  3T6R A;  4UI9 B;  2LAU A;  1FP0 A;  1Z2Q A;  3SHB A;  3L11 A;  2FUU A;  1U6G B;  4AUQ B;  5SVI B;  5TRB A;  4V3L C;  2JMJ A;  2B0O E;  3U5N A;  3HTK C;  1WEV A;  2M85 A;  5H1T A;  1Z60 A;  2EGM A;  2G43 A;  2LXP C;  3O47 A;  2IDA A;  4GB0 A;  5D1L B;  2YUR A;  4WA6 A;  2MT5 A;  2L5U A;  2LV9 A;  2YUC A;  3N9M A;  2RR4 A;  2YQL A;  2JMD A;  3LVQ E;  3I2D A;  5G0F A;  2DSM A;  3SOW A;  4C9Z A;  1HYJ A;  4YAD A;  2Y43 A;  2KWJ A;  4OGC A;  1WGM A;  3O7A A;  2LRI C;  1WFK A;  2BAY A;  4YC9 A;  4TKP B;  5SVI A;  2EGP A;  4LLB A;  2L75 A;  5DIN A;  2ECT A;  2YQM A;  3ZPV E;  4A4C A;  2KWN A;  3FEH A;  1WEQ A;  5KH9 A;  3LQI A;  4YAB A;  1CHC A;  5H9M A;  2XOY A;  4WZ2 A;  2PUY A;  3DPL R;  3JUE A;  2CSV A;  4R7E A;  2HDP A;  2YHO A;  1E4U A;  5G04 B;  4Z0R A;  2IQJ A;  4FO9 A;  2CRR A;  1G25 A;  1X4J A;  1Z6U A;  3VK6 A;  3ZTG A;  4O62 A;  4YAT A;  3U5M A;  2E6R A;  4S3O B;  2RSD A;  4AP4 A;  5D1K B;  5DKA A;  2OWA A;  1ZBD B;  4AYC B;  1VYX A;  2YHN A;  3EB5 A;  2MD7 B;  1VD4 A;  2KE1 A;  4CA1 A;  3N9P A;  2ECV A;  3SUB A;  2JRJ A;  3O70 A;  2PNX A;  3Q1D A;  4N3W A;  2LXH C;  1XWH A;  2FUI A;  2EXU A;  3O37 A;  2C2L A;  4ZQL A;  4W4U A;  3KNV A;  2F6N A;  2P57 A;  4P5O B;  4V3K C;  1X4I A;  4CCG X;  1WEP A;  4AVX A;  1DVP A;  1LDK C;  3ASL A;  3T9K A;  3ZPV 1;  2KU3 A;  4I7D A;  3T7L A;  2AN6 A;  2M13 A;  4ZUX U;  2L43 A;  2YW8 A;  3C5K A;  2CON A;  2FSA A;  2LGL A;  1WEM A;  2YT5 A;  4H9D A;  4WZ0 A;  4PPE A;  2VNF A;  4OGE A;  4YBM A;  3SOU A;  2MKE A;  2VPG A;  4S3O C;  2FD4 A;  4AYC A;  2KFT A;  3FJU B;  3ZYQ A;  2KGG A;  2KRE A;  5I3L A;  2Y1N A;  1HYI A;  3N9N A;  3LQJ A;  2ECG A;  5B8D A;  3KQI A;  2JMI A;  4FIP A;  2L80 A;  4QQ4 A;  3N9O A;  5LKT A;  3RPG B;  5B78 A;  2XEU A;  1MM3 A;  3QZV A;  5H1U A;  3IHP A;  4PTB A;  1F62 A;  2LGK A;  2DX8 A;  3ZNI A;  2M6M A;  3LQH A;  2ECN A;  3DDT A;  2K16 A;  1WEW A;  5SVX A;  3FAN A;  2JUN A;  2MNY A;  5B79 A;  1IYM A;  2CKL B;  2QJ0 A;  2ECW A;  5EYA F;  2C2V S;  3M99 A;  3E2D A;  2I50 A;  4I7C A;  2VJE B;  3O35 A;  4O64 A;  2XOZ A;  3LJU X;  2VP7 A;  2CSZ A;  2XOC A;  4B86 C;  1RMD A;  2YU4 A;  3EB6 A;  2CT2 A;  2DJA A;  4R2Y A;  3NG2 A;  4Q6F A;  4LKA A;  2UZG A;  2MD8 C;  3ZVY A;  4YBS A;  2K17 A;  2YVR A;  4Z0O A;  1JM7 B;  3FL2 A;  3DWD A;  1WEO A;  4QF2 A;  3MHH A;  4MVT A;  5D1M B;  3M63 A;  2EA6 A;  2VPB A;  5LKX A;  2G6Q A;  3KV5 A;  3U5O A;  5FEY A;  2M3H A;  5B75 A;  2K1J A;  2KIZ A;  2KKX A;  2MNZ A;  2VJE A;  5J3X A;  3M62 A;  2YRE A;  5K3Q A;  1WES A;  2MUM A;  3DQV R;  5B77 A;  5LKZ A;  2RI7 A;  3LVR E;  2E6S A;  2NAA A;  4L7X A;  5FER A;  2H0D B;  4WZ3 B;  2G45 A;  4QF3 A;  1WE9 A;  4LK9 A;  2LGG A;  1T1H A;  5SVY A;  1WIL A;  2XP0 A;  1JM7 A;  2YYR A;  2OXQ C;  1WIM A;  3KV6 A;  5TDW A;  3H7H A;  2CSY A;  4BHW A;  2LQ6 A;  2ECJ A; 
#chains in the Genus database with same CATH homology
 2L0B A;  2ZET C;  1WEE A;  2KWO A;  3L1X A;  1JOC A;  2VJF B;  2LGV A;  4UP5 A;  5LKU A;  3GL6 A;  4X3G A;  3HCU A;  4N4F A;  3GV4 A;  1LDJ B;  4LJN A;  5TBN A;  2VPD A;  2MIQ A;  1V87 A;  1FBV A;  4F52 B;  2QIC A;  3SOX A;  5C11 A;  1N87 A;  4GNG A;  5G05 B;  2Y1M A;  4A49 A;  2QIZ A;  2H0D A;  5FB1 A;  5JG6 A;  3C6W A;  2LN0 A;  2D8S A;  2MA5 A;  5TDR A;  4LAD B;  4NN2 A;  2LDR A;  3MHS A;  4GNE A;  5C13 A;  3O34 A;  4R8P K;  2KYU A;  4YBT A;  2M1R A;  5KH7 A;  3LRQ A;  5H1V A;  4GNF A;  2HYE D;  4YAX A;  2KWK A;  2VPE A;  4UP0 A;  2VJF A;  4IC3 A;  1X4U A;  3ZVZ B;  5B76 A;  1WEN A;  3L1Z B;  2ECI A;  5FB0 A;  4GND A;  3RPG C;  4A4B A;  3HCS A;  2K4D A;  5KH3 A;  1VFY A;  2KGI A;  3O33 A;  2F42 A;  3PUR A;  4MSX A;  1BOR A;  2YSM A;  2KR4 A;  3V43 A;  4I7B A;  2CKL A;  2MA6 A;  4A0C D;  4L58 A;  4FK5 A;  5LCW B;  3N9Q A;  4FJC A;  3PUQ A;  2XB1 A;  2EOD A;  4B7Y C;  3N9L A;  4IC2 A;  5AIU A;  4XI1 A;  3PHD A;  5AIT A;  3U5P A;  4BBQ A;  3HCT A;  3O36 A;  5TAB A;  2YSJ A;  1K2F A;  4ZDT A;  1WEU A;  1MM2 A;  3RTR B;  2F6J A;  3T6R A;  4UI9 B;  1FP0 A;  1Z2Q A;  3SHB A;  3L11 A;  2FUU A;  1U6G B;  4AUQ B;  5TRB A;  4V3L C;  2JMJ A;  3U5N A;  3HTK C;  1WEV A;  2M85 A;  5H1T A;  1Z60 A;  2G43 A;  2LXP C;  2IDA A;  4GB0 A;  5D1L B;  2YUR A;  4WA6 A;  2MT5 A;  2L5U A;  2LV9 A;  2YUC A;  3N9M A;  2YQL A;  2JMD A;  3I2D A;  5G0F A;  3SOW A;  4C9Z A;  1HYJ A;  4YAD A;  2Y43 A;  2KWJ A;  1WGM A;  3O7A A;  2LRI C;  1WFK A;  2BAY A;  4YC9 A;  4TKP B;  2EGP A;  4LLB A;  2L75 A;  5DIN A;  2ECT A;  2YQM A;  3ZPV E;  4A4C A;  2KWN A;  1WEQ A;  5KH9 A;  3LQI A;  4YAB A;  1CHC A;  5H9M A;  4WZ2 A;  2PUY A;  3DPL R;  4R7E A;  2HDP A;  2YHO A;  1E4U A;  5G04 B;  4FO9 A;  1G25 A;  1X4J A;  1Z6U A;  3VK6 A;  3ZTG A;  4YAT A;  3U5M A;  2E6R A;  4S3O B;  2RSD A;  4AP4 A;  5D1K B;  5DKA A;  1ZBD B;  4AYC B;  1VYX A;  2YHN A;  3EB5 A;  2MD7 B;  1VD4 A;  2KE1 A;  4CA1 A;  3N9P A;  2ECV A;  2JRJ A;  3O70 A;  2PNX A;  4N3W A;  2LXH C;  1XWH A;  2FUI A;  3O37 A;  2C2L A;  4ZQL A;  4W4U A;  3KNV A;  2F6N A;  4P5O B;  4V3K C;  1X4I A;  4CCG X;  1WEP A;  4AVX A;  1DVP A;  1LDK C;  3ASL A;  3ZPV 1;  2KU3 A;  4I7D A;  3T7L A;  2AN6 A;  4ZUX U;  2L43 A;  2YW8 A;  3C5K A;  2FSA A;  2LGL A;  1WEM A;  2YT5 A;  4WZ0 A;  4PPE A;  2VNF A;  4YBM A;  3SOU A;  2VPG A;  4S3O C;  4AYC A;  2KFT A;  3ZYQ A;  2KGG A;  2KRE A;  5I3L A;  2Y1N A;  1HYI A;  3N9N A;  3LQJ A;  2ECG A;  5B8D A;  3KQI A;  2JMI A;  4FIP A;  2L80 A;  3N9O A;  5LKT A;  3RPG B;  5B78 A;  2XEU A;  1MM3 A;  3QZV A;  5H1U A;  3IHP A;  4PTB A;  1F62 A;  2LGK A;  2DX8 A;  3ZNI A;  2M6M A;  3LQH A;  2ECN A;  2K16 A;  1WEW A;  2MNY A;  5B79 A;  1IYM A;  2CKL B;  2QJ0 A;  2ECW A;  5EYA F;  2C2V S;  3M99 A;  4I7C A;  2I50 A;  2VJE B;  3O35 A;  4O64 A;  2VP7 A;  2CSZ A;  4B86 C;  1RMD A;  2YU4 A;  3EB6 A;  2CT2 A;  4R2Y A;  3NG2 A;  4Q6F A;  4LKA A;  2UZG A;  2MD8 C;  3ZVY A;  4YBS A;  2K17 A;  1JM7 B;  3FL2 A;  1WEO A;  4QF2 A;  3MHH A;  4MVT A;  5D1M B;  3M63 A;  2EA6 A;  2VPB A;  5LKX A;  2G6Q A;  3KV5 A;  3U5O A;  5FEY A;  2M3H A;  5B75 A;  2K1J A;  2KIZ A;  2MNZ A;  2VJE A;  5J3X A;  3M62 A;  2YRE A;  1WES A;  2MUM A;  3DQV R;  5B77 A;  5LKZ A;  2RI7 A;  2E6S A;  2NAA A;  4L7X A;  5FER A;  2H0D B;  4WZ3 B;  2G45 A;  4QF3 A;  1WE9 A;  4LK9 A;  2LGG A;  1T1H A;  1WIL A;  1JM7 A;  2YYR A;  2OXQ C;  1WIM A;  3KV6 A;  5TDW A;  2CSY A;  4BHW A;  2LQ6 A;  2ECJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...