4FO9A

Crystal structure of the e3 sumo ligase pias2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
282
structure length
261
Chain Sequence
QGQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLATCPQEDNYPNSLCIKVNGKLFPLPGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKIRNPDHSRALIKEKLTTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEGSWCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the E3 SUMO Ligase PIAS2
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase PIAS2
total genus 60
structure length 261
sequence length 282
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fo9A01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fo9A02
4S3OC 1WEEA 3O35A 2FUUA 4A0CD 2L80A 4V3LC 2YUCA 4C9ZA 1IYMA 2VNFA 2K16A 2MD7B 4YBSA 3MHHA 4AVXA 2L43A 2EODA 4X3GA 1V87A 2G45A 5FEYA 4UI9B 5AITA 5EYAF 4WZ0A 2G6QA 3KNVA 3SOWA 2M6MA 3IHPA 4UP0A 2F42A 2RSDA 4B7YC 4YBMA 3T6RA 2YT5A 3KQIA 5JG6A 3U5OA 5B75A 2LQ6A 2MT5A 5TDRA 2LGLA 2F6JA 5D1KB 2KYUA 2KWOA 2YQMA 5DKAA 4IC2A 3LQIA 1XWHA 3PURA 2PNXA 2QJ0A 2KGGA 4AYCB 2K4DA 2I50A 3O33A 4XI1A 1Z6UA 2KWNA 2XEUA 3O36A 4I7BA 3SHBA 3I2DA 4YBTA 2D8SA 5J3XA 5D1LB 1CHCA 4N4FA 3T7LA 4WZ3B 2MD8C 5TRBA 2VPBA 2EA6A 2ECTA 2UZGA 4YC9A 2KREA 4WA6A 4I7DA 1X4IA 1Z2QA 3N9NA 3M63A 4YABA 2FUIA 2YREA 2H0DA 2K1JA 3O37A 2MNYA 1WEWA 3HCSA 4MSXA 5C13A 2VJFB 5H1UA 4S3OB 4N3WA 2LXPC 5G0FA 4GNFA 2E6RA 2YQLA 3LQHA 4GNEA 3SOUA 2AN6A 1JM7B 2LGVA 5H1TA 2VJEA 1E4UA 4YATA 2LXHC 3ZNIA 5FB0A 5H9MA 4IC3A 4LJNA 2CT2A 2L0BA 2KR4A 3HCTA 2K17A 1G25A 4GNGA 1WEUA 3FL2A 2VP7A 5D1MB 5I3LA 4BBQA 2OXQC 4B86C 5LKXA 3N9OA 3NG2A 4O64A 4R7EA 2EGPA 2YURA 5FERA 4CA1A 2L75A 3ZVYA 2KGIA 2YSJA 2ECIA 4PTBA 2FSAA 3L1ZB 2LDRA 1JOCA 4LK9A 2LRIC 3MHSA 2LV9A 4P5OB 5B77A 1RMDA 3N9PA 2LGGA 4WZ2A 1LDKC 3V43A 3M99A 1VYXA 1DVPA 3GL6A 5DINA 3HCUA 4ZDTA 4ZQLA 3LRQA 2Y1MA 1VFYA 1MM2A 4L7XA 3DQVR 2CSZA 4FIPA 2YU4A 4L58A 5LKTA 4QF3A 1WIMA 2ECNA 1F62A 2YSMA 2ECVA 2ECGA 1WFKA 2QIZA 2JRJA 2JMIA 2C2VS 4YAXA 2RI7A 2DX8A 2HYED 3N9MA 2MNZA 3SOXA 4A4CA 2F6NA 2CKLA 2YYRA 2KWKA 2Y43A 3O70A 5LKZA 1BORA 2MUMA 1FBVA 2G43A 3VK6A 3PHDA 1WEQA 3HTKC 2QICA 4NN2A 4AP4A 2KU3A 4FJCA 2JMJA 2HDPA 5KH3A 4A4BA 4F52B 5TBNA 5G04B 5B8DA 5KH9A 2VPDA 5TDWA 4QF2A 3ZTGA 4LLBA 2M3HA 3GV4A 1VD4A 2LGKA 1N87A 5TABA 3C5KA 4LADB 3RPGC 3PUQA 4AYCA 4BHWA 1K2FA 1HYIA 3O7AA 3ZYQA 3DPLR 1X4JA 4I7CA 1MM3A 2CKLB 2VJFA 4PPEA 2NAAA 1WEMA 5C11A 4V3KC 5AIUA 4R2YA 1X4UA 2KE1A 3L11A 5B79A 2JMDA 2YW8A 1WEPA 3EB5A 3LQJA 2ECJA 2MA5A 1WENA 3EB6A 2YHOA 2M85A 5LCWB 4TKPB 3KV6A 2KIZA 3KV5A 4ZUXU 4LKAA 3ZPV1 2VPEA 4GNDA 3C6WA 5LKUA 1T1HA 1WESA 2XB1A 4GB0A 1WEOA 1WGMA 3M62A 1FP0A 3ZVZB 4AUQB 1JM7A 3U5PA 2MA6A 2VJEB 4UP5A 2L5UA 2VPGA 3N9QA 5KH7A 2KFTA 4FO9A 2ECWA 3RTRB 1HYJA 2C2LA 2ZETC 1WILA 3ZPVE 4FK5A 3QZVA 2IDAA 2MIQA 5B76A 1U6GB 3U5MA 2H0DB 1LDJB 1WEVA 2KWJA 5H1VA 1Z60A 3O34A 2CSYA 5B78A 3U5NA 5G05B 4A49A 3RPGB 2PUYA 4CCGX 2YHNA 3N9LA 3L1XA 4YADA 4W4UA 2BAYA 4Q6FA 1WE9A 3ASLA 5FB1A 2Y1NA 4R8PK 2E6SA 1ZBDB 2LN0A 2M1RA 4MVTA
chains in the Genus database with same CATH superfamily
3LJUX 1WEEA 4MXWB 3POJA 4RS5A 1RYYA 1MR5A 4AFAA 4LBKA 3KF3A 2XHKA 3NKTA 4I0AA 2IVJA 3PUSA 3AX4A 2XL7A 3M2MA 5LY2A 1FV2A 2WNVB 3OSDA 4W50A 4C0BA 2ZGQA 4U2AA 1G6NA 4QQOA 3QH6A 2L43A 2EODA 4EJRA 5GLVA 3FEHA 4ATFA 2WABA 1RUD1 1SBEA 2NZ9A 2WQ8A 4AEKA 1FXZA 5LK7B 4YGEA 4BHPA 3PMSA 4D94A 4M3CB 1WKYA 4Y20A 4PF1A 4UFJA 4UI9B 1ND2A 1SCSA 2P17A 5FEYA 4JRLA 2PXJA 1C8M1 1UZVA 2XJSA 1FATA 4HL0A 5T3NA 4NRMA 4Q4Y3 1YFXA 5FXVA 4IEZA 1O3SA 1CONA 1W6PA 2NLRA 1MEC3 2QNKA 5CZKA 1SLLA 4KL1A 3VKMA 5IVEA 2JDKA 4IEVA 1LHWA 2IWGB 1R081 2VQTA 1QJU2 1Z78A 4XXPA 4DXRA 4GJYA 4YVSB 1BMV1 3ZYPA 4LTAA 4Q0QA 4XDPA 4CSWA 5CBLA 3AC0A 4R8HA 2ZZJA 3M3CA 5F5CA 3GHNA 3PMEA 4UP0A 4H7MA 5DUWA 3O0WA 4XFBA 2WFF2 5FBZA 1JZ8A 2PA7A 4CCKA 5IFPA 3H8RA 1LGNA 3Q8CA 4XJ8A 4I30A 3W9AA 4C1XA 5FZ8A 4PLNA 2RSDA 4FQ4A 4Q2FA 1DQ1A 3K4ZA 4Q4X1 2RS31 1VRH2 2VE1A 3R0RA 3NNLA 1AYM1 4CCDA 1RUJ2 5KC6A 1MQTC 4Q4X2 3UESA 3TNPB 3ZOIA 3R05A 4KWLA 4MGIE 2XMLA 2W87A 3VBFB 2XL9A 4CXYA 1UY0A 1E57A 1VBB1 5FMDA 5FY5A 1F5FA 1PVC1 4DRVA 5K4LA 1W2AX 1JTZX 4PHZA 2HBUA 3BCWA 2PQQA 3LEGA 2ZGPA 2H6BA 1D0GA 1QXJA 2QZ3A 1UIJA 2B45X 2DCYA 1NX9A 2WZR2 2G19A 3K75B 1GZWB 4FPKA 4JCKA 4BQ5A 1YRZA 2X8KA 2W92A 1NOVA 4FFHA 4AFBA 2YQMA 5IVJA 2W1QA 2PHRA 4YW2A 2HEWF 2JG9A 3PLQA 2RM23 1ZVFA 3FC0A 3ZKYA 2Q0AA 3ME2A 1O8PA 2ERFA 2OUHA 4RN5A 4XF3A 2J1VA 1KFUL 4XF0A 3BIWE 1NXD1 4R4ZA 2KGGA 2GNTA 4AYCB 1ULPA 2YBSA 3VBSA 4YW5A 3QLQA 3AMMA 4J6GA 2A5ZA 3I59A 4AZZA 2P3JA 4WM7A 1UOGA 2RG4A 1Z6UA 3BPZA 3M70A 5ACA2 2VMGA 4QPGC 1ND3B 3S57A 4A7ZA 3O0VA 3W59A 4BLJA 4UW3A 4DEVA 5DDJ2 1WCDJ 1RUH1 4NHKA 5CNAA 4YBTA 4Y33A 3IN9A 1NT0A 4OULA 5FZLA 4E2GA 4HG6B 3CLPA 4XCAA 4ORFA 3E1F1 3CF6E 5JIAA 4YFWA 2ORXA 3JB4C 2DSMA 2JG8C 1UOJA 5JOZA 4P9IA 1L7LA 1F8VA 3CDZB 1APNA 4GAZA 3R4DB 2JB8A 1W6QB 2XOZA 2R7EB 3PTYA 1GWKA 4I7DA 1X4IA 3A7QA 5LK5A 4AEDA 4AVAA 5HXVA 4FPCA 4J25A 1SLIA 2VMDA 3ZYRA 2FUIA 2JDPA 2K1JA 2HWC2 5HV4A 1FMD3 4H2AA 1LU2A 5FCCA 2FFWA 3OBAA 5FY8A 5IK7A 1QIQA 1VB4A 4OHVA 2P6CA 3MV11 2W47A 4LIVA 1UKRA 4PDWB 3WLUA 2WYSA 1R091 2GMEA 5EJZB 2WIIB 3HIFA 3SKVA 4C91A 1PK6B 1UOBA 2VTFA 3GHMA 1VE0A 4A41A 4QPYA 4DFSA 4FP3A 2RV9A 1BEV3 4R52A 5JOWA 2YPDA 1RUF2 2ZHKA 2LXPC 5KHHA 1CX4A 1SFNA 1HB3A 5FZMA 1QWRA 4EWEA 4FPGA 1HV1A 4LLFA 3U78A 5AC91 5HBAA 1WCSA 4DY5A 2DCZA 2WQ4A 4ISRA 1I1EA 4GNEA 2ZX3A 2EA7A 3U37A 4P02B 2AN6A 3K46A 2WWSA 2PHTA 5K0UB 5H1TA 2UYBA 1E4UA 3N7MA 2HJIA 4LQRA 1I3HA 2ZX2A 1AYM3 3KT1A 4JQTA 4EE2A 2LXHC 2ZCWA 2PLV2 2Y0OA 3KCXA 1S55A 1LECA 3E6BA 1IPJA 4FPEA 4IL7A 4IE7A 2Y8KA 4PF5A 5CKNA 2D8UA 3NVCA 1XSRA 4NR1A 1YQ5A 3WQ0A 1H1MA 2CY6A 3CJIB 3NNGA 3NSTA 4QXHA 1RHI3 2EALA 4XURA 2BU9A 4N53B 1REDA 4YG6A 5DDJ1 5C7GA 4XFIA 1XE8A 5FYTA 3EHKA 1L7QA 3ZX7A 3E5XA 4YVWA 5FZHA 1JYVA 2R30A 5DAPA 4Y5Z0 1O3TA 1IPKA 5C8WA 4C90A 3X29B 5JSRA 3BB6A 4LA3A 3WQ7A 5FY9A 4M3CA 3AZZA 2YGMA 4WVWA 3LCPA 1WLCA 3CJIA 3G7DA 4CP1A 3F2ZA 4O9GA 1WEUA 1DBNA 1OF4A 2A75A 2BNNA 1BBT3 3MPBA 1IKPA 2WO3A 5FMOS 1ZZ6A 2IXIA 2VP7A 3AVRA 4Y5TA 2VNVA 1QJZA 4AW7A 1JZ7A 1GWMA 2WA4A 4QF2A 3DWDA 2R073 3AYAA 5LZ6A 4JGYB 1YIPA 1G9FA 4Y1XA 4G4FA 2JDMA 4K1YA 4V1PA 3S5AA 4Z2WA 1J3QA 3NG2A 3SISA 3ZFEC 2EGPA 2J42A 2YURA 5FERA 3CHXA 2C1FA 2YSJA 4DY3A 1QNWA 3N3HA 2K2SA 3HT1A 4XMAA 2BYVE 4H9DA 4GZ9A 1MS1A 4XJAA 4LLOA 1SFPA 4AGRA 2PHDA 2ZGOA 1VBB2 2WZR3 4CYDA 4FAGA 4BQ3A 4PTBA 1X9TA 3AYEA 4DXTA 3L1ZB 1AX2A 2JKXA 1JYTA 3BODA 2BBVA 1BVVA 1BEV1 4A6OA 4CPBD 3NRUA 3KSCA 4TXWA 3KQRA 4N9IA 3RNSA 4GQ7A 2ZGLA 4IV1B 2GP5A 5GLUA 3RZLA 1LGBA 2WNUC 2W3JA 1POQA 1GANA 4OCTA 5F9TA 2OPWA 5B77A 4BLIA 3QCWA 1CIYA 5KHKA 5K0UA 4QKNA 2P5BA 1LDKC 2LW8A 2VW2A 1XU1A 1CN1A 1DYKA 4QKFA 5FXWA 3AKSA 1LCLA 5JLVA 5E88A 1DVPA 3LA2A 5FP3A 3ZSLA 1C3HA 4ASKA 1RUC3 4O9EA 1NQDA 1K45A 2QE3A 2FD4A 3POIA 3R4UA 3MDBC 4ZDTA 5A7OA 3AMNA 3WINE 5KHJA 3AK0A 1CIWA 3B7MA 1JUHA 1GV9A 3NAPB 1UY3A 2EIGA 3OPZA 5BNPA 2B46X 1I5ZA 3MICA 5BNNC 4PLMA 2W46A 4UXAA 4TZDA 2W9XA 3OBRA 1I9RA 5F3EA 5ERLA 4DB5A 3MFCA 3GBFA 5LKTA 3U4SA 1WIMA 4FTEA 2VM9A 5FYUA 3WW4A 2ECGA 5A7SA 2JRJA 5K8SA 1GSLA 4YM3A 1DLLA 1QXRA 1G9DA 3V0AB 1YQ2A 3H7HA 5FUIA 3ZFGC 2A70A 2CRRA 5LEJA 4IESA 2NP0A 5LWBA 1QJY3 1V6JA 2Q5TA 1CAWA 4LORA 3OYWA 2W52A 3THDA 3VKNA 1S1AA 3PLWA 4R9CA 3N9MA 3IKWA 2FDKA 2MNZA 3SOXA 4YZ1A 4YGBA 2XLFA 4ARXA 5L36A 3I3BA 1YC61 2Y38A 1ZX5A 4C8DA 2YYRA 5A3UA 5C3RA 1ZRIA 3FFQA 4JGZA 3E97A 4ZS2A 2ZMNA 4CUCA 1G9AA 3O70A 4NIGA 1RUE1 1BORA 1CAWB 1PIV2 2WSVA 2W1SA 4AAXA 1NCQC 3J26N 5ABJB 4B1MA 3T0DA 1WEQA 4M3CE 3WUCA 2GNBA 4LHKA 1H9PA 1NAEA 4CEWB 1H2MA 2JMJA 5G0FA 2VOTA 3RZZA 3LIHA 1PO22 2OQ7A 1TME2 4JTOA 3FBYA 4QX1A 3ZFGB 2WRAA 1HQLA 4KMQA 2ZKNA 2F4PA 3GXUA 1CWPA 2VNRA 4QPGB 1LESA 1ASJ1 3GNEA 2P6HA 2JE8A 1RUE2 1WCQA 4IE6A 2VOWA 1H2KA 4E2QA 3VDBA 1M06G 5KH9A 2VUCA 2HWF1 3KT7A 5LBCA 4LK7A 4HSLA 5BNPB 1Q8SA 2KM2A 1B35C 1UPIA 1POV3 2RR12 1R1A3 1W2OA 3B3QE 4K1ZA 4KG8A 4KGQA 3OJBA 1MEC2 2M3HA 1K5MC 1DYPA 1AYN1 2VZTA 3AZYA 3A23A 3I3DA 3K4AA 3DPRA 4P9WA 5T54A 4FFIA 1I5PA 1QMJA 1G7YA 3LDBA 4R9BA 4H14A 5TABA 3IZOA 2LROA 5IVBA 2P3IA 3CQOA 1KXGA 3MIBA 3PVNA 5FPZA 4ZZ5A 4UW5A 2WNVC 5D8AA 1LOCA 2FD8A 4OYUA 2WT1A 5L9BA 5LRSA 1DLCA 4NPLA 2JJ6A 2EXHA 4K21A 1OA2A 4DMIA 1JI6A 4LITA 2E51A 5IUQA 5T55A 2D6OX 4K7JA 4A6SA 5JXIA 1MS9A 1K2FA 1XPWA 4Z1VA 2FCVA 1W9WA 3I3MA 3INAA 2Y6KA 4YVSA 4W8JA 2XLGA 1UZYA 2WSUA 3DPLR 1UQXA 3UGFA 3UT0A 3ACHA 4JRAA 3RZKA 1AR92 4BIFA 2C0ZA 4K6BA 1V6NA 2CKLB 2QQIA 1C8M3 1W8ZA 2ZAHA 2VECA 3PHMA 5IAVA 2NAAA 4CP9A 2QZ2A 2RS11 1JZ6A 3VD4A 3LDKA 1JYIA 2Y34A 3POFA 4LO6B 4GMP1 1HN1A 1QGLA 4IEUA 5KHGA 2J1AA 1E5IA 1BBT1 3W21A 1SQ4A 3HR9A 4YG3A 3T4HB 1X8EA 3OY8B 4QPIC 1HRI3 2VZ3A 5L73A 1WEPA 2QVSB 4AVSA 3WF3A 4HETA 4AQSA 1EAH2 4F1PA 5C3PA 2I07B 5KXCA 4WVZA 2F17A 4CEYB 5D8AC 4BQXA 3JBG1 5KC5A 3VKFC 4P9YA 3ILNA 2FDGA 1COV2 3K48A 4KWJA 1RHI1 2M13A 4XHBA 5FZDA 4CUAA 2PQSA 2RR13 2UWAA 4BQ2A 2DCKA 3B01A 1IZ3A 4Q4Y2 4B1LA 3WUDA 4CXWA 5HXMA 2YU1A 5FZ7A 3DPRC 1MS8A 4N53A 4GA9A 1LOAA 5C3OA 5JIUA 2XVLA 2WINB 3CMGA 2DCTA 2FQPA 4FPJA 3K3NA 3VHOA 2XUEA 1A3KA 4BQYA 3C8XA 1Q56A 3UKNA 4QM9A 5E16A 5FOJB 3WOGA 1PM4A 1SLBA 4M4RA 3VBRB 5L7OB 1WESA 3KVBA 1WGMA 3M62A 4LOSA 3BN6A 4JGYC 1PO23 2XOCA 2V5DA 1MACA 1Q8OA 2R0FA 3S30A 2MA6A 1QJY1 5APAA 4OQ8A 3WSOA 4Q1PA 4TLGA 1PGW1 4JGYA 1H30A 4NIIA 1AR71 2Q1MA 4E2SA 4D7YA 4FO9A 4OUMA 4EROA 1PZ9A 1XNKA 4EZHA 1VBE3 5H9PA 3HQXA 5HCBA 1HYJA 1BXHA 2E9QA 2R1BA 4Q4V3 4DNYA 1UU6A 3U1XA 1NCQA 4AE2A 3QZVA 2AH2A 3AKRA 5A32A 4Y1ZA 4E4SA 1DU3D 3C2UA 1W6OB 4BCUA 4I2OA 2G4IA 5B76A 1AZDA 1TZOA 2WNEA 5IFTA 1FPN3 3CL1A 5DAWA 5GALA 2H0DB 1LDJB 1W8FA 4RD7A 5A7PA 2VAUA 1Z60A 4OI4A 4LKEA 2X29A 4ZU7A 4QQHA 1ZBA2 3AB0A 1KDMA 4ONUA 1NE4A 2I45A 1CPNA 1AR82 4GULA 5J09A 4LUKA 4FOQA 5G05B 4ASLA 1IKQA 2VPVA 4B7EA 2YHNA 3N9LA 1OFSA 2OXBA 5FMOL 1QU0A 1V00A 1VAVA 2VCBA 3H1YA 5A1AA 3KLSA 2BERA 2IUWA 1WE9A 2RS32 2ZOEB 2HWE1 5FB1A 5ABJA 3T0BA 3VZMA 2ZHLA 5FYBA 1MM2A 2Y1NA 3VZKA 4R8PK 3KZ4C 3A4UA 3MIFA 3OG2A 1TMF1 2YU2A 1G8WA 4X8NA 3TNQA 3BUCA 1ZRRA 1ZBDB 1YIFA 2R043 5FO8B 2LN0A 1VP6A 4FSJA 2M1RA 3B94A 1J3RA 1V6OA 1RVF3 4MVTA 3RWKX 1QXPA 2VW0A 1A6CA 5I91A 1ZZBA 1HRV2 2V72A 1H9WA 5FP8A 3NWKA 1C57A 4A0CD 1YJKA 4IEPA 3ECQA 3LE0A 1AL23 2Z2SB 4FCAA 1H8VA 4QX8A 4SLIA 3H8UA 3F95A 1W28A 2K16A 2VNFA 1XSQA 4ES8A 2MD7B 3J8F3 1HJGA 2IXJA 3K77A 2ZMKA 4HVQA 2JDAA 4XDOA 1ASJ3 1WW4A 2OWAA 5K0UC 4AVXA 5FO9B 1HXS1 1BVP1 4X3GA 2Y64A 3ZPOA 3SMHA 4ASMB 1P8JA 1VBB3 2GC2A 1OUXA 3I59B 3M1HA 4LLBA 1UW8A 5AITA 3O14A 4PIZA 5A32B 3RDIA 1DQ0A 3JCIA 4ATEA 3I2OA 1HQWA 3GF6A 4JV4A 2RS13 2ZGRA 4NO4A 5A3TA 3ZXAC 1M4WA 4CDXC 2HWD3 4WZ0A 2G6QA 4KWKA 2NQYA 3DKWA 5CKMA 1OBNA 1R093 1A34A 1H8TB 1OOPA 2AEYA 4NOTA 2EIDA 2VD7A 2YG0A 3APBA 1HRI1 1TE1B 3RMXA 1ND2B 3USUA 3LEKA 1W8UA 1C4RA 2R16A 1J83A 4NAMA 1GWLA 2QFEA 4QMAA 5C5TA 1HW5A 1XU2A 2AUYA 1PGL1 4LO4B 4QXBA 5F37A 4JVAA 4E4HA 3DXTA 2PLV3 2VBBA 3OGGA 3HVDA 4YRDA 5D1IA 4B7YC 1D0HA 2VUJA 5F6LB 3OTFA 1Y9GA 4E9KA 4YBMA 1RITA 3IDAA 4Q4V2 4UWDA 4YW6A 5FAXA 1N1SA 3UV9A 3WNXA 5FJHA 3VLBB 1ZA7A 1W2NA 2BGCA 2PFWA 4CCNA 3UNPA 3I2IA 5JG6A 1FNZA 3DL3A 3U5OA 4JGZC 2LQ6A 2QQJA 1VBC2 3U14A 3DEMA 1W99A 3DKQA 2PAMA 2RHPA 3U75A 5TDRA 2BBAA 3AXEA 4LULA 4AGVA 1U5XA 4DPNA 5I93A 1WGPA 4QQ2A 2OX0A 5F32A 4AEDC 2DFBA 3ASIA 5JCTA 2BUKA 3J8F2 2KYUA 1E5SA 5A80A 1W8HA 2AGSA 3AZXA 1GU3A 3MW2A 4N43A 5DKAA 2EIBA 4JDMA 2Q8OA 5FZAA 2XGXA 1XWHA 1Z7S3 4L99A 5T50A 2PNXA 1MPXA 1PO12 4P9XA 1DGWA 2C9AA 2GP3A 3G6JB 4GKXA 5IATA 5K7PA 4LOTA 3B69A 2I50A 4A45A 2OKXA 2MPFA 4XI1A 3NL1A 1XNTA 4GD4A 4AEJA 4BK5A 4YM1A 1W0NA 3WG2A 5IYYA 3O36A 2BVBA 5JZGA 5D1LB 4EN0A 3LSDA 3RWNA 4I7BA 3IT8A 4FBFA 1AHSA 4LUMA 5CISA 1VBD1 2TNFA 4E8CA 1JN2P 2ARAA 4YVWB 2XH6A 3T7LA 2JECA 2WZR1 4WZ3B 3B93A 1IOAA 2ZEXA 5TRBA 4F3JA 3C7FA 1X36A 2VR4A 1WZXA 2ZABA 4Y3OA 1X50A 2W94A 4Y22A 2EA6A 2ECTA 5D8AB 5DN2A 5EYYA 3P3NA 4X6QB 5GZEA 5F8PA 1VBA3 1W2UA 1GLHA 5FUPA 1JHJA 1UYXA 1PK6A 1V6MA 2Q8CA 1Z2QA 3M63A 4YABA 1B09A 5EJ3A 2H0DA 3S6PA 3MDPA 2DCJA 4COVA 4Y26A 2BWAA 1WEWA 5A7WB 3HCSA 1UL9A 4GKYA 4LO5B 4Q29A 2CNAA 3ALQA 3IWZA 4N9HA 2J1TA 2ZA9A 3CNAA 2WLQA 3THTA 4CPBA 5C9AA 4W4UA 5C13A 2PHWA 1H2NA 3L9JT 3AMPA 4YVWC 4D3WA 2VJFB 2VMIA 5FZ0A 2J7MA 4XJ9A 2MEV2 4CP9B 3H9AA 5H9QA 3IAQA 4IEOA 1PK6C 4KWUA 2PTMA 3LB9A 2A71A 4NRPA 3URFA 4XBNA 3ZXKA 2F4LA 4XEZA 4DRRA 4GNFA 3AM2A 3T2TA 1N3OA 4MX3A 2VJXA 3MIGA 3OY8A 5LATA 1R1ZA 4FOYA 4UFHA 4ET7A 1WMXA 3WVJA 4XDQA 2GNDA 2OPKA 4HKWA 2JKBA 3T09A 5A7NA 5A1FA 2LGVA 3L2HA 1KGYA 3ZSKA 4EWAA 1WLWA 2VJEA 4YATA 1ZNPA 1XNAA 4B8EA 2YUEA 1F35A 4AI9A 4P5HA 1ULGA 4IQPA 4LBQA 1CAVB 4HANA 3ZIWA 1UX6A 4HK9A 5E1RA 4AI3A 2W68A 4IC3A 5H9MA 2HLEA 3D0SA 1F9KA 2DF7A 4IW3A 4PQ9A 5FBJA 5BY5A 5JZGC 3P1IA 1AR62 2P3KA 1NE6A 4META 1PX3A 3BYWA 2L0BA 4NIHA 4DINB 4Q8LA 3N7JA 2GMPA 1F2NA 3KS7A 5FUNA 3W5NA 3VBOB 4KBZA 5C9AC 4ITCA 3SCFA 3RGBA 1DGWX 3KD4A 3ACFA 4XUQA 1AL21 2VXJA 2K17A 3HCTA 1W9TA 3AZWA 5HCAA 3JUEA 1UMZA 5FZKA 1H6YA 1QJX3 1V9U2 3J7MA 1OVSA 1RUG3 5BYNA 2ETEA 2GAUA 4SBVA 4XACA 2WO2A 3GALA 2CONA 5KXDA 1MZFA 2E31A 3HQRA 5J37A 4BBQA 1YEWA 3V0AA 1X7NA 1W03A 1FT9A 4PJYA 3PJQA 2D6KA 1JHNA 1VPHA 4AG4A 4J1XA 3TEZA 3MUY1 1ODNA 1OQ1A 1U12A 2H0VA 4XTPA 1VBE2 2R6QA 1XQNA 2JM3A 1COV3 4CA1A 3MGUA 4AF9A 4UF0A 2KGIA 4FTBA 5FZOB 1FPN1 3ON7A 1LB2A 1W6OA 1LJ7A 3IDEA 4RHV2 4G3YC 2ILMA 4AVVA 1UCXA 2WDBA 3FHIB 3QH7A 1X9PA 4RL7A 4JGZB 1AUYA 5IW0A 1CPMA 5EV7A 4AFMA 1POV1 1FNYA 4QX7A 5FYSA 1Q8PA 5LW9A 2IFRA 4QDRA 1WW7A 2AACA 2LRIC 1GNZA 5FRAA 1D2QA 2OZ6A 4BA6A 2RDQA 2UY9A 3ORJA 4HZFA 4QDQA 5D2AA 1LULA 2Q1FA 1HN0A 2P2KA 3U11A 4P5OB 2D40A 3N9PA 3OF1A 2LGGA 1Y4WA 1MS3A 1SBFA 4HXCA 3RS6A 4WZ2A 4L11A 3V43A 4JDOA 3ILRA 5DAXA 3S5QA 2A6WA 1OPMA 3TRSB 1IS4A 1YQ6A 1TEIA 1VYXA 3ABZA 3LA3A 4MGQA 1O4ZA 3WW1A 3HCUA 4ZU5A 2X05A 3PJYA 1ZBE1 2JWPA 5LBFA 1Z0HA 2HBTA 3H7JA 4NHMA 4XZUG 4DIQA 3LRQA 3RPQA 1WWYA 1RUE3 1S4CA 3SEPA 2N7GA 2XBO1 4IXLA 1NQJA 1O4YA 3PUIA 5FYYA 2W08A 2BZDA 3GZEA 3SH5A 1BZWA 4B4RA 2WS92 1UOFA 2Z69A 1WMEA 1W9FA 5C5UA 5KR7A 3DQVR 3VDDA 2E53A 4NAOA 1UU4A 1RL3A 1SPPA 2YY1A 3FUQA 1NXMA 1F62A 2E26A 3O1RA 3JD71 3S7IA 2WT2A 4YZ3A 4CTEA 3SCHA 2YSMA 2FCTA 4XIKA 1W05A 1Y7BA 2PAKA 1MVQA 4YW3A 2XJUA 1ZRDA 1EUUA 3LOIA 1MQTB 1FOD2 2C2VS 5FLJA 2CSVA 3LZZA 5D21A 4N43C 2RI7A 4QWNA 2VBPA 3AKQA 1V6KA 2GC0A 2SBAA 2X09A 3HN1A 5EWSA 2RJLA 4O7XA 2DX8A 3HQUA 3AYCA 4LR4A 2WBKA 1YCIA 1PX4A 3BALA 3KT4A 5T5JA 3NAPC 5JPMB 4XBLA 4RQPA 1GZ9A 4A4CA 5GLWA 3KHBA 3AFGA 1UZZA 3GBWA 5FQ0B 2F6NA 4CE8A 4FTSA 2CKLA 4IV3A 2KWKA 4IDZA 1QQP3 3E6DA 2XDVA 2FCUA 1YYNA 3OGRA 2EGMA 1WCKA 5JOXA 3VK6A 3KCYA 1AVBA 3PHDA 1OQDA 3T2QA 1GKBA 3HTKC 3TYJA 1QOSA 3WCRA 2KU3A 2ZXQA 4GIQA 4RR3C 4DQAA 4Q8KA 5FDBA 2AREA 4WM8B 2PHXA 2JIGA 4AGGA 1G9CA 1BQPA 2VZUA 4HKOA 4QM8A 4AR2A 4AYUA 4BMBA 4BXSV 1QJEA 1HB2A 1T2XA 4K3UA 1O7FA 4S2HA 2XWBB 3ZDVA 4QPIB 5TBNA 4HONA 5FZGA 1BMV2 4HK8A 5FKBA 3H50A 3T30A 2G1MA 2JXAA 3WNNA 2QTWB 1JU3A 5T5OA 1EAH3 1AR72 4LXLA 1O91A 4COUA 1CQ9A 4PCRA 4XHXA 1VBD2 2IXKA 1OI6A 3OUHA 3RJ2X 4Y4RA 5FPBA 5FP4A 4CDXA 1HB4A 4DO0A 5CADA 4W6YA 4FPOB 2W0XA 4CUGA 5F7UA 2YMZA 4XUTA 2LGKA 3IIAA 1G9BA 3GZUC 3AMHA 1G86A 1PZ7A 5CA6A 2VZOA 3LVRE 3FLTA 1RUD2 4BQWA 3Q8AA 3RPGC 4H7LA 1NA1B 3J4UH 1RTVA 2RS51 3PUQA 4G9SB 4IEQA 4UBGA 4MLOA 4Z8BA 4GMP0 4OHYA 2VC9A 3LEIA 4XETA 3OUJA 4UYBA 2AC1A 1UY4A 2QBXA 2Y6GA 4XFCA 1JYCA 4XILA 3LAGA 2RMU2 1OKOA 4FFGA 1OLME 2JD4A 2VMCA 3FWEA 5FZBA 3O7AA 1HYIA 4GWNA 1CZVA 1S0DA 3JBG2 3LA7A 3MZHA 1UAIA 1X4JA 1NCRA 5JPNB 1DZQA 1MM3A 1K5MB 4PDWA 3THCA 1VMFA 1JYWA 3HMYA 2GZWA 2HWF2 1ODMA 1W06A 5GLZA 1QJFA 2WKKA 3DN7A 3POBA 4IERA 4UI9L 1W0PA 3B9CA 1WEMA 4PPEA 2XVGA 3B9IA 2VMFA 4BM8A 5BNQA 1GQPA 1NY72 3GDBA 1RUI3 4RFT0 1IPSA 1Q43A 2RDNA 4IETA 4WZFA 4JKKA 3HJRA 4Z2AA 3VD3A 5KWRA 5B79A 1TNFA 3N36A 3L11A 1KDKA 1QJX1 2R061 1W8WA 5G04L 3I3EA 4GXLA 3HAGA 2YW8A 1J3PA 1A78A 4FXKB 2UWCA 3CBNA 2A3WA 1OC1A 1AR91 4XE9A 2R062 4JTNA 1SHWB 3EXUA 4L8QA 4A3ZA 5M0TA 2MA5A 5K3QA 3A0KA 1DCQA 3EB6A 2XHNA 1H4GA 2WWJA 4TTGA 2VCAA 2YHOA 2P37A 4E8DA 1GZWA 5BNNB 3ZFEB 2ZX4A 3Q8FA 3KV6A 1C5IA 2KIZA 2OW4A 5C71A 5SVIA 2QQKA 2LRPA 3VBOC 1OT5A 3DDTA 3FE5A 1WLTA 1EPZA 4MHUA 4PI2A 1DZTA 1TMF3 1NCRC 2WO7A 3AP4A 3MLLA 4YARA 3RZHA 2BW8A 4M01A 5C8CA 4FPFA 3DPRB 5FR3A 1V70A 2W95A 1DQ2A 4CP2A 2BFUL 2VPEA 2YDEA 1RXGA 3OEBA 4D7SA 1J84A 1D7PM 4J1WA 3UJQA 4QGMA 3SCGA 1RINA 3D3AA 1OH3A 4QX2A 1C8NA 3WW3A 4B4QA 1JM7A 4HSJA 2XPJA 2IXHA 4QGNA 5IK5A 1YI7A 1IS6A 3PVOA 2VJEB 4UP5A 3RJRA 1N1TA 3DYPA 3N9QA 3VDAA 4GB32 4OZOA 3M3OA 5KH7A 2PLV1 1AR93 1H1AA 1OHFA 3BTZA 1I6XA 2KFTA 3RTRB 2DU0A 1VJ2A 1RUC1 2C2LA 4MGKE 1ZM1A 1YFYA 3AP6A 4MV2A 2PELA 2H6CA 4AHWA 5A6ZA 2CYFA 1HLCA 5A3PA 5JI9A 2RDSA 2VUDA 4FK5A 3RI8A 1RJ8A 3RZMA 3I2KA 4NRQA 5A3MA 2MIQA 3ZSEA 1W6PB 1QQP2 3KGZA 1TMF2 2BOJA 2ARBA 1WEVA 3BTAA 5C70A 1O8SA 4ZY9A 1YQCA 5H1VA 4YGCA 3O34A 4X6RB 5FPVA 5A6QA 1FI2A 3H1MA 1R64A 1XB9A 2CDOA 2ID4A 4RGKA 4LBJA 4QQLA 4WVVA 5FZ6A 5AFEA 4DUWA 1YFUA 2D5HA 4LBMA 4A49A 2WNUA 4RR3B 3H3UA 4XJUA 5GM0A 1QOOA 3L1XA 2VZVA 4LEJA 2QQWA 1HIXA 3O1PA 3UK9A 3CEWA 1JZ3A 2QDRA 4MOAA 4MXWA 4N7IA 4Q4V1 2Y0IA 3NQHA 4LHLA 2J1UA 3ZO0B 1UD1A 2WZPP 1S2KA 2HH9A 4BE3A 2RS33 5I8YA 5I8SA 1B35A 4LNVA 1C28A 1J1TA 1EAH1 1AXZA 1DHKB 1QDOA 1REFA 2P4EA 5FTTC 3K51A 3U4XA 1E5HA 5SVYA 2ZS6B 3NAPA 3NW4A 1GR3A 5DZEA 3RI9A 2VH9A 5T5PA 4XJWA 2NN8A 3KM5A 5FFOC 1HRV3 1F4HA 1GZCA 2PAEA 3FL7A 4QHOA 4S3OC 4Y1UA 2A73B 2OUJA 3NNMA 1ZBA3 2CWSA 1YI9A 1RIRA 1CD3G 2TEPA 4TSVA 4ZZ8A 2L80A 4V3LC 1R083 2W1WA 4ZPIA 5FXXA 3RG0A 4AWDA 2YUCA 1PNFA 4C9ZA 1IYMA 1BHGA 3LGRA 3TAYA 1GQGA 2E7TA 4NN0A 3MHHA 5ACA1 2O14A 2WN2A 2JDHA 4P00B 4XIOA 3SHRA 2XQRA 4QKDA 3WD5A 2XJPA 4I3GA 5JMOA 2JIJA 3T1MA 4ES9A 4LO8A 2BFUS 4QHBA 4P9GA 2CGNA 4XQDA 5TSWA 1K3IA 3VBUB 1UYYA 3QACA 2DTWA 1K42A 2EVXA 2P34A 3VZOA 3UETA 3NJYA 1BYHA 2WL1A 2XBO2 4P9LA 1N3PA 1VRBA 5LASA 5JZGB 1STMA 1BK1A 5FQ0A 2QQLA 3MI8A 4DXZA 3HD8B 4K8FA 3C3VA 4XYXA 5FY7A 3KNVA 1W8OA 3WQBA 3ZVXA 4EZ4A 1BEV2 2MKEA 2BTVC 3PTRB 4NHLA 2ZKLA 4NROA 5T52A 2JICA 1EY2A 4UAPA 3PNAA 1ENRA 2XJVA 5CB7A 3WHUA 2JEMA 3ZDSA 2M6MA 4YZ4A 1US2A 3ZFFB 2Y6JA 2ZBJA 3IHPA 4Y22B 1U5IA 3B00A 4R9AA 4QX3A 5FYCA 1IQDC 4QU1A 1JH5A 3P5BA 1NG0A 3WP6A 4AXOA 1FMD2 5FZ4A 5C6CA 1AYM2 3UL2A 3HNMA 1BBT2 2BNMA 2O0OA 4NWVA 4HT1T 2ZAAA 3ZN6B 3ZYFA 4AVCA 5K9YA 1IS3A 1HDKA 1VAKA 5F5AA 2YT5A 3N4MA 3T6RA 2DVDA 1GOHA 1EYBA 1FMD1 3MIDA 1R1A1 4RHV1 3AYDA 2ZHNA 1O5LA 1OFNA 5B75A 1HX6A 3SQOA 3ZMNA 3S0MA 1IG3A 2MT5A 1GUIA 1GOGA 2BRTA 2BVVA 3FZ3A 2NMOA 1UY2A 2WT0A 4JHZA 5GZFA 1QDCA 2GNMA 4A7KA 3OGVA 4NPRA 1UYZA 4K9SA 5F2SA 1Q8VA 3ZXDA 4CDQB 2RS53 3T2PA 3WDWA 4MHRA 4D8MA 2G9FA 1UU5A 2OYZA 4HVOA 2BP6A 1DGLA 3TN92 2DYCA 2VQAA 5J7MA 1ONAA 3M7AA 1ND3A 3GBGA 2QQPA 4IC2A 3ZFGA 3LPGA 4QPWA 2ES3A 2JD9A 3ENRA 1KQRA 2WQZC 2CHHA 3GJBA 4RA0A 2K4DA 1O5UA 4XF4A 1KS5A 2JENA 3AJYA 3MF9A 4NHXA 4N7UA 4CDQA 2ATFA 2GN3A 5GZGA 5DZFA 5FY4A 2D44A 3TBDA 4AFDA 2KWNA 2HWD2 2XEUA 3OBTA 1PGW2 1FYUA 4LBQD 1MEC1 1EPWA 1K5MA 3CJXA 2WS93 3QBQA 4YG0A 3SHBA 5A7QA 1UMHA 4W6WA 5EIYB 4WM7C 3V65A 3TWIA 2D8SA 2E32A 2PYTA 4N8MA 1XYNA 4QX0A 1QEXA 3GZTB 3NKGA 3PUHA 5FYHA 4AEDB 2ZGTA 2XVKA 1W3VA 1Y9QA 3VBSB 4MADA 2MD8C 2V73A 1A8MA 3OBZA 4R4XA 3KVAA 2FDFA 1ZRFA 4RGAA 4FFFA 1QJU3 1WW5A 4FPLA 5FY0A 1JZ2A 2ZZQA 4Z82A 5A3OA 2UZGA 5C9AB 4H3WA 4P5YA 1OUSA 4OHWA 3WXPA 1NZIA 4YC9A 3M7KA 1UNBA 2KREA 2LUWA 5IVFA 4WA6A 3FHAA 4TN7A 5G05L 4BXFA 2NYYA 3VDDC 3WHTA 2RMU3 2YREA 3WF2A 2DDUA 2QUOA 1U5ZA 1VAMA 2E63A 3ITQA 3T08A 5BXXA 2MNYA 2DU1A 1PIV1 2IVIB 4MSXA 1KFXL 2B9UA 1JOPA 1KS4A 2XR4A 2V4AA 3I97A 1EP0A 2D3SA 3OD4A 4EN8B 4O61A 4BK4A 3ZPYA 4CCJA 1MVEA 2D6NA 4QQ4A 3CZJA 4W6XA 3VBRC 4CXXA 5L7OC 5D1MB 5GJ6A 3MO4A 1FX5A 1DYOA 3IDBB 3Q8EA 3POEA 5LRRA 3WP5A 4S3OB 5H1UA 4N3WA 4V2WA 1RVF2 4P14A 2VQUA 3HN3A 3JQWA 1NLSA 5CFCB 1AXYA 1H8TC 4Q4W2 1BJQA 2E6RA 2ZMLA 3WF0A 3JD73 2W39A 4WM8C 2VBDA 1JS9A 2DVGA 3SOUA 1N1YA 4E4ZA 1MZ6A 3NJVA 1YO8A 4OI1A 2VU9A 5F5IA 5FV3A 3LDYA 2CL2A 4IEYA 4CVUA 4EV0A 1W8NA 1IQAA 3M4FA 3ZNIA 1RUC2 5T5LA 2L9LA 2Z4FA 5L9VA 1ZBE3 5LY1A 3ACGA 2VY0A 2KKXA 4UFLA 1XYOA 2VL4A 2BPA2 1S0FA 2NMNA 4UBHA 2D6PA 5EXOA 5IHRA 4L92A 1CAUA 1DP0A 3HNBM 5HCFA 5KHIA 5F6KA 3EYPA 2ZX0A 2KR4A 3H0OA 5A33A 5JXJA 2HWD1 2DUPA 4S2FA 2RJ2A 3VGIA 5LCWL 4L9BA 3C7HA 3FUOA 5FP9A 5IT6A 3BIEA 1SFYA 1UZ0A 3ILFA 3NV2A 5FLIA 4AOCA 4CP0A 3JB8A 5FPXA 4GNGA 1MS4A 2YFUA 5LA9A 1Q8QA 2XOYA 4Q0PA 3FL2A 3N7LA 3R4SA 1HJFA 5I3LA 3AKPA 4AI8A 3TEXA 2OXQC 4B86C 1VB2A 2Y33A 5IVVA 1SMVA 1VALA 1SLAA 3UGGA 1MS0A 1WD4A 4LKDA 4WVMA 3N9OA 1S2EA 3IPVB 2VVDA 1OOPB 1VRH1 2HKXA 5F2WA 4R7EA 1WD3A 2LS6A 3ZR6A 2UWBA 2R041 2L75A 3H3ZA 3ZVYA 2PN5A 2VW1A 2JB4A 1VBC1 3SNMA 5FPUA 5IK8A 4IE0A 3ACLA 4AEMA 2A6ZA 4QT6A 2VGDA 3MIHA 4B3NA 4GWJA 4NVPA 1YJLA 2CAUA 1R1A2 5FZ9A 2FSAA 5AC93 3D0JA 3IPVA 2YXSA 2E7QA 3I49A 2LDRA 1JOCA 4LK9A 2DUQA 2XONA 2ZEWA 1NY71 1XYPA 4CCMA 3MHSA 1OA4A 4DS0A 2YC4A 1LU1A 1W6NA 2VZSA 3HEIA 4E4DX 4CDWA 4GB33 2AYHA 4WM8A 1MZEA 1FOD1 2B39A 4XOGA 5FZFA 2C24A 3WW2A 2XXZA 5HV0A 5I0SA 4IV1C 3VDCA 5BPXA 1RMDA 2JDUA 2EXJA 1JW6A 1TVGA 3MBWA 1VIWB 5DPNA 4WV8A 1V0AA 5FWJA 1SDWA 3CJIC 3GCXA 1Y9MA 5CVRA 1EV12 4D69A 4I0BA 3M99A 1SLCA 1KD7A 1NYWA 1OSGA 2HWB3 2ORZA 2VOVA 4XTMA 4XUPA 3VBRA 1IG0A 3ZYBA 5L7OA 3GL6A 2RMU1 3BI3A 2XG3A 3M8LA 1H6XA 2WS91 5EZWA 1TNRA 4GALA 1PMJX 3UKTA 5A3NA 5FYIA 5HI0A 2Y1MA 2YV8A 1VFYA 2KR2A 3R6SA 1MQTA 2C4XA 1WA6X 3ACIA 5B4NA 3K3OA 4YW4A 1BLZA 3AFKA 1LENA 5E8AA 5CAZA 1J59A 2CSZA 3N7KA 5H9RA 3VBHC 3EJKA 4DUVA 2YU4A 2XJQA 1ENQA 5JR2A 5KBFA 4FIPA 1OD5A 3HBZA 4LBLA 4C1WA 3VBSC 1LOEA 4QDSA 2ECVA 1RUI1 4YW1A 1CJPA 1RUNA 3JXSA 3VHRA 3O1UA 1ZREA 5FLHA 2I74A 2W5FA 2W91A 1U5YA 4XF1A 5LBBA 4YAXA 3VDDB 3WT3A 2CDPA 3I3QA 4HFSA 1WW6A 1SPPB 2BEOA 2R072 1QF3A 2EIEA 3QOPA 1SBDA 2WC2A 5F5QA 4OHZA 1UN1A 2JDZA 1OH4A 4XCBA 3VN4A 3TEYA 4QB1A 5LEKA 4L0PA 1VBD3 3IB3A 1IS5A 5JWPA 1CAXA 1FPN2 3VZNA 2Y43A 3NV3A 1OVPA 4IUGA 5JXHA 2FDHA 4YZ2A 5LKZA 2MUMA 2DJAA 1FBVA 5EP9A 2HEVF 3O0XA 2G43A 1W9YA 1WLDA 5CIRA 4BPZA 1O59A 1JU4A 2JG8B 3ZM8A 4NN2A 2Z79A 4AP4A 4IE4A 3LKJA 4FJCA 4FI9A 2DVFA 4MUVA 1LOFC 4LBNA 1L7RA 2D6LX 4JHTA 4HPKB 1XXNA 5EYXA 3WDYA 1LODA 3IMNA 1SZBA 1ZZ9A 1RUOA 4A4BA 2E6VA 4F52B 5KH3A 1Z7S2 4Y1VA 1OKQA 3AL6A 3HWJA 3PDQA 2VOKA 1CZTA 4XUNA 4PIYA 3VV1A 5G04B 3ZYIB 4ZHNA 3ES4A 5EQUA 1OXCA 2JG8A 2GSYA 2DBNA 3LD8A 2C6SA 3FHQA 4WM7B 3ZN4A 1CX1A 4PQQA 2WUHA 1LRHA 1O6UA 5B8DA 2G9GA 4QB6A 3RFRA 3VHPA 1QQP1 3ZXFA 2E61A 5SVIB 2VPDA 4XXAA 3T4VA 1LHVA 5TDWA 3ZTGA 4COYA 5CU1A 4V2VA 1H0BA 2VUAA 3UYJA 3FM8C 1N87A 3E5UA 5A1LA 5J1XA 5BUVA 3VBUA 3FLPA 2WR9A 1R082 2BWCA 4B7KA 3JU9A 5FOBB 4GH4B 3BTXA 3C5KA 2A6XA 2VOXA 4URAA 3O1TA 4LBQB 4LADB 3K4DA 4GB31 2B0OE 1ZZ7A 4XBQA 1Y43B 3KMHA 5I0RA 3NMBA 3SUBA 2F6BA 2JG9B 2LALA 3WNKA 4BJ0A 3O1VA 4CU8A 3LSEA 4C0HA 2BJSA 4LPLA 3WP3A 1CR7A 4JDNA 1XNDA 1RGSA 2SLIA 3J9SA 4B4PA 1ENSA 2R1DA 1CZSA 4JKLA 4Q4X3 5A7WA 1O4TA 2P1BA 5FWEA 5C4WB 4FAHA 3HPNA 4F8AA 1QNYA 2DV9A 3IBMA 5E89A 2Y6LA 3ST7A 2VTXJ 2DTYA 1QY4A 2VJFA 1AX1A 1OPOA 1BCXA 3H42B 3T0AA 2EF6A 5CEHA 2PHUA 4CEWC 1RMU2 4XVHA 4V3KC 5C11A 1JBCA 4F83A 3ZN6A 3U0ZA 2D6MA 4WVMB 4R2YA 5CFDB 1C5HA 3U10A 2CAVA 2RM21 1D4VB 4UW4A 4OMDA 3DXUA 5A3LA 4DUXA 3SKJE 5BV6A 5AVAA 5CFDA 4TLFA 3WQ1A 3LWCA 3POWA 1ALYA 2ECJA 1A8DA 2IZWA 3POYA 2Q1ZB 1V9U3 5JDBA 1WENA 3ZLIA 2R071 3WNPA 2HWC1 3PVEA 3ZXLA 3JZVA 4LT5A 3CO2A 4WBBA 2M85A 5LCWB 4TKPB 4O62A 4ZS3A 1RUH3 3KV5A 3M3EA 3RQ0A 4CDXB 2ENRA 5DXDA 3MW4A 1JXNA 4ZU4A 4LKAA 1SDDB 1PMIA 3CU7A 2D93A 2A6YA 2VXRA 2R042 2DURA 1RUI2 1OD3A 2WLPA 3HT2A 2Q30A 5DABA 5F3IA 3VHNA 3WX5A 4CEYA 4DXSA 1ND2C 3J7HA 1AL22 5EHDA 3VKOA 1HQNA 5DAVA 1T1HA 3VBHB 3M3IA 1WEOA 4GB0A 2J22A 4KH9A 4UOJA 3ZVZB 2UYAA 1RUG2 1FAYA 2WNVA 4AUQB 4Y1YA 2Q4SA 5FREA 4AAPA 1RUG1 4ISQA 2J1EA 3JBG3 2L5UA 2GC1A 1VRH3 3FJUB 3MF6A 3MUZ1 5ANNA 3PU8A 4OVEA 3NNJA 3GYDA 4YNIA 4AI0A 1JOBA 2ECWA 4QQPA 4IGOA 2L7PA 1ULFA 2ZETC 1HXS2 1EV11 1UWWA 2B7YA 4LO7A 1AYN2 1PVXA 2FZ2A 1KEXA 5DUUA 4Z07A 4EYUA 4K40A 4XF9A 4CCEA 1W6MA 1MS5A 3SC7X 3RZGA 1LEDA 3AKTA 3MIEA 1PIV3 4GWMA 1F15A 5IAXA 4UFMA 3GCWA 4MH0E 2CTVA 3CKHA 5IJRA 5AVPA 5ANQA 4OHXA 5DZGA 2XWJB 2X5IA 2Z5WA 1X82A 2KWJA 4CUBA 2KWOA 3VZJA 5BNOB 4RQPC 3AZVA 3OYWB 1AF9A 1UXXX 3THPA 2QDNA 4I3PA 2Y26A 4HN1A 4QXKA 2CSYA 2R32A 2EICA 3U5NA 3ATGA 2GN7A 4XFAA 2HYKA 2QKDA 4QGLA 5DAQA 3RPGB 1ULCA 2WWUA 4CCGX 3IAPA 3DGTA 1PO13 2WAAA 5JVVA 2Q8DA 2UURA 4XFFA 3W20A 4Q6FA 4W65A 4CU7A 5BNOA 4MGTA 3ASLA 2IXLA 1S0IA 4RS5B 4XZPA 4Y4YA 5EFUA 4BMEA 3AXDA 3P6BA 4XJZA 1RMU1 2ADEA 4ZXEA 3I54A 2OVUA 5I0TA 3MYXA 5A3WA 3ZN5A 4CEWA 2E6SA 3VBFA 5CG8A 4AQTA 4BZ4A 3H8XA 5C8CB 3ZR5A 4OI0A 3ES1A 1QKQA 1S0CA 3E6CC 1ZBA1 2XKPA 5JXGA 3O35A 3I7DA 2FUUA 5CG9A 4Q4W3 5HCHA 2HYXA 5CFCC 4GH4C 4Q0UA 3AVSA 4JQRA 5FZIA 1Q5OA 4NE9A 2YBPA 2CRWA 4EN6B 1C1LA 2EXIA 4ARYA 1MBMA 4YBSA 4UW6A 5F39A 1E5RA 5I0UA 1DCSA 1DGRA 2RS52 2QQOA 5IVYA 1K5JA 5A33B 2IFWA 1S0GA 1XE7A 3DYMA 1KITA 3WF1A 5KXBA 3RMYA 2D5FA 4RGGA 1IGOA 1V87A 4PI0A 5ISLA 2G45A 4EQVA 2DUOA 2VO5A 4XQ4A 5FYMA 4PDWC 1JODA 4YPJA 4MGSA 3MEPA 2BNOA 3VBUC 3ZSJA 5EYAF 1N1VA 3KHCA 4LBOA 1XNCA 4OUEA 4CDUC 2XUMA 3FFZA 5FPLA 4BU2A 4HLTA 3KDEC 2ET1A 2PHFA 1UO9A 2D7FA 4RYDA 3TB0A 4YFZA 2X53S 2OQ6A 3PVBB 1JZ5A 3SOWA 3KV4A 1UMIA 2K46A 3AL5A 5J3UA 4Y20B 4P9JA 4CU6A 4LE4A 4OUSA 4BIOA 2ZACA 5FPAA 3FN9A 4Z92B 2BOIA 4RFRB 5L19A 1RJ7A 5EJ1B 5LBEA 5GLTA 3PIJA 1W90A 1XNBA 5FIXA 2FZ1A 4A3XA 2F42A 5F3GA 3TN91 4OGEA 2WFF3 3EQEA 2OIIA 2VCMA 4LMFA 4M00A 4MXVA 4QPIA 4AL9A 2IQJA 1H1IA 2EXKA 4EN9B 4P08A 3VUOA 3J7NA 2VULA 4XUOA 4QB2A 2AZ5A 4KQ7A 3SEEA 5A6XA 3WNLA 5FXZA 2FMYA 2BDRA 1YNAA 3OPTA 3KQIA 1N47A 5FJKA 1UZWA 2GMMA 2XJRA 4MGZE 2GC3A 2WO1A 4QAWA 1NLQA 3WDUA 1YQ8A 3NJZA 2YHJA 5JAXA 4OGCA 4HOOA 2NM1A 2YPJA 4CCOA 1TG7A 4KBBA 1XOYA 1ZRCA 3Q1DA 4JAAA 3FX3A 1UX7A 3O1OA 2B4KA 2GU9A 5GZDA 2F6JA 2LGLA 5D1KB 2UY8A 1UYPA 1RXFA 2DBIA 2O8OA 5BNNA 5JSPA 3NNFA 1NA1A 2IC1A 1QJY2 2QQNA 3CIHA 2QQMA 3M3QA 5IWFA 3I2FA 3LQIA 3PURA 1H2LA 2RJKA 2BGOA 3OUIA 2QJ0A 2DVBA 1S0BA 3V56A 1OURA 4INDA 5C4WC 1GNHA 3FAOA 2JMIA 5FY1A 3Q8BA 3O33A 2KD7A 2AEZA 2VG9A 2VVFA 3HBKA 4BISA 2FMDA 3ZXGA 1LEMA 5JSOA 3O1MA 2HWF3 3O1SA 3IMMA 2DFCA 2ZTNA 3VBHA 2DWRA 2J1SA 1GYKA 1CAUB 1ZBE2 4IGPA 3I2DA 2FDJA 2KXLA 5J3XA 1CHCA 4NJ4A 2D3RA 3TOJA 4N4FA 4RSUA 2ZJCA 2YVRA 1JMUB 1HRV1 1YWKA 4CU9A 3KWVA 3L2YA 4GMP3 1CJDA 1MZ5A 1ULOA 4RQPB 3ZFFA 4DOUA 4Q5OA 2VPBA 1YUDA 2ZEZA 3WEZA 1LHNA 3D82A 4OI2A 2YFZA 4S2DA 3O12A 3P3PA 1JUIA 1F4AA 1V6IA 1X33A 2FBEA 2J1RA 4BQ1A 1XJAA 2OS2A 1LHUA 1DQ5A 3DCQA 4LE3A 1DFQA 4D6SA 3N9NA 2HWB2 3VKLA 3IM0A 3ETPA 1UXZA 5FZ1A 3S7EA 3NV1A 3O37A 2CGOA 2ZPXA 4COZA 3LDRA 2HWE2 1GBGA 3E2DA 1DDLA 1LNSA 1K12A 2BGPA 4JX0A 2ZGMA 4AHYA 5DG1A 4YYOA 1GNYA 2ADDA 2A7AA 4AI1A 3KB5A 5C3QA 3ROUA 4OQ9A 1UKGA 3GM8A 5JUVA 1SEFA 1J58A 3A22A 4Q26A 1RUF3 2XQXA 4ZKTB 4Y24A 4AQ6A 2C5DA 3C7GA 5LA1A 1Y3TA 3HOBA 5A6YA 1SG3A 5FKCA 2QQVA 2JDYA 3U07A 3BU0A 2VMHA 3N35A 3W5MA 5FMBA 3AJZA 2D43A 4W4ZA 2Z42A 2YQLA 3LQHA 1BK0A 3DV8A 1W9SA 3NJXA 1KJLA 4CCCA 4CRQA 3VD9A 1V9U1 3OGSA 1JM7B 3ZFFC 4ZONA 5HPOA 2VZPA 5LB6A 3ETQA 3BOWA 1OLRA 1GOFA 1Q3EA 5EPAA 2A1XA 2D3PA 3FMGA 4AFCA 5ACA3 1ND3C 1LAJA 2RDRA 1H4HA 4XFHA 2Q8EA 4BOWA 3ZXEA 4MG2A 5FB0A 1CESA 1WCUA 4OFGA 1PVC3 4NIAA 2HWE3 5FK7A 4N90A 1RUH2 4LJNA 2KKYA 2HEYF 1GQHA 3WV6A 3D5OA 2YC0A 2CT2A 3KQ4B 2OZJA 3LEMA 4XPVA 3HNYM 4CDUB 3LVQE 3ZYJB 3EMRA 4LA2A 3V0BA 3MLJA 1HV0A 1DF0A 3WP4A 3O47A 2WYFA 2YYOA 4BH9A 1FV3A 4KU7A 4QKBA 2MHFA 4LHNA 2K0GA 3C7OA 3RYPA 1G25A 3LIGA 1WBLA 3WG3A 3I2HA 4YM2A 5FYZA 2JG9C 2YZ4A 4EN7B 4O65A 1JZ4A 1JYXA 3LOBA 4LK6A 1D4M1 1XE0A 1PO11 4TYSA 4GWIA 3TN93 4FOWA 1W6QA 1U0AA 5FZCA 5B2GB 5C33A 5F3CA 1RUD3 3B02A 2E33A 3D4KA 3UJOA 1LOBA 1PO21 2E7AA 2YBKA 2GH2A 1DG6A 1AJKA 4UT5A 3T2OA 3PIGA 5LKXA 4BWOA 2ZGNA 1ENXA 1COV1 1UPSA 4XABA 5DUVA 1WA4A 4H55A 1H8TA 1NZCA 3WNMA 4O64A 4UFIA 2ZGSA 1HXS3 2R49A 1LKNA 1VBC3 3VB9A 4BYYA 2FDIA 5H9SA 1B35B 2JX9A 2YC2A 1OOPC 1PGSA 3POGA 3T9KA 1PVC2 2GALA 3A0NA 2ECIA 4YWAA 2AR6A 5JR7B 2O1QA 3DUIA 4L2NA 1W2TA 4NHYA 2VNGA 1CAXB 2JDNA 4FT8A 4XAEA 4B29A 2A3YA 1ZZCA 3KGLA 3ZFEA 1PZ8A 2XP0A 4HN0A 1ZYBA 5LA2A 3I4IA 5F1RA 2O8QA 2VZ1A 4Z0RA 2LV9A 4A44A 4FPYA 4AVBA 1GICA 2PHLA 2WFF1 3E5QA 2WFPA 3WDVA 2RR4A 4DEQA 2VCCA 4CCLA 1WUVA 2YROA 4YM0A 1D4M2 4PBPA 3DYOA 1ST8A 5GKAC 2X10A 4MSVA 4FQZA 1W8TA 1NUKA 1TME3 2X5IC 4OZXA 4IGQA 2PMWB 4XC9A 4MYEA 2YGLA 3FBMA 4FVVA 5DINA 5DMYA 1W6NB 2C9KA 4ZQLA 1YLLA 3JUUA 2XBO3 2Y6FA 4FPHA 3PL0A 5DQ0A 5J96B 4YGDA 2MEV3 4KNCA 1OQEA 3AP7A 3ZSMA 1POV0 2QJVA 4LKSA 4L7XA 5DDJ3 4M0NA 4OLLA 2LAUA 2GDFA 1DGRN 1OMIA 3D8CA 1BKZA 4L58A 1UIKA 2ECNA 4QF3A 2JE7A 4CDQC 4AVTA 1SACA 2ARCA 1NCQB 2CSGA 2EAAA 5ABJC 2P57A 1W6MB 4YZ5A 5FYVA 4KGGA 1W04A 1WFKA 1LHOA 1URXA 1UY1A 3RSJA 5E6HA 2QIZA 2G9ZA 1NKGA 3K2OA 3LQCA 2C26A 2CU5A 1REEA 1RUJ3 1AXKA 1WMDA 3PU3A 1ULEA 2V4VA 3BU7A 3J8F1 2B9VA 1XRUA 2X5IB 5AFBA 1OA3A 2VZQA 1NA1C 4M4PA 2WZ8A 5J48A 3MFAA 3RRDA 3CZUA 4D6QA 2XB6C 4NWWA 2ZEYA 4MGYE 3OEAA 5B4XA 1ASJ2 2HYED 1DIWA 2JUNA 4BDVB 3OB8A 4Z0OA 2HWC3 2TUNA 1AR63 4QXCA 4QHZA 4NPMA 1DQ6A 1NCRB 4YW7A 3ZYGA 4BB3A 3MV01 3W58A 4NIDA 5CKQA 2JE9A 1QH7A 2A3XA 4Q27A 4JC1A 5DG2A 2KA3A 2ET7A 4EWDA 2ZHMA 3I2GA 3FANA 3BKZA 4Y5SA 2VTXA 3VD7A 2QICA 1SCRA 4URTA 4CDWB 4COWA 2BQPA 4QD2A 1LR5A 1W39A 4HVRA 1R092 3BTYA 1PGL2 1UF2C 4AI2A 2R063 2HDPA 3KCCA 4X8PA 4AK3A 1HKDA 4S2GA 1O3QA 2FHRA 2RM22 4Q0VA 1AR81 1D2SA 2VVEA 5I8TA 3SXWA 2ZGKA 4RS5C 1HRI2 1LGCA 4IE5A 1VBE1 3BVCA 4Q0SA 3MLKA 3T1LA 3ZMOA 4A4AA 2AENA 3WNOA 2K9ZA 4KU8A 2B8MA 4XW3A 3SLIA 2VMEA 5CFCA 4IEWA 5LA0A 1W0OA 1GP5A 1VR3A 5GZCA 1PHMA 1L3JA 1ZA4A 5SV5A 1YFWA 2VQ0A 4K8RB 3LFIA 5C8CC 1ZZ8A 4L97A 3GV4A 3SITA 3ZIXA 4N53C 1VD4A 1ACCA 3B5LB 2A6VA 4I01A 1PNGA 4QPGA 2V09A 3AP9A 4XFGA 3VBFC 4F7ZA 3RZJA 4JKMA 2EAKA 3WZ1A 4HKLA 2I2SA 4LJHA 1WMFA 4N43B 5C4WA 2B42B 2XOMA 1VMHA 2EXUA 3VL9A 4HBNA 3EO6A 2RE9A 4I02A 5FZ3A 4AYCA 5SVXA 3JD72 4MO3M 4AHXA 2QCSB 3RYKA 4BHWA 4U36A 3H8OA 3WR0A 2ZX1A 3I8TA 3DF0A 4GH4A 2WN3A 3USUB 4RHV3 4CEYC 3ZYQA 4IEXA 1DQ4A 2XJTA 3H1WA 4I7CA 1US3A 3LPFA 1DZRA 2IXCA 5FP7A 2WJSA 3UKVA 2TBVA 3QD6A 4IV3B 1RMU3 3BPSA 2BV4A 1F5JA 1GZTA 2WA3A 2XKOA 3LFMA 3Q9OA 4CA9A 3VD5A 4Q4Y1 4DZGA 4FP2A 5AIUA 1C1FA 1RHI2 1AJOA 5SV8A 2WZEA 3MW3A 4MZUA 4CZSA 1X4UA 4YVSC 2KE1A 1D4M3 3O5SA 2JMDA 4HPKA 1Z7S1 3OPWA 1QOTA 5DUXA 1VBA1 2MNGA 2R0HA 2VNOA 3J7LA 4XQWA 5FZOA 1LOGA 3SH3A 5JMCA 1LOFA 3EB5A 1VBA2 3EBRA 1QHDA 2H0BA 2WNUB 3A21A 1FOD3 4RR3A 3LQJA 3UGHA 4JZRA 1S2BA 5FZEA 1AR83 1AL0G 1RUJ1 1KJRA 3FLRA 3RVHA 3RYRA 5L9RA 4LKFA 3C7EA 1CGPA 1RB8G 3JQXA 4HMZA 4PBOA 4FXGB 2NPIA 5CYYA 3NV4A 1OLMA 2HWB1 4IV3C 1LTEA 2RS12 3TEWA 4AQ2A 3KV9A 4ZUXU 2LM3A 4BQ4A 1WBFA 3ZKUA 1GFF2 4PIXA 5J98B 3OGJA 1CVNA 4UFKA 4CDUA 2W1UA 2Y6HA 1OLQA 3WCSA 1J1LA 3NO8A 3V0BB 3IDCB 2P3YA 5JOYA 3ZPV1 2UU8A 5A70A 2V5YA 1NLRA 3VBOA 1XC6A 1JOJA 1QJU1 3MHZA 2B5HA 4GNDA 3C6WA 2WNOA 4GJZA 5LKUA 3VZLA 4NUBA 2XB1A 2ARXA 3LF7A 4QU2A 4WZCA 5I0DA 3BOPA 1W3XA 1YXWA 2CV6A 3OOXA 4LIUA 3O7OA 2QQUA 1GMMA 5JI7A 1FP0A 3GZAA 1PM7A 4AHZA 4A42A 1YHFA 4A7YA 1OF3A 3U5PA 5C3SA 3V64A 1TQ5A 2OA2A 1SLTA 2ZGUA 5FMCA 1EUTA 1GP4A 2VPGA 3KF5A 3ELNA 1V6LA 1EV13 4Q1RA 3WG1A 3ZXJA 4QX5A 1CAVA 4XAAA 1F31A 4FOVA 4LHSA 3GJAA 4OMCA 4TWTA 4E27A 1KRIA 1WILA 3ZPVE 3WF4A 4YSFA 1AYN3 1AR61 3WY6A 2RVAA 1T6GC 1QH6A 2RR11 2IDAA 1XBFA 1S0EA 5FO7B 4Q4W1 1N3QA 4KG0A 4M3CF 1U6GB 3MPPG 3U5MA 2WAOA 5AC92 3H3LA 3ZYHA 2CGPA 1RVF1 1S0JA 3WDTA 1RUF1 3FJSA 2OT7A 4KI5M 1HB1A 3GGLA 3POSA 1VLNA 2CWMA 1GP6A 2XLAA 3DECA 3WDXA 4D7TA 5BNOC 5B78A 2GH8A 4IV1A 4ZXKA 1PMHX 4D0QA 3IIIA 3PUAA 3VL8A 1JYNA 4K20A 4CDWC 2PUYA 1IHMA 4R9DA 2D97A 5CFDC 4M0HA 1TME1 2VZRA 4PLOA 4YADA 5KXEA 1VMJA 4YLZA 2Y60A 1ULDA 3OCPA 4NMIA 3T3YA 2W2IA 3WG4A 1QJX2 2BAYA 1X8MA 5J36A 4I0WB 3D6EA 3I2JA 4PT6A 2D98A 3AP5A 1RC6A 3AMQA 2DVAA 3USSA 1AR73 1T6BX 1AX0A 5IK4A 2MEV1 4I09A 4UF0B 3SH4A 2YB7A 3BGAA 3H7YA 5FK8A 3EB7A 4D6RA 3OD0A 1O3RA 5IVCA 5BNPC 1C8M2 4XMIA 4A2UA 2LTNA
chains in the Genus database with same CATH topology
1WEEA 4MXWB 4RS5A 1MR5A 4AFAA 4LBKA 2XHKA 3NKTA 4I0AA 3AX4A 2XL7A 3M2MA 1FV2A 2WNVB 4C0BA 2ZGQA 4U2AA 1G6NA 4QQOA 3QH6A 2L43A 2EODA 4EJRA 5GLVA 4ATFA 5LK7B 1RUD1 1SBEA 2NZ9A 4AEKA 1FXZA 4YGEA 4BHPA 3PMSA 4D94A 4M3CB 4Y20A 4UI9B 5FEYA 1ND2A 1SCSA 2P17A 4JRLA 1C8M1 2XJSA 1FATA 4HL0A 5T3NA 4Q4Y3 1YFXA 1O3SA 4IEZA 1CONA 1W6PA 2NLRA 1MEC3 2QNKA 1SLLA 4KL1A 3VKMA 4IEVA 1LHWA 2IWGB 1R081 1QJU2 1Z78A 4XXPA 4YVSB 1BMV1 3ZYPA 4LTAA 4Q0QA 5CBLA 4R8HA 2ZZJA 3M3CA 3GHNA 3PMEA 4UP0A 4H7MA 5DUWA 3O0WA 4XFBA 2WFF2 5FBZA 2PA7A 1LGNA 4XJ8A 4I30A 3W9AA 4C1XA 2RSDA 4PLNA 4FQ4A 4Q2FA 1DQ1A 4Q4X1 2RS31 1VRH2 3R0RA 5KC6A 1AYM1 1RUJ2 1MQTC 4Q4X2 3TNPB 3R05A 4KWLA 4MGIE 3VBFB 2XL9A 1E57A 1VBB1 1F5FA 1PVC1 4DRVA 1JTZX 3BCWA 2PQQA 2ZGPA 2H6BA 1D0GA 1QXJA 2QZ3A 1UIJA 2B45X 2DCYA 2WZR2 4FPKA 4JCKA 3TB0A 1GZWB 1YRZA 2X8KA 2YQMA 1NOVA 4AFBA 2PHRA 4YW2A 2HEWF 2JG9A 3PLQA 2RM23 1ZVFA 3FC0A 2Q0AA 3ME2A 2ERFA 2OUHA 4XF3A 4XF0A 2KGGA 1KFUL 4AYCB 3BIWE 1NXD1 4R4ZA 2GNTA 3VBSA 4YW5A 3QLQA 3AMMA 4J6GA 2A5ZA 3I59A 2P3JA 4WM7A 1Z6UA 3BPZA 3M70A 5ACA2 2VMGA 4QPGC 1ND3B 4A7ZA 3O0VA 3W59A 4BLJA 4UW3A 5DDJ2 1WCDJ 1RUH1 4NHKA 5CNAA 4YBTA 3IN9A 4OULA 4E2GA 3CLPA 4ORFA 5JIAA 3CF6E 4YFWA 3JB4C 2JG8C 5JOZA 4P9IA 1F8VA 1APNA 3R4DB 1W6QB 3PTYA 4I7DA 1X4IA 5LK5A 4AEDA 4AVAA 5HXVA 4FPCA 3ZYRA 1SLIA 2FUIA 2K1JA 2HWC2 1FMD3 1LU2A 5FCCA 5IK7A 1VB4A 4OHVA 1UKRA 4PDWB 3WLUA 1R091 2GMEA 2WIIB 3HIFA 4C91A 1PK6B 3GHMA 4DFSA 4QPYA 4FP3A 4R52A 1BEV3 5JOWA 1RUF2 2ZHKA 2LXPC 5KHHA 1CX4A 1SFNA 4EWEA 5AC91 1QWRA 4FPGA 1HV1A 4LLFA 5HBAA 1WCSA 4DY5A 2DCZA 2WQ4A 4ISRA 1I1EA 4GNEA 2ZX3A 2EA7A 2AN6A 2WWSA 2PHTA 5K0UB 5H1TA 2UYBA 1E4UA 3N7MA 2HJIA 1I3HA 2ZX2A 1AYM3 3KT1A 2LXHC 2ZCWA 2PLV2 2Y0OA 3KCXA 1S55A 1LECA 3E6BA 1IPJA 4FPEA 4IL7A 4PF5A 3NVCA 4NR1A 3WQ0A 1H1MA 2CY6A 3CJIB 3NSTA 1RHI3 2EALA 4N53B 4YG6A 1REDA 5DDJ1 4XFIA 1XE8A 3ZX7A 3EHKA 3E5XA 4YVWA 2R30A 4Y5Z0 1O3TA 1IPKA 5C8WA 4C90A 3X29B 5JSRA 3BB6A 4LA3A 3WQ7A 4M3CA 3AZZA 2YGMA 4WVWA 3LCPA 1WLCA 3CJIA 3G7DA 4CP1A 4O9GA 1WEUA 1DBNA 2A75A 2BNNA 1BBT3 3MPBA 1IKPA 2VP7A 5FMOS 1ZZ6A 2IXIA 4AW7A 1QJZA 4QF2A 2WA4A 3AYAA 2R073 4JGYB 1YIPA 1G9FA 4Y1XA 4G4FA 4K1YA 3NG2A 4V1PA 4Z2WA 1J3QA 3SISA 3ZFEC 2EGPA 2YURA 5FERA 2C1FA 2YSJA 4DY3A 1QNWA 3N3HA 2K2SA 3HT1A 4XMAA 2BYVE 1MS1A 4XJAA 4LLOA 4AGRA 4PTBA 2PHDA 2ZGOA 1VBB2 2WZR3 4CYDA 4FAGA 3AYEA 3L1ZB 1AX2A 3BODA 2BBVA 1BVVA 1BEV1 3KSCA 3KQRA 4N9IA 3RNSA 4GQ7A 2ZGLA 4IV1B 5GLUA 1LGBA 2WNUC 1GANA 5F9TA 5B77A 4BLIA 3QCWA 5KHKA 5K0UA 1LDKC 2VW2A 1XU1A 1CN1A 1DYKA 3AKSA 1LCLA 5JLVA 5E88A 1DVPA 3LA2A 3ZSLA 1C3HA 1RUC3 4O9EA 1NQDA 2QE3A 4ZDTA 3R4UA 3WINE 3AMNA 5KHJA 3AK0A 1CIWA 3B7MA 1JUHA 1GV9A 3NAPB 2EIGA 3OPZA 5BNPA 2B46X 1I5ZA 3MICA 4PLMA 4UXAA 4TZDA 3OBRA 1I9RA 4DB5A 3MFCA 3GBFA 5LKTA 1WIMA 4FTEA 3WW4A 2ECGA 2JRJA 5K8SA 1GSLA 4YM3A 1DLLA 1QXRA 1G9DA 3V0AB 3ZFGC 2A70A 5LEJA 4IESA 2NP0A 1QJY3 1V6JA 2Q5TA 1CAWA 3OYWA 2W52A 3VKNA 1S1AA 4R9CA 3N9MA 3IKWA 2MNZA 3SOXA 4YZ1A 4YGBA 2XLFA 5L36A 2Y38A 1ZX5A 2YYRA 3FFQA 4JGZA 3E97A 2ZMNA 1G9AA 3O70A 1RUE1 1BORA 1CAWB 1PIV2 2WSVA 1NCQC 3J26N 5ABJB 1WEQA 4M3CE 3WUCA 2GNBA 4LHKA 1H9PA 4CEWB 1H2MA 2JMJA 3RZZA 1PO22 1TME2 4JTOA 3FBYA 3ZFGB 1HQLA 2ZKNA 2F4PA 2VNRA 4QPGB 1LESA 1ASJ1 3GNEA 1RUE2 2VOWA 1H2KA 4E2QA 1M06G 5KH9A 3KT7A 2HWF1 4HSLA 5BNPB 1Q8SA 3B3QE 1B35C 1UPIA 1POV3 2KM2A 1R1A3 2RR12 4K1ZA 4KG8A 4LLBA 4KGQA 3OJBA 1MEC2 2M3HA 1K5MC 1DYPA 1AYN1 3AZYA 4P9WA 5T54A 3DPRA 1QMJA 1G7YA 5TABA 4H14A 2P3IA 1KXGA 3MIBA 3PVNA 5FPZA 4UW5A 2WNVC 5D8AA 1LOCA 2WT1A 5LRSA 2JJ6A 2EXHA 4K21A 1OA2A 4DMIA 2E51A 5IUQA 5T55A 2D6OX 4K7JA 1MS9A 1K2FA 4Z1VA 3INAA 4YVSA 2XLGA 1UZYA 2WSUA 3DPLR 4JRAA 1AR92 4BIFA 2C0ZA 4K6BA 1V6NA 2CKLB 1C8M3 2ZAHA 2VECA 3PHMA 2NAAA 2QZ2A 2RS11 1JYIA 4LO6B 4GMP1 1QGLA 4IEUA 5KHGA 1BBT1 1SQ4A 3HR9A 4YG3A 1X8EA 3OY8B 4QPIC 1HRI3 5L73A 1WEPA 2QVSB 4AVSA 4HETA 4AQSA 1EAH2 2I07B 5KXCA 4WVZA 4CEYB 5D8AC 3JBG1 5KC5A 3VKFC 4P9YA 3ILNA 1COV2 3K48A 4KWJA 1RHI1 4XHBA 2RR13 2UWAA 2DCKA 3B01A 1IZ3A 4Q4Y2 3WUDA 3DPRC 1MS8A 4N53A 4GA9A 1LOAA 5JIUA 2XVLA 2WINB 2DCTA 2FQPA 4FPJA 3VHOA 1A3KA 1Q56A 3UKNA 4QM9A 5E16A 5FOJB 3WOGA 1SLBA 1WESA 3VBRB 5L7OB 1WGMA 3M62A 4JGYC 1PO23 1MACA 1Q8OA 2R0FA 3S30A 2MA6A 1QJY1 4Q1PA 1PGW1 4JGYA 1H30A 1AR71 2Q1MA 4E2SA 4D7YA 4FO9A 4OUMA 4EROA 1PZ9A 1XNKA 1VBE3 5H9PA 3HQXA 5HCBA 2R1BA 1BXHA 2E9QA 4Q4V3 4DNYA 1UU6A 1NCQA 4AE2A 3QZVA 3AKRA 2AH2A 5A32A 4Y1ZA 4E4SA 1DU3D 3C2UA 1W6OB 4BCUA 4I2OA 2G4IA 5B76A 1AZDA 2WNEA 1FPN3 3CL1A 5GALA 2H0DB 1LDJB 4RD7A 1Z60A 4OI4A 2X29A 4ZU7A 4QQHA 1ZBA2 3AB0A 1KDMA 4ONUA 1NE4A 2I45A 1CPNA 1AR82 4GULA 5J09A 4LUKA 4FOQA 5G05B 4B7EA 1IKQA 2VPVA 2YHNA 3N9LA 1OFSA 5FMOL 1QU0A 1V00A 1VAVA 3H1YA 3KLSA 1WE9A 2RS32 2ZOEB 2HWE1 5FB1A 5ABJA 3VZMA 2ZHLA 2Y1NA 3VZKA 4R8PK 3KZ4C 3A4UA 3MIFA 1TMF1 1G8WA 4X8NA 3TNQA 1ZBDB 1ZRRA 2LN0A 1YIFA 2R043 5FO8B 2M1RA 1VP6A 4FSJA 3B94A 1J3RA 1V6OA 1RVF3 4MVTA 1QXPA 2VW0A 1A6CA 5I91A 1ZZBA 1HRV2 4A0CD 1H9WA 3NWKA 1C57A 1YJKA 4IEPA 3ECQA 1AL23 2Z2SB 4FCAA 1H8VA 4SLIA 3H8UA 2VNFA 2K16A 4ES8A 2MD7B 3J8F3 2IXJA 2ZMKA 4HVQA 1ASJ3 1WW4A 5K0UC 4AVXA 5FO9B 1HXS1 1BVP1 4X3GA 3SMHA 4ASMB 1VBB3 2GC2A 3I59B 3M1HA 1UW8A 5AITA 3O14A 4PIZA 5A32B 3RDIA 1DQ0A 3JCIA 4ATEA 1HQWA 3GF6A 4JV4A 2RS13 2ZGRA 4NO4A 3ZXAC 1M4WA 4CDXC 2HWD3 4WZ0A 2G6QA 4KWKA 2NQYA 3DKWA 1R093 1H8TB 1OOPA 4NOTA 3APBA 1HRI1 1TE1B 3RMXA 1ND2B 3USUA 1C4RA 2R16A 4QMAA 2QFEA 1HW5A 1XU2A 2AUYA 1PGL1 4LO4B 4JVAA 2PLV3 3OGGA 4YRDA 5D1IA 4B7YC 1D0HA 2VUJA 5F6LB 3OTFA 4E9KA 4YBMA 1RITA 4Q4V2 5FAXA 3UV9A 3WNXA 1N1SA 3VLBB 2BGCA 2PFWA 5JG6A 1FNZA 3DL3A 3U5OA 4JGZC 2LQ6A 1VBC2 2PAMA 2RHPA 5TDRA 4LULA 3AXEA 4AGVA 1U5XA 4DPNA 5I93A 1WGPA 4QQ2A 4AEDC 2DFBA 3ASIA 5JCTA 2BUKA 3J8F2 2KYUA 2AGSA 3AZXA 3MW2A 4N43A 5DKAA 4JDMA 2Q8OA 2XGXA 1XWHA 1Z7S3 4L99A 5T50A 2PNXA 1PO12 4P9XA 1DGWA 2C9AA 3G6JB 4GKXA 5K7PA 3B69A 2I50A 2MPFA 4XI1A 3NL1A 4AEJA 4YM1A 3WG2A 3O36A 2BVBA 5JZGA 4EN0A 3LSDA 3RWNA 4I7BA 3IT8A 4FBFA 1AHSA 4LUMA 1VBD1 2TNFA 1JN2P 4YVWB 2XH6A 3T7LA 2JECA 2WZR1 4WZ3B 3B93A 1IOAA 5TRBA 4F3JA 1X36A 2ZABA 1X50A 4Y22A 2EA6A 2ECTA 5D8AB 5EYYA 3P3NA 4X6QB 5GZEA 1VBA3 1W2UA 1GLHA 1PK6A 1V6MA 1Z2QA 3M63A 4YABA 1B09A 5EJ3A 2H0DA 3S6PA 3MDPA 2DCJA 4COVA 4Y26A 2BWAA 1WEWA 3HCSA 1UL9A 4GKYA 4LO5B 4Q29A 2CNAA 3ALQA 3IWZA 4N9HA 2ZA9A 3CNAA 3THTA 2WLQA 5C9AA 5C13A 2PHWA 1H2NA 3L9JT 3AMPA 4YVWC 4D3WA 2VJFB 2VMIA 4XJ9A 2MEV2 3H9AA 5H9QA 4IEOA 1PK6C 2PTMA 3LB9A 2A71A 3URFA 3ZXKA 4XBNA 4DRRA 4XEZA 5G0FA 4GNFA 3AM2A 3T2TA 1N3OA 4MX3A 3MIGA 3OY8A 1R1ZA 4FOYA 3WVJA 4XDQA 2GNDA 2OPKA 4HKWA 2JKBA 2LGVA 3L2HA 3ZSKA 4EWAA 1WLWA 2VJEA 4YATA 1ZNPA 4B8EA 2YUEA 4P5HA 1ULGA 4IQPA 4LBQA 1CAVB 4HANA 3ZIWA 1UX6A 4HK9A 5E1RA 4AI3A 2W68A 4IC3A 5H9MA 3D0SA 4PQ9A 1F9KA 2DF7A 5BY5A 5JZGC 1AR62 2P3KA 1NE6A 4META 2L0BA 4DINB 4Q8LA 3N7JA 2GMPA 1F2NA 3KS7A 3VBOB 5C9AC 4ITCA 3SCFA 1DGWX 3KD4A 3HCTA 2K17A 1AL21 3AZWA 5HCAA 1UMZA 1QJX3 1V9U2 1RUG3 5BYNA 2ETEA 2GAUA 4SBVA 3GALA 5KXDA 1MZFA 5J37A 4BBQA 3V0AA 1X7NA 1FT9A 4PJYA 3PJQA 2D6KA 1JHNA 4AG4A 4J1XA 1OQ1A 1U12A 2H0VA 4XTPA 1VBE2 2R6QA 1XQNA 1COV3 4CA1A 3MGUA 4AF9A 2KGIA 4FTBA 1FPN1 1LB2A 1W6OA 1LJ7A 3IDEA 4RHV2 4G3YC 2ILMA 4AVVA 1UCXA 3FHIB 3QH7A 4RL7A 4JGZB 1AUYA 1CPMA 5EV7A 4AFMA 1POV1 1FNYA 1Q8PA 2IFRA 1WW7A 2LRIC 1GNZA 5FRAA 1D2QA 2OZ6A 4BA6A 2UY9A 4HZFA 4P5OB 1LULA 3U11A 2P2KA 2D40A 3N9PA 3OF1A 2LGGA 1MS3A 1SBFA 4WZ2A 3RS6A 4L11A 3V43A 4JDOA 3ILRA 3TRSB 2A6WA 1OPMA 1IS4A 1TEIA 1VYXA 3LA3A 1O4ZA 3WW1A 3HCUA 4ZU5A 3PJYA 1ZBE1 1Z0HA 4NHMA 3H7JA 3LRQA 3RPQA 1RUE3 2N7GA 2XBO1 4IXLA 1NQJA 1O4YA 3SH5A 2W08A 4B4RA 3V0BB 1MM2A 1BZWA 2WS92 2Z69A 1WMEA 3DQVR 3VDDA 2E53A 1UU4A 1RL3A 2YY1A 3FUQA 1NXMA 1F62A 3JD71 3S7IA 2WT2A 4YZ3A 4CTEA 3SCHA 2YSMA 4XIKA 1Y7BA 2PAKA 1MVQA 4YW3A 2XJUA 1ZRDA 3LOIA 1MQTB 1FOD2 2C2VS 5FLJA 3LZZA 4N43C 2RI7A 3AKQA 1V6KA 2GC0A 2SBAA 5EWSA 3HN1A 2RJLA 2DX8A 3AYCA 4LR4A 1YCIA 3BALA 3KT4A 5T5JA 3NAPC 5JPMB 4XBLA 4RQPA 1GZ9A 4A4CA 5GLWA 3AFGA 1UZZA 3GBWA 5FQ0B 2F6NA 4FTSA 2CKLA 4IV3A 2KWKA 1QQP3 3E6DA 1YYNA 1WCKA 5JOXA 3VK6A 3KCYA 1AVBA 3PHDA 1OQDA 1GKBA 3HTKC 3TYJA 1QOSA 3WCRA 2KU3A 4GIQA 4RR3C 4DQAA 4Q8KA 5FDBA 2AREA 4WM8B 2PHXA 4AGGA 1G9CA 1BQPA 4QM8A 4HKOA 4AYUA 4BMBA 4K3UA 1O7FA 4S2HA 2XWBB 5TBNA 4QPIB 1BMV2 4HK8A 3H50A 2JXAA 5T5OA 1EAH3 1AR72 1O91A 4COUA 1CQ9A 4PCRA 4XHXA 1VBD2 2IXKA 1OI6A 3RJ2X 4CDXA 5CADA 4W6YA 4FPOB 2W0XA 2LGKA 2YMZA 3IIAA 1G9BA 3GZUC 3AMHA 1G86A 1PZ7A 5CA6A 3FLTA 1RUD2 3RPGC 4H7LA 1NA1B 3J4UH 1RTVA 2RS51 4G9SB 4IEQA 4UBGA 3PUQA 4MLOA 4Z8BA 4GMP0 4OHYA 4XETA 4XFCA 1JYCA 4XILA 3LAGA 2RMU2 1HYIA 2JD4A 3FWEA 3O7AA 4GWNA 1S0DA 3JBG2 3LA7A 3MZHA 1UAIA 1X4JA 1NCRA 5JPNB 1DZQA 1MM3A 1K5MB 4PDWA 3HMYA 2GZWA 2HWF2 5GLZA 2WKKA 4PPEA 3DN7A 4IERA 1W0PA 3B9CA 1WEMA 2XVGA 3B9IA 4BM8A 5BNQA