4FO9A

Crystal structure of the e3 sumo ligase pias2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
282
structure length
261
Chain Sequence
QGQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLATCPQEDNYPNSLCIKVNGKLFPLPGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKIRNPDHSRALIKEKLTTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEGSWCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase PIAS2
publication title Crystal structure of the E3 SUMO Ligase PIAS2
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 60
structure length 261
sequence length 282
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fo9A01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fo9A02
3C6WA 3SHBA 2MNYA 2ECWA 2L5UA 3LQIA 5KH3A 3O7AA 4A49A 5LKUA 2VJEB 2L0BA 3C5KA 5B8DA 3U5MA 3L1ZB 4L7XA 3LQHA 4YBSA 2Y1MA 3VK6A 4CCGX 2NAAA 3ZVYA 4IC2A 3LRQA 1CHCA 2MA5A 1HYJA 2LGKA 5J3XA 4P5OB 1LDKC 1WEEA 2KIZA 2VPEA 1WEVA 2K17A 5B79A 4AP4A 4GNGA 3ZYQA 3O33A 5FEYA 2G6QA 3T7LA 4FK5A 4O64A 1JM7A 4F52B 2JMIA 2QICA 2ECJA 1Z60A 3M99A 1MM2A 4S3OB 3N9OA 5TABA 2F6NA 2L80A 2ECTA 1HYIA 1X4UA 2MUMA 1K2FA 1V87A 4B86C 2YURA 4GNDA 2YU4A 1BORA 5B78A 2YYRA 4R7EA 5H1UA 2M1RA 4YABA 1FP0A 1X4JA 2VPDA 5LCWB 3N9LA 1VD4A 4LLBA 3ZPV1 1JOCA 1WEWA 2JRJA 4ZDTA 3SOWA 2RSDA 4ZQLA 2VPGA 5C11A 2KGGA 5D1MB 2YW8A 5KH9A 2YQLA 1JM7B 2YT5A 2LXPC 4LJNA 5DINA 2EA6A 2KWKA 3KV6A 2E6RA 2VP7A 5FERA 4WA6A 4NN2A 2I50A 4R8PK 2Y43A 1WGMA 5G0FA 4BHWA 2YHOA 5JG6A 5LKZA 2LDRA 2Y1NA 4GNEA 4S3OC 2MNZA 2KFTA 3I2DA 3RTRB 3PHDA 5TDRA 2E6SA 4QF2A 3SOXA 2H0DA 3ZTGA 3EB6A 4AYCA 4UP0A 2OXQC 2PUYA 5AIUA 1WESA 1WILA 2VJFA 2CSZA 1WIMA 2QIZA 4Q6FA 2XEUA 3N9QA 2UZGA 3RPGB 4MSXA 3V43A 2ECIA 2G43A 3GL6A 4L58A 1XWHA 4FJCA 4FO9A 1DVPA 2K16A 4YADA 2CKLA 3N9PA 5B76A 2CT2A 2ECGA 2YHNA 2KWOA 2BAYA 5D1LB 2K4DA 2L75A 1N87A 1Z6UA 2M3HA 5H9MA 2KWNA 4MVTA 2JMJA 5FB0A 5EYAF 4YBMA 4C9ZA 4AVXA 3LQJA 4IC3A 5TRBA 2LGLA 2FUIA 2KWJA 1WENA 1WFKA 4LK9A 4GNFA 2VJFB 1WEPA 3NG2A 2LRIC 2MD8C 5LKTA 2VJEA 4AUQB 2LXHC 5LKXA 2LQ6A 2FUUA 1WEQA 4W4UA 3HCUA 1X4IA 4R2YA 3O36A 2M85A 3N9NA 2ZETC 1WE9A 4X3GA 3KQIA 3O70A 2CKLB 1WEUA 4I7CA 2KE1A 3IHPA 4PTBA 4BBQA 4ZUXU 1VFYA 5H1VA 2YREA 2MD7B 2FSAA 3RPGC 4XI1A 4YBTA 3O34A 5B77A 2C2LA 2AN6A 4A4CA 3PURA 3ZVZB 2F42A 3L1XA 4YC9A 2L43A 4WZ0A 2YSJA 3KNVA 5TDWA 2KR4A 5KH7A 2YSMA 4YATA 2QJ0A 2JMDA 4PPEA 4FIPA 3M62A 5FB1A 2KREA 4LADB 3MHHA 4V3LC 1Z2QA 2CSYA 2PNXA 3N9MA 1G25A 1WEMA 3M63A 4TKPB 3ASLA 3U5NA 3MHSA 3U5OA 2LN0A 4WZ2A 4I7BA 1T1HA 4B7YC 4N3WA 4QF3A 2HDPA 4UP5A 3HCTA 3L11A 1RMDA 2KYUA 1LDJB 2EODA 3O37A 5G04B 3FL2A 1IYMA 4YAXA 2KGIA 4I7DA 2IDAA 2KU3A 4WZ3B 5B75A 2MT5A 5I3LA 5H1TA 5D1KB 2MA6A 4N4FA 5C13A 2H0DB 4AYCB 3KV5A 3HCSA 1U6GB 1WEOA 2LGVA 2ECNA 3DPLR 3SOUA 2ECVA 2C2VS 4V3KC 2LGGA 2YUCA 1MM3A 2DX8A 3QZVA 4A4BA 2K1JA 2HYED 1E4UA 4A0CD 1F62A 2LV9A 2RI7A 5DKAA 3ZNIA 3ZPVE 4GB0A 4UI9B 2XB1A 2YQMA 2MIQA 4LKAA 2F6JA 3GV4A 2D8SA 3PUQA 1ZBDB 2EGPA 3DQVR 3O35A 3T6RA 3EB5A 2VPBA 5AITA 2VNFA 4CA1A 5G05B 2G45A 2M6MA 3U5PA 3HTKC 5TBNA 1VYXA 1FBVA
chains in the Genus database with same CATH superfamily
2ETEA 2VUAA 4Y26A 4K8RB 1ULOA 2VY0A 4N43B 2NQYA 1U5XA 1UZWA 5FO9B 4CDUB 1HV0A 3UKTA 1FI2A 3WP6A 5HV0A 1AX1A 5KH3A 4O65A 1XQNA 2XJUA 3VBFA 3Q1DA 4JCKA 1GUIA 4FQZA 1U12A 3LWCA 2WO3A 3B7MA 3HQXA 2XPJA 3AZZA 4IV1A 5B8DA 1Q8QA 5IK4A 5LBEA 1JYCA 3HNMA 3KF5A 1SCSA 4R4XA 4CUGA 5FZ6A 5DAPA 5A3MA 1D2SA 4EWAA 2EIGA 3H3UA 1OURA 4ZY9A 3LQHA 3UYJA 1NCRC 4Q0PA 1F5JA 1CIYA 3VZNA 2X10A 1JW6A 1XBFA 2BOJA 2GN3A 2DU0A 3AM2A 4COVA 4KWUA 5JSPA 2RS51 3VZKA 2VU9A 5BNNC 2NAAA 1H6XA 3DN7A 1HXS3 1MACA 4AI0A 3LRQA 2HWB3 3TEZA 2MA5A 2BEOA 1IG0A 4QX1A 1US2A 2HKXA 2RMU3 1K5JA 3B01A 3H3LA 2YMZA 3WF3A 4P5OB 1JZ3A 4Q0VA 1CX1A 4Q27A 4DQAA 5CADA 3WNNA 3NJXA 5SVYA 4C1WA 3ZFEC 2KIZA 4EN9B 4QX8A 2XJSA 4JAAA 3L2HA 2VPEA 1QDOA 5B79A 1ND3C 4XUPA 2E33A 4IW3A 3KCCA 2FDFA 4AP4A 1BCXA 3WXPA 5LEKA 1UU4A 3P3NA 2WFPA 2Y6HA 1GWLA 3TN92 1CQ9A 5A32B 4YARA 2WWUA 4OI1A 3WCSA 1W0NA 5A6YA 3H42B 3AP9A 4GMP1 2YGLA 4X6QB 2Z79A 5CIRA 1VBE3 3I7DA 2CGNA 1WW6A 2O0OA 4P9JA 1BK0A 2QUOA 3POGA 2QDNA 5C3PA 4AWDA 4ZU4A 3HEIA 3PDQA 1O6UA 2I07B 1O7FA 3M2MA 5F5IA 2XMLA 4A44A 1WCQA 1FXZA 2F17A 1BZWA 3N36A 2JD4A 2RS12 4NAMA 3ACHA 5BNPC 1LEMA 1OQ1A 1QOOA 2CL2A 3PVEA 2ZZJA 2F6BA 1OFSA 3PVBB 4RS5C 4AGRA 2L80A 1VMFA 3GM8A 3MICA 5DDJ3 5I0RA 3HVDA 4WVMB 2WSUA 4UF0A 5T5JA 2NZ9A 1X4UA 2ES3A 4B86C 2FDKA 1PX3A 2O8OA 3UGGA 2CV6A 3ZN6A 3MV01 5JCTA 4I09A 2KR2A 2E51A 5K0UB 3DV8A 4OHWA 3WNKA 4CDQB 2VBPA 1XNDA 2HJIA 3W59A 4R7EA 5H1UA 3EJKA 5EYYA 1SBDA 4RN5A 4MADA 1EAH1 3UJOA 4IEZA 5F6KA 5CAZA 3HNYM 1QNYA 1WGPA 1TE1B 1V70A 2HLEA 4NVPA 1WCUA 1RUG3 4EZ4A 1KFUL 5KHIA 5LA0A 5SV8A 2D6KA 4TWTA 4A41A 2VPDA 2CWSA 4RQPA 1FATA 3AKSA 2JDPA 3WW4A 2JRJA 1HRI1 2DBIA 1H0BA 1K3IA 1UWWA 4LLFA 4QAWA 3R05A 1W8NA 3OY8A 5E88A 2D6NA 2WZPP 1BBT3 4DUVA 1O5LA 2MPFA 1D4M3 2OT7A 1DGWX 1WCDJ 4MXWA 4TLFA 1PGW1 1QEXA 2B0OE 2KA3A 4LQRA 1XU2A 2VNVA 3WZ1A 4GKXA 2R49A 5C11A 5FYUA 4XBQA 4QQPA 3A7QA 2ET7A 1GSLA 2W87A 1RUOA 5FZBA 3A22A 2TNFA 2YUEA 1ZRCA 4HT1T 4JGYC 2YT5A 1JM7B 3AP4A 1XRUA 4BU2A 5A1LA 1RL3A 4BQ4A 4ISRA 5FYYA 1R1A1 4ZS2A 5FZGA 1Y9QA 2XLGA 5DDJ2 3O1PA 2BERA 3IBMA 1SFPA 4OHVA 4CEWC 4K8FA 3T0AA 2E6RA 2EA6A 2VBDA 1VMJA 4OVEA 5IK8A 4XABA 4GZ9A 4QGLA 4S2GA 4FQ4A 3WCRA 4AZZA 4Q4V3 1HB3A 1O8PA 2WFF3 3DYPA 4FPHA 1G86A 3AL6A 5GLZA 5CFDA 5CFCB 1GU3A 5G04L 4NJ4A 1QQP1 4LKSA 4WM7A 3GJAA 5FP3A 2HYKA 4QPGB 2OQ6A 4M3CF 1B35B 2WA4A 2A7AA 1JS9A 1W6NB 3BYWA 4FPJA 3IDCB 4AQ2A 2XWJB 1QXJA 1RUG2 2Z69A 5J7MA 4W6XA 1DBNA 2XP0A 1WD4A 3LA2A 5EHDA 3T0BA 5LKZA 4UXAA 1DCQA 2OKXA 1DFQA 1JU3A 5FXZA 3THTA 1PMHX 2JDAA 4LMFA 4FOVA 2VVDA 4OMCA 4GNEA 5A7WA 5HXMA 1YHFA 5C6CA 1H1AA 4COYA 1C1LA 3I2DA 3TEYA 1MR5A 1QY4A 3PLQA 1LJ7A 4RGKA 1UX7A 2B7YA 3LD8A 4IV1C 4M3CB 1BJQA 2GN7A 4FCAA 3POEA 5BNQA 1FV2A 1T6GC 2DCKA 4Z07A 1OLME 3ZIWA 4A45A 3M8LA 2JEMA 3EB6A 4UP0A 4Y5SA 5D2AA 3KWVA 3KDEC 3DECA 3O7OA 4KU7A 4K6BA 2GNBA 3VN4A 3OGVA 4YLZA 3P5BA 3UGHA 1DU3D 3AKQA 3NV3A 1LCLA 2VOKA 2A70A 4HKWA 3AMNA 1C5IA 1RHI3 4AGVA 1HB2A 1JOJA 4LO4B 4BDVB 2IXJA 1G6NA 3RI8A 5T5OA 3SH3A 1ZBE2 1W39A 2MEV3 3LSEA 4Q6FA 2VM9A 3MIBA 2P6CA 5C3SA 4DXTA 2A75A 3LDBA 1MQTB 2VCBA 1OUSA 2WO2A 2GMMA 2QQJA 3MO4A 4QQOA 1WKYA 3PL0A 4KI5M 5IAVA 2RR13 2B46X 1W3VA 3GL6A 4ITCA 3VBRA 4Z2AA 2W39A 4L58A 3VHNA 3S7IA 4DY3A 1W99A 4D6SA 2QTWB 4Y5Z0 5FUPA 2LS6A 2PHDA 3C3VA 1Y7BA 4XZUG 2K16A 4YADA 3N9PA 1NY72 5FP7A 2AR6A 5JI7A 1YYNA 3J4UH 4M4PA 3GZEA 3VBFB 3DF0A 4LBMA 4Y1VA 2PAMA 2CT2A 2YHNA 3LGRA 3C5KA 5A1AA 2WJSA 3AP5A 1DQ2A 3Q8BA 4HANA 4IV1B 5D21A 1JYXA 2M3HA 2DF7A 3U14A 5SVXA 3TWIA 1P8JA 1PVC1 4BXFA 4MVTA 5FXVA 5A7PA 5LK7B 2X09A 4Q4Y2 5B2GB 5FZ4A 3TNPB 1OD5A 5FV3A 1BMV1 4XJZA 4DZGA 1GP6A 3E5QA 2GNDA 2JG9A 3AL5A 4M0NA 3N3HA 3Q8AA 2Q8OA 5KC6A 3DYOA 5JVVA 3LDYA 2FUIA 1LHUA 1RHI2 3H7JA 3POWA 1FNYA 3WY6A 1AYN3 4WZFA 5FO7B 5ACA1 3NNLA 2Y6KA 3ZPYA 2ZZQA 5FZIA 4LK9A 2CGOA 2W1UA 5HCFA 2MEV2 1EPWA 5B76A 5A1FA 5BNOB 1W9SA 2LRIC 4XFCA 3T2QA 5D1IA 4QHBA 1GQGA 2WIIB 3MUZ1 1J1LA 5T55A 2TEPA 2RR12 2VUJA 2VMHA 2VJEA 4MSVA 4Q0UA 2BFUL 4QB1A 4E27A 1WCSA 1ULPA 1ST8A 4CCJA 4DXSA 1OPMA 5APAA 1RUJ1 2VZ1A 1YLLA 1ZBA3 2AEZA 3ACFA 4XJUA 3H8UA 2FUUA 1NUKA 4RQPC 3T30A 4IEWA 3T9KA 4QB6A 4QPIA 4PLMA 2C6SA 3N9NA 2M85A 3A4UA 5EYXA 3FHIB 1W03A 3RQ0A 4JHTA 3ZFFB 2BNNA 3OUJA 4CCNA 5JI9A 4P9WA 1UYYA 4C0BA 1JMUB 2GC2A 3U78A 4E8CA 1WEUA 5F5AA 3KQ4B 1BXHA 1FPN1 1TME2 4QB2A 2Y0OA 2ZOEB 4AVTA 3JD71 5ABJB 2KE1A 4A2UA 3Q8CA 4HFSA 4ISQA 4MLOA 4XFGA 4ZUXU 4LORA 4HETA 4JC1A 3LCPA 1JZ5A 1VFYA 3J7NA 2ZXQA 2YREA 3MHZA 1YFWA 1UYPA 2P37A 3O0VA 1IPJA 4GH4A 4OHXA 1W9YA 1VALA 1RMU1 3F95A 2PLV1 4EROA 4EE2A 3RPGC 4BQYA 4AE2A 3W5NA 2GC0A 2QE3A 1XPWA 5FZFA 2P3JA 4CP9A 1AYN2 3I97A 4Q8LA 3VZMA 1XNTA 1K45A 4OLLA 2ZX3A 4EN7B 3DPRA 3E5XA 5CFDC 2J1AA 4KL1A 3J8F1 1CAVA 3BCWA 2E53A 1D0GA 1OKQA 1X36A 3KNVA 2RM21 5FFOC 4WM7C 3B9CA 1US3A 2P6HA 2CNAA 2WNVA 4XUOA 3URFA 2XDVA 2ZGRA 2UWAA 1UOBA 1Y9GA 2GC1A 4E2GA 2BWCA 3HD8B 4RYDA 3RJRA 4O9GA 1ZBA2 2JG8C 2Q1MA 4UW6A 4FIPA 4PPEA 2AEYA 3USUA 2J7MA 2Y6JA 1G9FA 3M62A 3D3AA 3IN9A 5FZ7A 4FOWA 4MXWB 1MS0A 1XSRA 3JBG3 4E4SA 3FANA 1YJLA 2PNXA 1IS6A 5DUVA 1WLDA 3T4VA 3MW4A 2XJTA 4IEUA 1DQ5A 1AR63 3P3PA 4ES8A 1FX5A 3N7JA 5FZOA 2NMNA 1SLLA 2ADDA 2JB4A 4MYEA 4Y24A 2A6WA 3PUHA 4OI4A 4XQ4A 5F3EA 3MHSA 5DZEA 1PO11 3S57A 5A33B 5JMCA 2VOVA 4LBJA 2AYHA 3I4IA 4I30A 4I7BA 2D98A 3ZX7A 1T1HA 2R16A 2CWMA 1J58A 4A6OA 3H1MA 2CDPA 3GHMA 4YGBA 5A80A 2E31A 3RPQA 2QQUA 2VZVA 1LHVA 3FHAA 2YU1A 4W6YA 3NWKA 3ZO0B 3HCTA 2JX9A 1C57A 1PNFA 3WSOA 4BQ2A 1Z7S3 3LF7A 3J7LA 4WM7B 4ZXEA 2EODA 3O37A 3RS6A 4PJYA 3WW2A 1FV3A 1W28A 1LB2A 1YQ5A 1QJU2 2ZEZA 3H3ZA 5HCHA 5DXDA 4JGZC 4PCRA 3FLTA 4INDA 4YAXA 4A7YA 1AVBA 4YW6A 1OD3A 1PVXA 2XBO3 2XHNA 1IPSA 3D5OA 5LB6A 3W9AA 4Z1VA 2IDAA 1ZZBA 4HG6B 1HRV3 2YPJA 4QXBA 3NV4A 1ZRRA 2TUNA 1W6OA 3SH4A 3VDDB 2L9LA 3HWJA 3VD9A 4WM8A 5I3LA 5H1TA 4QDQA 2MA6A 2RS31 1UMIA 3ZYRA 3U4SA 2WAOA 1AR73 1FNZA 4BQ3A 5JPMB 5H9QA 4N53A 1RC6A 3K4DA 2G9ZA 5FKBA 3H7HA 4R8HA 1MPXA 3HCSA 4DEVA 5IT6A 2R073 3AMPA 3IDBB 1H8VA 4OCTA 1HDKA 2VTXJ 4N43A 4QDRA 2ECNA 1R091 1YEWA 5CKMA 5FREA 1VBD1 3DPLR 1BKZA 1HX6A 3OGGA 1UYZA 4K20A 4URAA 1GP4A 5A3NA 2ECVA 1RXFA 2JG9C 2C2VS 3EBRA 1O4TA 5F7UA 1OA3A 1BEV3 1IOAA 3IKWA 4YVSB 3KGLA 4C8DA 1IPKA 3WDTA 1AHSA 5FMDA 4XF9A 1Q8VA 5FP8A 5C71A 1MM3A 5FMOS 2CSGA 3VBUB 2HYED 2VZUA 4OHYA 2HWE1 3OGSA 2DCJA 4CCOA 4Q4W2 4D69A 1A3KA 3VGIA 1J83A 1GWMA 2AUYA 4A0CD 1F62A 1CWPA 2LV9A 3FHQA 1DCSA 4LHSA 5FPLA 1WLWA 2NLRA 1MZFA 3N7KA 2EA7A 5FY9A 5FYSA 3VBRB 4DXRA 5K3QA 3ZNIA 2VAUA 1OA2A 4ATEA 2GDFA 2VW2A 1S0JA 5FPBA 4CYDA 5FPUA 5E8AA 1V00A 4O7XA 3K46A 4RHV2 3RRDA 2YQMA 4PF1A 5FZ0A 2F6JA 1I5PA 1ULFA 1FOD3 5DUXA 1AR92 3PVNA 2QCSB 1HRV2 4MGZE 5GM0A 1J3QA 5DN2A 1ZBDB 2ZJCA 1W04A 1EV11 4ES9A 1DQ6A 4DRRA 2EGPA 4QPIC 1H4GA 2ARXA 4FPGA 4CUBA 1QIQA 2RE9A 1AXYA 4YYOA 1NX9A 4LHKA 4M0HA 4P00B 3E6CC 1SEFA 3WG4A 1C8M1 1LGBA 3SEEA 2R072 4D6QA 3GJBA 5F8PA 4AFDA 4D8MA 1JZ6A 5CVRA 2M6MA 2VH9A 5FPAA 4BJ0A 3U5PA 3THDA 2D3RA 1O4YA 4XW3A 4XF0A 5TBNA 4KBBA 2BNMA 1A6CA 3ZSKA 3ZYIB 3RYKA 1H2NA 1V6LA 5A32A 3MI8A 1FBVA 1APNA 3C6WA 4K1YA 1Z78A 5DZGA 5GALA 5FCCA 3LQIA 1WBLA 1VLNA 1C4RA 3W21A 3AYAA 3FUOA 5JXIA 5FJHA 3HOBA 1UZYA 2FHRA 4XUNA 4Y4YA 1MEC3 1UAIA 2VUCA 1NQJA 1YUDA 1RUE1 3KCXA 1DZRA 5DUWA 3B3QE 2BVBA 2R061 3AYEA 2VJEB 1UMZA 1O4ZA 1NOVA 3C7FA 3E2DA 3OBTA 4UFLA 1AX2A 2WNVC 3FEHA 2QVSB 5A3PA 4Q4X3 2A6VA 2PQQA 5M0TA 5ERLA 1NG0A 4WVMA 1ENXA 2V4AA 3AK0A 3IMNA 3JCIA 2R041 4NHYA 1RUH3 4PQQA 5A3LA 5B4XA 3GALA 3G7DA 3ZLIA 2GMEA 2HWD1 3THCA 1OI6A 3K4AA 5K0UA 2Y1MA 4C1XA 5JDBA 5DPNA 2C5DA 2F4PA 1L7LA 5KXEA 4CCGX 2P1BA 3IMMA 3KB5A 3MFAA 3USSA 2YC2A 2OYZA 3O1TA 3MLLA 4XVHA 3I3BA 2P3IA 2LGKA 5J3XA 4B7EA 1H4HA 3ZXFA 1PO22 2QQKA 3ZKYA 1KS4A 1J3PA 1RUC3 1LNSA 1UO9A 4GH4B 1LDKC 3JXSA 4P9IA 4CDXA 3ZYFA 2VQ0A 5CU1A 2WZR1 5J37A 2KKYA 2JDYA 5EFUA 1BLZA 1XB9A 1POV0 2F4LA 5LRRA 5FEYA 1X8MA 3DPRB 2W68A 2GSYA 2EXJA 3HJRA 1PMJX 2WQ8A 1R081 5CKNA 4UFHA 4FK5A 3TOJA 4F1PA 2EXHA 4O64A 3QOPA 1DIWA 3LQCA 5L9BA 1JM7A 3J7MA 1XNAA 4XFAA 3O1SA 4HKLA 4F52B 1TMF1 4NUBA 1QWRA 4IEOA 3M99A 4NPLA 4Q4X2 2VXJA 1MM2A 4S3OB 1WW7A 3K75B 5FLIA 2GH8A 3WDWA 4B1LA 1UPIA 4A7ZA 4LBOA 1DDLA 1RUH2 4GB32 5FOBB 3GYDA 4UW5A 3GZTB 3JU9A 3T08A 4F8AA 2WA3A 4WM8C 5G05L 5L9RA 4NWWA 1X9TA 2YBPA 1PIV1 4L97A 3R6SA 4AEDB 3AX4A 2Z4FA 3WP3A 1COV2 4D7SA 5CFCA 3B02A 4XC9A 2MUMA 1K2FA 3VZLA 4KBZA 3MIEA 1I9RA 2RVAA 2W9XA 4N53C 4NN0A 4QPGA 1B35A 5JUVA 2BTVC 3HMYA 1S0BA 4IERA 2UWCA 3AVRA 4UT5A 3ZXAC 1QHDA 1GFF2 1GR3A 3POBA 1ULCA 1EYBA 1DP0A 4FSJA 4N43C 3VD3A 1AR82 4Z0RA 1XOYA 2WNUB 3APBA 4AI1A 4CDUC 1KJRA 2RV9A 2WQ4A 1V9U2 4E8DA 4IGPA 1EUUA 4FFIA 5A70A 3ZM8A 1UN1A 4IGQA 1UOGA 1FP0A 2A6XA 3NL1A 4ZS3A 3S5AA 4QX7A 4M3CA 2DVAA 1POQA 3JUEA 3ZR6A 4LUMA 4QXHA 4LLBA 4HLTA 4QU2A 1TVGA 2GAUA 1VBC1 1YQ2A 1OLQA 1IQAA 3SEPA 4AVVA 1DLCA 5KR7A 4FTSA 1D4VB 3SOWA 4UAPA 5FQ0B 2RSDA 2YVRA 3WG2A 1NXMA 2HEWF 4AEJA 2KGGA 1CIWA 3IIAA 1H9WA 2VOTA 1GOHA 2FD4A 2AACA 5BV6A 2Q8DA 1M06G 3MF6A 1W0OA 4BE3A 1W6OB 2GP3A 3I54A 3H7YA 1HIXA 4WM8B 3MLJA 5FXWA 4AI3A 2OVUA 3CO2A 4EZHA 5I0DA 2AZ5A 3WF0A 2VQAA 5CB7A 5HCAA 3IDEA 4GMP0 1HB4A 2FQPA 1TG7A 1Y3TA 3MUY1 5KHHA 1UKGA 3T3YA 5A3OA 1MQTA 3B9IA 3I2JA 3IPVB 5CG8A 1UYXA 1HLCA 2XH6A 3CDZB 4IESA 4ASMB 1STMA 2V72A 2VO5A 1YQ6A 4HL0A 3IM0A 4L0PA 3TN93 4FVVA 3DWDA 3UK9A 5LK5A 2A3YA 1DYKA 2I50A 1QJX2 4EN8B 4AVAA 4AHYA 1F4HA 2LALA 4NIGA 1VRH1 5G0FA 5IVFA 4RD7A 5JG6A 5C5UA 2GP5A 3ZXEA 3NNFA 2RG4A 4LHNA 5KHGA 2LDRA 2Y1NA 3RFRA 3PMSA 5C3OA 5JOXA 4QQ2A 3BUCA 1SDDB 5FZDA 4AFAA 5IK5A 4JV4A 4R9AA 2RS13 1ZZ6A 2BRTA 3ELNA 3PHDA 2VD7A 4QKNA 1OSGA 3WNLA 5JOYA 2E6SA 4R2YA 2BWAA 1SG3A 4UBGA 4YW5A 2J42A 5FYZA 2FD8A 1PX4A 4QF2A 1UY0A 2PHLA 4GAZA 5FTTC 4HONA 4YPJA 5HPOA 3ZTGA 5EXOA 3JQXA 3FJSA 4RR3B 5C5TA 2PUYA 1H8TB 4E4HA 1WILA 1H9PA 1K12A 2JWPA 2W47A 4ZKTB 3ILNA 3WP5A 4WZCA 5BNOA 5K0UC 1WIMA 4XUTA 4CDQC 5LA2A 4NOTA 4XFBA 3RG0A 2HWC2 2Q1ZB 5IK7A 2JXAA 4LKEA 2Q5TA 1W6QA 1XC6A 1ZZCA 2XEUA 3I2IA 3N9QA 5GZFA 1XYPA 5I0TA 4OYUA 1ONAA 3SKJE 2VTXA 1CZSA 2VZPA 5LASA 5F3CA 5IVJA 1OF4A 4MSXA 2B5HA 1S4CA 2XB6C 1UOJA 4OI2A 3V43A 4NRPA 3SNMA 3MGUA 1HXS1 4CDXC 1UX6A 2HWB1 4AEKA 2W91A 3NJVA 2RMU1 1W8FA 5JXJA 5K8SA 4FJCA 1A8MA 4AQTA 2P2KA 2YHJA 4DOUA 3ZFFA 1IG3A 2EAAA 3B69A 1RB8G 2H6BA 2Y6FA 3AP6A 3BPZA 1O8SA 1GKBA 2IXCA 3AB0A 4IE5A 4NPMA 4B29A 2ECGA 3PLWA 2XJVA 4CSWA 3HBKA 5LBFA 3O5SA 5ABJA 3ILRA 1RUI3 5JXGA 3MF9A 3ZN4A 2VGDA 5F5CA 1AJOA 2QQIA 2DDUA 4BCUA 2ZMLA 5FOJB 2VPVA 3MFCA 2EALA 4QKBA 2JM3A 5EQUA 3T0DA 4Y20A 4DB5A 1J3RA 2LROA 2RS52 2P3YA 1VBE1 2WBKA 4QX3A 3L2YA 3OBAA 2VULA 3NV2A 1N1YA 4C9ZA 2VE1A 3OEBA 5JZGB 1SBFA 5F3GA 3NSTA 4GWIA 3ABZA 4DMIA 1WMFA 4XHXA 4DFSA 3IWZA 1H2KA 5CFCC 2C4XA 4QHZA 3FWEA 3I8TA 5T5LA 2ENRA 3CHXA 2XUMA 4XJAA 3OPZA 4QPGC 1B35C 2W3JA 3VBHB 4DEQA 1WEPA 1RUNA 2W1WA 1Q56A 3AZWA 4HN0A 1X33A 4Z82A 5E16A 4CDXB 5LZ6A 1KJLA 3TEWA 4R4ZA 1UY4A 3S6PA 4WV8A 3HQRA 5LKTA 3S7EA 1HRI3 4L92A 3AJYA 2A3XA 5IFTA 4LITA 1REDA 1NZCA 4UWDA 5DAQA 2RJKA 4Q1RA 3WF4A 2VMEA 1Q8SA 2ZX4A 3NJZA 3ITQA 3OPWA 1QXPA 2VJXA 4NR1A 3VKOA 4A7KA 1WEQA 1R64A 3WD5A 3LAGA 1EY2A 3FFZA 2BV4A 1RUG1 2WO1A 4OZOA 1PGL1 4UFMA 1RUI2 5IHRA 3GXUA 3TEXA 4IEVA 2K0GA 4MXVA 1WE9A 2AH2A 3KQIA 1WD3A 3O70A 4AQSA 1O3TA 1DQ0A 1GYKA 4NHKA 2EICA 5FYBA 5A33A 5KC5A 2PHRA 3IDAA 5H9SA 3W58A 4L2NA 1ZBE3 4LEJA 5FDBA 2BGPA 3IHPA 1BBT1 4CP1A 4BBQA 5CKQA 1D4M1 4OGCA 2DYCA 2HEYF 2DFCA 5CZKA 5CEHA 3WQBA 1CR7A 2QQLA 1OQEA 2JE8A 3NKGA 4JTOA 3JQWA 4AFBA 1YCIA 2LRPA 2EXUA 2W95A 4J1WA 2FSAA 4DO0A 1GWKA 4S2FA 1EAH2 1Q43A 2UYAA 1MQTC 1O3SA 1UZ0A 4XI1A 4QGMA 1YFXA 2C2LA 1SACA 2ARAA 5FAXA 1W9FA 5F1RA 1ZZ9A 3ZVZB 5I0UA 3V56A 2CDOA 4B3NA 1F31A 4PBOA 4Y3OA 2WYSA 4NHLA 3FN9A 5LATA 3L1XA 1S0DA 4KWJA 3KVBA 2BPA2 4YC9A 1W90A 4CUCA 1JODA 3VBFC 2A73B 4BM8A 1HRI2 1Q8PA 5KH7A 5FXXA 4Q4V1 2WFF1 2KD7A 1CAXB 3VDDA 2YSMA 2Y34A 2W08A 4ORFA 1AJKA 1S0CA 2JMDA 1PGW2 5EIYB 3VDCA 1DGWA 1L7QA 1Q5OA 1W3XA 3FX3A 2PQSA 4Q4Y3 3S30A 5C70A 1ENRA 4XQWA 3O1RA 1X7NA 5AVAA 5FB1A 5IVEA 4M01A 1NY71 1HQWA 1OH3A 2KREA 4Z92B 2L7PA 2JDKA 2VG9A 4RGGA 4HN1A 1R1A2 1UMHA 3WDUA 1Q8OA 3WW3A 4BISA 3BU0A 3N9MA 5ANQA 4YVSA 2XLAA 1G25A 3SH5A 1W6PA 2Z42A 5IVYA 2RR4A 2J1SA 1J1TA 2QBXA 3AYCA 2JIJA 4CTEA 4CXXA 4JKMA 4YVWB 3VBUA 1BVP1 3UL2A 2VC9A 2LN0A 2HH9A 4N8MA 4UFJA 5GLWA 2NPIA 5BNOC 5JIAA 3R4DB 2VR4A 1QQP2 2PHFA 5J48A 4W8JA 2YC0A 1MS9A 4QF3A 5JSOA 3WNPA 2HDPA 4Y1UA 5FY1A 2OW4A 4OQ8A 4AVSA 1NCQB 2ZKLA 1OOPA 2QDRA 4AK3A 5C7GA 3L11A 1RHI1 5FP9A 4JHZA 2K2SA 1ENSA 1LDJB 4NAOA 4XAEA 2PYTA 3FFQA 2IUWA 2MEV1 1SFYA 3C7GA 4Q8KA 3FL2A 3U1XA 1QH6A 2CONA 4E4DX 1RJ7A 4I7DA 4YSFA 2V5YA 3MDPA 3AZVA 4XIKA 3LEIA 3T1LA 1PVC3 1DQ4A 3ZFFC 1TME3 3SCGA 1LKNA 1QKQA 3BOPA 1RGSA 3WDVA 4CPBD 1U0AA 3CJIB 4QXKA 2MT5A 1CJPA 1FAYA 1XE8A 1PK6A 3BVCA 3QCWA 4YG3A 2R6QA 4FAGA 5ABJC 5LY1A 4O62A 3RI9A 5KXDA 3AMMA 5FWJA 1JZ8A 4HMZA 2JICA 2DTWA 1MS3A 2QQNA 2R7EB 3POJA 2E63A 3AC0A 3V0AB 5FY0A 3OPTA 1DZQA 4ZPIA 1ZYBA 1RINA 1UZVA 1LGCA 3AVSA 4OI0A 2ZHNA 5GLUA 5L7OB 3OYWA 2WSVA 4FAHA 1ODMA 2LTNA 2ZCWA 4V3KC 2DU1A 5E6HA 2LGGA 2I74A 2RDNA 2WO7A 3KD4A 3ETPA 2RDRA 3OTFA 4LO6B 3MW2A 1W6QB 2ZGMA 3M3OA 2YUCA 5C4WB 1REFA 1MS8A 1W9WA 3FBYA 1XNKA 1SCRA 4F3JA 2EXKA 4N9HA 3PIGA 2UURA 2D43A 4DNYA 3O47A 4LPLA 4QDSA 3KCYA 1U5IA 3MIDA 3KVAA 1SZBA 3R4UA 4IE0A 1E4UA 5A3TA 1SLAA 3K2OA 1UY1A 4P9XA 4UFIA 4GNDA 4L99A 1N3PA 1AL23 3ZPVE 1WMDA 1WLTA 2J1TA 4FPEA 4Y1XA 2JDHA 4B4RA 5JR7B 3T4HB 1ALYA 2CY6A 1W6MA 2JE9A 3V0BB 1PVC2 1OLMA 2NMOA 2V09A 2D7FA 4LOTA 3O1UA 5FZCA 4PIXA 4K7JA 3POIA 4B7KA 3T6RA 2BGCA 4Q29A 3CBNA 3TRSB 2Q0AA 4P5HA 1BMV2 2VPBA 4K40A 1CPNA 5FZKA 1AXZA 1KQRA 3K77A 4FBFA 3NAPB 2LW8A 1RUD3 4RSUA 4Y20B 4QWNA 4XIOA 5G05B 4CA1A 5SVIB 2XJPA 5FYHA 1S0IA 2MKEA 3ILFA 3EHKA 4FTBA 4XILA 1S1AA 5ACA2 5FBZA 5IUQA 3HTKC 2W1SA 4LE4A 2ZGLA 3DEMA 3S5QA 5A6QA 5GZGA 2Z5WA 2OZJA 2ZTNA 4QU1A 4O9EA 2IFRA 1LHNA 3ZYGA 1QJU3 2VVFA 3ZSLA 2KXLA 3EO6A 1TEIA 3M3QA 2M13A 5FZ8A 2L5UA 1UY3A 1AYM1 1K5MB 1VP6A 3L9JT 4IQPA 4WVZA 3TBDA 3BTAA 3IB3A 3SKVA 3O7AA 1RUJ2 2XL7A 1YI9A 1UU5A 2ZAHA 1JZ4A 2B4KA 1CPMA 3QH6A 4OMDA 5AC91 1OC1A 4CU7A 4LK7A 1YXWA 2L0BA 3VL9A 3PU8A 5EWSA 2OWAA 1QJFA 2CAUA 4HVRA 1AL22 4COZA 1ZZ7A 2WNEA 2YXSA 2YURA 3AKTA 3VDDC 5FPXA 3BU7A 4XDPA 1RVF3 1C5HA 1G9BA 2IC1A 4AEDA 5A7QA 2SLIA 3EMRA 4BLJA 3CNAA 1DHKB 5AVPA 3TAYA 4L7XA 2FDGA 5I0SA 4MGTA 3H1WA 2WT1A 3HPNA 1FPN2 3FL7A 5F2SA 3O1VA 3JD72 3ZFGB 1IQDC 1W05A 3UGFA 1SLTA 4XHBA 2D97A 2QJVA 1BK1A 4CDWB 4BWOA 3NO8A 5J09A 3ACIA 5T3NA 4W65A 1ODNA 2WNUA 4XQDA 5A6ZA 1CJDA 1PO13 2JIGA 2ZX1A 3OGJA 5HI0A 4TTGA 3ZVYA 1RUD2 2WRAA 1RMU2 4R9DA 2PLV2 4LNVA 4L9BA 4YM1A 1W8OA 5FZHA 5IVVA 3RZJA 4FP2A 4IETA 1E5HA 4IEPA 3H9AA 4YVSC 3SUBA 2DCYA 1HYJA 1H2LA 1PM4A 3VBOA 3JBG1 4Q4W3 3UJQA 3UV9A 1QJY1 3QLQA 4UYBA 4RL7A 3VBUC 4DINB 1AR61 4C91A 2E7QA 3T2TA 3J8F2 2K17A 2BOIA 2Y6LA 3AMHA 3ZYBA 5FYMA 4A3XA 4G4FA 4EWDA 4GNGA 3ZYQA 3VBRC 2ZS6B 5FQ0A 4LKDA 4E2SA 1KXGA 1FT9A 1MS5A 1LRHA 2B9UA 2H0VA 4RHV3 1OUXA 3WLUA 2G6QA 4MGYE 4PQ9A 5IVCA 3CZUA 4U36A 1UKRA 1X82A 3T7LA 2DUOA 1AR93 4AL9A 2PHUA 4RFT0 4YM0A 2X53S 2OPWA 1F2NA 3PTYA 5LRSA 5JOWA 4TZDA 2QICA 4LK6A 2RHPA 1Z7S1 4H9DA 1RITA 1RVF2 2VOXA 1ZRFA 3K3OA 3MBWA 4G3YC 2LAUA 2K9ZA 2HWF1 4W6WA 3IPVA 4Q2FA 4BHPA 2UY8A 2F6NA 4I2OA 1GNZA 2VVEA 4MH0E 3KMHA 2ZHKA 1RJ8A 4XBLA 4GKYA 5JAXA 1VBD3 1PK6C 3OOXA 5H9PA 4XCAA 2XBO1 3K4ZA 1VPHA 1HRV1 5J36A 3PTRB 2Y6GA 5DAWA 1PO12 1CD3G 5L9VA 2PN5A 2BQPA 5GLTA 1W6PB 5DABA 2YU4A 5A3UA 1BORA 1LOBA 2FMDA 5B78A 3GDBA 5CA6A 1AR71 2E9QA 4JDOA 2XONA 1KS5A 4CUAA 2V4VA 2X5IA 1RYYA 4L11A 3U11A 1RIRA 4A3ZA 1LOFA 2R32A 2OX0A 2R071 2Z2SB 4UW4A 3SHRA 4XXPA 2QQOA 1Y9MA 3ORJA 5J1XA 2ZX0A 4BQ5A 3LOBA 3OB8A 3D82A 1OOPB 4RA0A 5HCBA 1RUF3 1OKOA 1IKPA 3CJXA 5A6XA 1UW8A 1VD4A 1BEV1 1CVNA 3I3QA 3RGBA 1E57A 1UIJA 3LJUX 1JOCA 1WEWA 2DFBA 3OD4A 4RR3A 3E6DA 1MVQA 2LUWA 1GOFA 5EPAA 1H8TA 1EV13 4HPKA 3PUAA 4AXOA 4ZQLA 2VPGA 1D2QA 2X8KA 4FXGB 2VZ3A 1JH5A 3H50A 4XDQA 4FPFA 4LR4A 2YW8A 1IGOA 1TQ5A 1YRZA 4XAAA 5KH9A 4Y22B 1PK6B 5GZDA 1H2MA 3LEGA 2WABA 3SC7X 1JU4A 1XYOA 3P1IA 1H6YA 1PO23 1F9KA 1R092 3OUHA 1C28A 1OF3A 1VBD2 2FMYA 4CPBA 5J3UA 2LXPC 2HEVF 1BYHA 2YBKA 3HIFA 4MGSA 4TSVA 1O3RA 1FOD1 2YFZA 5DINA 2B8MA 4GH4C 4YW3A 1KFXL 2JUNA 4D0QA 2P4EA 3LOIA 3NV1A 4B4PA 2VP7A 3OEAA 5FERA 4KG0A 5C8CB 2D40A 4WA6A 2XOMA 1OLRA 3IZOA 3AMQA 2C1FA 3OYWB 2OQ7A 5T5PA 1WW5A 2WS93 1UQXA 2HWE2 3M3EA 2RDSA 4Y4RA 4LO7A 1LHOA 3DPRC 4HOOA 2Y43A 5F37A 2GNMA 2ZBJA 5FYTA 3SISA 2LM3A 4LHLA 2J1EA 3IIIA 3LPGA 4GA9A 3ZYPA 4PDWB 2XL9A 3EB7A 4PHZA 4Y5TA 3I49A 3LKJA 2D3PA 2X05A 3LDKA 3BIWE 4QKDA 3POSA 1RUF2 4I0WB 5KHJA 2FCVA 1GANA 3ZYJB 2N7GA 3HT1A 4XFIA 4AHWA 4J1XA 4GB33 3N7MA 1QDCA 4S3OC 2MNZA 4MV2A 3FZ3A 1U5ZA 3FJUB 2C24A 1X4IA 2NYYA 4NWVA 4M3CE 1EV12 1NA1B 3C7OA 1JUHA 5JZGA 2A3WA 1MEC1 1COV3 1W6MB 1ZA4A 1BHGA 1JBCA 2Y60A 4Q26A 1VBB1 1NCRA 3C8XA 2H0DA 1ND2B 4MX3A 4IEXA 4AEDC 1D7PM 4ZU5A 4EN6B 4AYCA 4LA3A 3VHRA 4AFMA 1PM7A 1U5YA 4CU8A 4X8NA 5I8TA 3B5LB 2W2IA 4N9IA 1C8M2 1OVPA 1UD1A 2JDMA 4H2AA 1AR83 2H0BA 2JKXA 4HSLA 5FPZA 3WQ0A 2WQZC 2J1VA 3VBHA 2IXKA 5IFPA 2YYOA 1IS4A 3DXTA 1XE0A 2DVBA 2ZHLA 1V9U3 4GWJA 2WNUC 2QIZA 1FMD3 3ES1A 2K46A 4DY5A 1VBA3 5C9AB 3I2HA 4HZFA 4OFGA 1GQPA 1IKQA 3CL1A 5CG9A 4JDMA 1CZVA 4AI9A 2XOCA 2VECA 2UZGA 3RVHA 3KZ4C 4AF9A 2GH2A 3HT2A 3MIFA 4GWNA 5A7NA 1ASJ3 2BDRA 1JOBA 1NQDA 2RJ2A 2WS92 4FOYA 3HN3A 1VE0A 2B9VA 4GQ7A 4BH9A 4LUKA 2ECIA 4H55A 4LKFA 3LE0A 5E89A 3ZIXA 1RUE2 1T2XA 3M7AA 5LCWL 2R062 4NO4A 4CCEA 2I2SA 4FPCA 1RUC1 2DV9A 4Q1PA 4AQ6A 4DPNA 4XTMA 5BPXA 3KHCA 3LB9A 4AG4A 3DYMA 4K3UA 5F6LB 2GMPA 4YW7A 2KWOA 5FYVA 5D1LB 3KHBA 2R042 5F9TA 5HBAA 2QQVA 1XNBA 2QQMA 1VIWB 2XLFA 2Y64A 5FJKA 2XOZA 2HWD2 5IWFA 1HKDA 1I6XA 5H9MA 2E6VA 3ACGA 1HJGA 2VZSA 5HV4A 4P5YA 2BFUS 1CX4A 1GZTA 3GCWA 5LY2A 4OUSA 5C8WA 2XQRA 1QGLA 1ULDA 2C9KA 2WZ8A 3N35A 4QX5A 5F32A 5EYAF 4KGQA 3LFIA 4CXYA 4YBMA 5T50A 4AVXA 1W2TA 5JLVA 1SBEA 4CP0A 5I91A 2WDBA 3LQJA 4IC3A 4IEYA 1HN0A 4IEQA 3JB8A 1JYVA 5FZ9A 1GOGA 2WAAA 2ZGNA 4W50A 1QJX3 2ZGUA 4TYSA 2PA7A 2KWJA 3VBSB 4DXZA 1S0FA 3C2UA 1DYOA 2WINB 1FMD2 2WZR2 2YFUA 1F5FA 1VBA2 3O14A 1OH4A 1PMIA 2OS2A 3OG2A 5SV5A 1XSQA 3FM8C 3VBOB 1CAXA 2VJFB 2DVFA 1ZZ8A 1VB2A 1UPSA 2TBVA 2FDHA 3D0JA 2ET1A 1MS1A 3EQEA 3PIJA 4QQHA 3D0SA 4QXCA 1SPPA 1Z0HA 1ASJ2 3OGRA 4CCCA 4JRLA 2MD8C 1CAWA 1KEXA 1ZNPA 5DMYA 4YW2A 1E5IA 1W8TA 1LOFC 1R082 3E6BA 4HBNA 2WN2A 3LEKA 3BB6A 4IGOA 4LBNA 1JI6A 4BK5A 2KM2A 1YFYA 1BQPA 4EN0A 4Z8BA 2LXHC 4AUQB 5LKXA 2D6OX 4V2WA 3I2OA 3NNGA 1I3HA 1TMF2 3FC0A 1GZWB 4FPYA 2LQ6A 3KT7A 3HBZA 2XXZA 2C9AA 4CCKA 4J6GA 5FMCA 3UNPA 1POV3 4W4UA 2XKPA 1S0GA 2O1QA 3HCUA 2ZEWA 1UNBA 3LFMA 3NNJA 3RWNA 2UWBA 1AF9A 4LIVA 2Q8EA 3VKFC 2ZETC 4RR3C 4D6RA 4YVWA 1H8TC 2CKLB 2VCAA 2HWC3 3BGAA 4XZPA 4XCBA 2V5DA 3J26N 1PIV2 4AHZA 2GU9A 2VMGA 2YY1A 4MO3M 3JB4C 3EB5A 1W8ZA 1UXXX 4GIQA 4FTEA 2IWGB 3NMBA 1LTEA 3BALA 4PTBA 4NE9A 4PI2A 2G19A 1X8EA 5T52A 1TNRA 1ZX5A 3WR0A 5H1VA 1DGRN 1DZTA 1NCQA 4JQTA 2MD7B 5K7PA 1AX0A 1AZDA 4Y1YA 3ZXLA 1VR3A 1XYNA 3ATGA 1JUIA 2UU8A 2PAEA 5B77A 5FBJA 2AN6A 1VRH3 1MZ6A 3PURA 2F42A 3MEPA 3WHUA 4BA6A 2X5IB 4D7YA 2VZQA 1PZ8A 3I2GA 3PHMA 5I8YA 3OJBA 2XVGA 4KQ7A 4XBNA 2L43A 4WZ0A 1S0EA 5TDWA 3CJIA 5F3IA 1VBC2 3VKMA 3ZPOA 2KR4A 2PELA 4FPLA 5IAXA 3TN91 3IT8A 4YATA 1IS5A 1C3HA 4CRQA 3ZXGA 3GCXA 4AHXA 1AXKA 5LA9A 2RS53 4CU6A 2ILMA 4Z2WA 1Q3EA 4A42A 2YB7A 3V0AA 1LOEA 3NVCA 5FO8B 5T54A 5FP4A 1WWYA 1V6JA 1RTVA 2ZGPA 4CEYB 4HPKB 3WG1A 4LADB 3MHHA 1G8WA 4F83A 4NRQA 3I59B 1OMIA 5L7OA 2VW0A 2OZ6A 3M7KA 3HNBM 3VHPA 5JZGC 1NXD1 1QOTA 1W2NA 2UY9A 2E7TA 3U4XA 2Q8CA 5SVIA 1HQLA 2RS11 1VAKA 1URXA 3FE5A 3HAGA 4J25A 3U07A 5C4WA 3WOGA 3MDBC 3ZXKA 2BP6A 1YIFA 1WMXA 2VQUA 3MPPG 4XJ8A 4YWAA 5EV7A 4TKPB 3U5NA 3WF2A 1JZ2A 4Z0OA 1CONA 2BNOA 3U5OA 3T2OA 4I0BA 2ID4A 4NROA 3VBHC 4CZSA 3M63A 4WZ2A 3D8CA 2D6MA 2JDUA 4O61A 1AUYA 1S2KA 4GMP3 5D8AB 1QOSA 4B7YC 2CRWA 5FY7A 4EQVA 5ISLA 4JRAA 2VZRA 2Q1FA 4FXKB 2HBUA 3K3NA 1LENA 1VRH2 2ZMKA 4I3GA 4UP5A 1NT0A 1SFNA 4BPZA 4BIOA 4P14A 4QQ4A 1ZA7A 1MVEA 4LA2A 2CAVA 3V0BA 4AOCA 4PT6A 3BTXA 2ARBA 2O8QA 4NIIA 3WUCA 3N7LA 4P9LA 2YROA 3NW4A 3OD0A 4YZ5A 5IATA 2IVJA 5I93A 2ZGTA 3H8RA 2QZ3A 2O14A 3NAPA 4YW1A 5IW0A 3ROUA 2DBNA 3CF6E 5FYIA 2CRRA 4WZ3B 5B75A 1JHJA 4HSJA 4YGEA 4NIDA 2A6ZA 1ZVFA 3AZXA 3SCFA 2BBVA 4AYUA 1UL9A 2C0ZA 3HQUA 2D5FA 5KXBA 2VCMA 2H0DB 1NCRB 2OUJA 4AYCB 1EAH3 1OBNA 1R1ZA 1UZZA 1RUI1 2OUHA 2FDJA 3KV5A 4NPRA 5JWPA 4OHZA 1EP0A 4Y1ZA 1WEOA 5IJRA 1UF2C 3AKRA 1UY2A 1K5MA 2QKDA 3PUSA 5BNNB 5DDJ1 4RGAA 1HN1A 3RDIA 1HJFA 1GMMA 1N1TA 1WLCA 3Q8EA 3ES4A 3J7HA 1F35A 1HXS2 4DUXA 2HWB2 3DKWA 3Q9OA 3QZVA 2K1JA 4IUGA 4UW3A 4AFCA 2RMU2 3ZFEB 2MHFA 4BQ1A 5FR3A 1O3QA 3BPSA 5LWBA 1ND3B 3MW3A 4FI9A 3PVOA 2E32A 1WMEA 4NMIA 2RI7A 4XPVA 5DKAA 3BTZA 1VAVA 4PBPA 3KS7A 2RDQA 3ZFGA 4ZZ8A 3HN1A 1GNYA 1M4WA 3ZOIA 1GNHA 3WNXA 4CDWA 1R1A3 4MUVA 3U0ZA 2XB1A 2P3KA 4XF4A 3IAPA 5ANNA 2MIQA 4ZONA 4LKAA 4OUMA 3W20A 3AKPA 4PF5A 1ENQA 2D8SA 4JX0A 4SLIA 4UBHA 2JECA 1OT5A 4B8EA 4CU9A 1VBE2 4NRMA 2IQJA 3DQVR 3O35A 4XURA 1XU1A 1IS3A 2WL1A 3GF6A 1MS4A 3FLRA 2XGXA 3OCPA 3QBQA 3MPBA 4H7LA 3SQOA 3UETA 5JSRA 4QT6A 3WQ7A 4CE8A 4GJYA 4XOGA 2YU2A 2VNFA 4YVWC 1QQP3 4WVVA 5FMOL 2D44A 5BNPB 3CMGA 2GZWA 3DGTA 4RS5B 4JZRA 1B09A 4QM8A 4HXCA 2D3SA 1CESA 2WWJA 3GGLA 4V2VA 4I02A 1QH7A 1GQHA 5FZEA 3AFKA 3UKVA 1ACCA 1NCQC 1ZBE1 4MOAA 5FPVA 1F15A 3NRUA 3ZMOA 3SHBA 2VL4A 2BBAA 2A71A 3LZZA 2ECWA 2MNYA 2Y0IA 2WR9A 3BTYA 3ZSJA 4LBQD 3T1MA 5EJ3A 1HV1A 4PLNA 3RZHA 1LESA 1KD7A 1SPPB 2VZTA 4ZZ5A 4AR2A 5F39A 2E7AA 4A49A 1CAWB 2DCZA 5LKUA 2ATFA 2ZA9A 3R0RA 2FCTA 4GULA 4YG6A 3GBGA 3CJIC 4AVBA 1PGL2 3KQRA 3WDXA 3N4MA 1PHMA 1W8WA 1XJAA 2JG8A 2ZMNA 2QQWA 3K51A 4HK9A 4W4ZA 3FAOA 3L1ZB 4MZUA 3U5MA 1A8DA 2IFWA 2KKXA 2ZGOA 3LA3A 4QX2A 3MIHA 5JXHA 1I5ZA 4Y33A 5EZWA 1E5SA 2D6LX 3D6EA 4FOQA 2WNOA 2XG3A 3TYJA 2VMIA 1BBT2 3KLSA 5DZFA 3SXWA 3RZGA 4XACA 4YBSA 1D4M2 3VLBB 4JTNA 2CYFA 2XVLA 4CA9A 3VK6A 3AP7A 3WHTA 1SLBA 5K9YA 5A3WA 3PJQA 4Q4Y1 2P57A 5L7OC 4JGYB 1V6IA 4IC2A 5DAVA 2I45A 4GWMA 4FP3A 5K4LA 1SLCA 4BK4A 1CHCA 5AFEA 4R9BA 2A1XA 2CGPA 2D93A 3POFA 5C4WC 5EJ1B 5LBCA 5FY5A 3RJ2X 2YZ4A 4I3PA 4ONUA 3WX5A 4CEWB 3KV4A 4NHMA 1J84A 2BZDA 1UU6A 5GKAC 1WEEA 1EUTA 4QQLA 1S2BA 1OXCA 3MZHA 1JHNA 1WEVA 1N47A 4TN7A 2CSVA 4AAPA 2CU5A 4S2HA 5BY5A 2ZX2A 3GBWA 3O33A 1X9PA 4Q4V2 2WFF2 2W92A 1WUVA 3T2PA 4N7UA 1PZ9A 3T09A 1NLSA 2WT2A 2RR11 4UI9L 1QJZA 5F2WA 4XE9A 4JGZA 2JB8A 2VNOA 5DG2A 1QNWA 2AREA 4QM9A 4Y22A 1ZRIA 1DG6A 3O1MA 2JMIA 1QXRA 5E1RA 2ECJA 3HR9A 1Z60A 1QJEA 4M00A 3KF3A 4ASLA 2WKKA 3RZKA 3N9OA 4IE4A 3WT3A 3GZAA 3INAA 3WV6A 1V6NA 4MG2A 2DUQA 3ENRA 2VCCA 3NAPC 3OBRA 5FY4A 5CYYA 3AXEA 3VUOA 5TABA 5ACA3 2W1QA 1XE7A 1W8HA 5C8CA 2ECTA 4YM2A 1NE4A 1T6BX 1YWKA 3H8XA 1TME1 3SITA 1HYIA 1LOAA 3RTRB 1FYUA 4E2QA 2VBBA 1V87A 1LGNA 4LLOA 3ST7A 4LBLA 2W46A 1Y43B 1UIKA 3DKQA 5FK7A 3ZVXA 4CCDA 3WVJA 5JIUA 2OIIA 5DQ0A 1ZM1A 2X29A 4PDWA 5IVBA 4F7ZA 1NAEA 1REEA 3KV9A 2YYRA 4URTA 1RUJ3 2ZAAA 1LR5A 1HQNA 3R4SA 1K5MC 5FY8A 2M1RA 2ZACA 4UOJA 1AYN1 2R30A 4YABA 2WN3A 2WLPA 4MHUA 3NJYA 4TLGA 5GZEA 2FZ1A 2ORXA 4PIYA 4BQXA 1X4JA 1NA1A 2P5BA 4YZ2A 3ZR5A 1DGLA 5LCWB 3N9LA 4E9KA 1WZXA 1I1EA 3ZPV1 4V1PA 2BU9A 5KXCA 1FPN3 1ND2A 4IV3A 3U75A 3X29B 3DXUA 4AI2A 1X50A 3JD73 1JYTA 1NKGA 4ZDTA 2B39A 4XMAA 2HBTA 1W2OA 3E1F1 4EYUA 3OF1A 1QF3A 4AI8A 3E97A 3LA7A 3ZSEA 4IE7A 5I8SA 3ZFGC 4FFGA 3ASIA 4IL7A 1ZBA1 4TXWA 1ULEA 4P08A 4OQ9A 5D1MB 3SCHA 2JJ6A 3ZXDA 4CDWC 1RMU3 2PLV3 3JZVA 1H1IA 3EXUA 2VZOA 3C7HA 2WUHA 2DJAA 1AL21 3WDYA 2YQLA 3WF1A 5C9AA 3JUUA 1JYWA 4QX0A 3SMHA 3ME2A 3ZDVA 5JPNB 4LJNA 4XMIA 3VD5A 4HVQA 3VL8A 2H6CA 3S0MA 1W2AX 5FZMA 1XNCA 4BXSV 2Q4SA 4X6RB 1G7YA 3J8F3 4P9GA 3KV6A 1V0AA 2J1UA 5CISA 1YIPA 2G1MA 2KWKA 3VDAA 2RM23 1YQCA 2B45X 2OXBA 4C0HA 5DAXA 1AYM3 4IXLA 4JKKA 3POYA 4XJWA 3O1OA 3CEWA 1RUD1 3ZN5A 3LSDA 3RWKX 4UF0B 5C33A 4NN2A 2ADEA 1VAMA 3V65A 2Y33A 5B4NA 4R8PK 2FCUA 3ZN6B 1O5UA 5AC93 1A34A 1DF0A 1WGMA 2BYVE 2C26A 4BHWA 3QH7A 1N1SA 2YHOA 2BVVA 1H1MA 5FRAA 4ARYA 4GALA 3QD6A 1A78A 4H7MA 3H0OA 3CIHA 4CP2A 2R0HA 3ZSMA 5A7SA 5EP9A 4LIUA 5FYCA 1QJU1 4LBKA 5FK8A 4YM3A 4L8QA 2YG0A 4YGDA 1IHMA 2KFTA 3FUQA 4IE6A 5TDRA 2EVXA 2PHTA 3E5UA 4RQPB 2MNGA 3LDRA 4SBVA 2ZHMA 3VKNA 2DWRA 2PXJA 2OXQC 3RZZA 3WNOA 1CAUA 3VBSA 3J9SA 3OY8B 2WC2A 1KGYA 1KDKA 5AIUA 1V6OA 1WESA 1L7RA 1MZ5A 5L73A 5F5QA 2BW8A 4CCLA 3ALQA 5J96B 1JZ7A 1RVF1 2VJFA 4YNIA 4D3WA 2ZGKA 1SHWB 1QJY3 4YW4A 2D6PA 4N90A 1LU2A 1D0HA 3I3EA 3ECQA 1QMJA 2WWSA 3LEMA 5JOZA 1LU1A 2GALA 2RM22 2R1BA 2XOYA 3AYDA 5AFBA 4KWLA 4XJ9A 3RPGB 3OBZA 5FZLA 2VTFA 1YFUA 2IZWA 1AYM2 3H1YA 3MYXA 4WVWA 1GZWA 1OOPC 4QGNA 3UESA 2JE7A 1MBMA 5JMOA 4KU8A 3BIEA 4BMEA 1XXNA 2G43A 1XWHA 1YI7A 1GICA 4D94A 4CXWA 3MIGA 5AC92 4FO9A 5CFDB 4XFFA 4Q4W1 4YFZA 4YZ1A 1OHFA 2YBSA 3DL3A 3I2KA 4S2DA 1DVPA 1NE6A 2RS33 2CKLA 3CLPA 2BJSA 4LULA 4AGGA 3O0XA 4I0AA 3NQHA 5FUIA 2J22A 2HWF3 3NNMA 4K21A 4NIAA 3RYPA 3UT0A 3CQOA 4LBQA 2BAYA 2K4DA 3W5MA 2L75A 4XETA 1N87A 1Z6UA 3TB0A 2RJLA 4YG0A 1R093 4RHV1 2JG8B 4DS0A 3GZUC 3OUIA 3WNMA 1W06A 5GZCA 2KWNA 4Q0QA 1AR91 2GC3A 2DTYA 3M4FA 3NKTA 3FBMA 5C3RA 1UOFA 2AGSA 5A7WB 2JMJA 1S55A 4OGEA 5FB0A 2G9FA 4K1ZA 5DG1A 1SMVA 4OUEA 5JR2A 1DYPA 1W9TA 4XFHA 1LHWA 2EAKA 5TRBA 3A23A 4COUA 1F8VA 2Y8KA 1UCXA 3ACLA 3IAQA 3ON7A 4A4AA 1G9AA 2LGLA 1IZ3A 2HWE3 4R9CA 4XUQA 1PGSA 3JBG2 1RXGA 5C8CC 3RZMA 4JDNA 4XF1A 3LIHA 5KBFA 3RMYA 1QJY2 3PUIA 5J98B 2BUKA 2FDIA 2JKBA 5LW9A 1AR62 1WENA 2VMCA 3KGZA 5FLHA 1OA4A 4BOWA 2G9GA 1YNAA 4CDUA 4CVUA 1WFKA 3CZJA 1QU0A 4GNFA 4DRVA 2ZGSA 4BZ4A 3NG2A 2VUDA 4QPYA 2W52A 1SQ4A 1SLIA 4PDWC 4LE3A 1AL0G 2V73A 1G9CA 1UXZA 3G6JB 2D8UA 1LOCA 3M3IA 4JQRA 1C1FA 3ZMNA 3V64A 1S2EA 2DCTA 4CCMA 2A6YA 4CEYA 4BB3A 1ZREA 3BOWA 1YC61 4HKOA 3I59A 2RS32 4K9SA 1Z7S2 4BYYA 4BIFA 1NA1C 4JGZB 2ZGQA 2SBAA 1KDMA 2HWF2 2PHXA 1GV9A 2XVKA 4QKFA 1ND2C 1LOGA 1C8M3 1NYWA 2XQXA 4IV3C 4QHOA 5BXXA 2W94A 4EWEA 3O36A 4X3GA 1NLQA 1RUF1 1BVVA 3MV11 2OA2A 3DCQA 4MGQA 2ZKNA 4LO5B 4OZXA 3BN6A 3RSJA 4N7IA 3I3MA 2XJRA 2CSZA 4I7CA 2XBO2 1GP5A 1WBFA 2VXRA 5KWRA 4RFRB 2EIEA 5FZ1A 3KT4A 4M4RA 5D8AA 5IYYA 3M3CA 4GD4A 3I2FA 4KMQA 1NZIA 4YFWA 3VB9A 5L36A 3LIGA 5KHKA 4YRDA 1GZ9A 2E26A 3TNQA 2NM1A 5C9AC 4ZHNA 3BKZA 4H14A 2EF6A 2AC1A 1AR72 1Y4WA 1PZ7A 3A0KA 3VDBA 2D5HA 4QMAA 1OQDA 4JKLA 1LODA 1YO8A 3O34A 4YBTA 1RUE3 2JDZA 2VQTA 2A5ZA 4ARXA 1JOPA 2R063 3RZLA 1PO21 4ATFA 4A4CA 2JG9B 2DURA 4I01A 4ET7A 1SDWA 4LXLA 2IVIB 4U2AA 2E61A 4COWA 1OPOA 4AW7A 2YDEA 4PLOA 1GBGA 3BI3A 1BEV2 2YSJA 2R043 4Q0SA 2WZEA 3THPA 2QQPA 4NIHA 1YJKA 4XF3A 2HWD3 2JD9A 2J1RA 3PJYA 4Q5OA 4QPWA 2WS91 2YPDA 4P9YA 2QJ0A 4X8PA 3VD7A 2PMWB 4XTPA 2XJQA 4HVOA 4ZXKA 2DSMA 1VBB3 1WCKA 4IV3B 4KWKA 1VB4A 2BGOA 4MHRA 4FT8A 2WLQA 4YZ3A 4A6SA 5A7OA 1VMHA 2VMDA 3VHOA 3ZKUA 3UKNA 4AEMA 4Q4X1 5CBLA 3AFGA 5FIXA 1N3QA 5BNNA 1Z2QA 2CSYA 4GXLA 4V3LC 2AENA 4XXAA 2FZ2A 3D4KA 4XYXA 2YV8A 1RUH1 4GB31 4AVCA 1FOD2 2WZR3 2YC4A 3Q8FA 2ORZA 4QPIB 5GJ6A 1TNFA 3O0WA 4ZU7A 1WEMA 2G4IA 1C8NA 3VBSC 4CDQA 4OULA 4B4QA 2FBEA 4JVAA 2VMFA 2NN8A 5FZ3A 3RMXA 3ZDSA 5EJZB 3ZFEA 4EJRA 1COV1 4LO8A 2CTVA 2QFEA 2R0FA 4IDZA 3VBOC 4EV0A 1L3JA 2JENA 1CGPA 2XKOA 1ND3A 3F2ZA 3KM5A 3KT1A 2DUPA 5FUNA 3VZJA 2XR4A 3ASLA 1R083 4DIQA 4N3WA 1LULA 1GZCA 4ASKA 1DQ1A 1AR81 2WYFA 4QD2A 1LAJA 2IXIA 4BLIA 2W0XA 2P34A 3AZYA 1TMF3 3WEZA 4H3WA 1W8UA 4LOSA 1VRBA 1RMDA 2KYUA 1WA6X 1V9U1 1VJ2A 2Y38A 3AXDA 1FMD1 1MZEA 1VBA1 5LA1A 3VKLA 4XEZA 3B00A 2VNGA 4CP9B 5G04B 3FMGA 2QNKA 4WBBA 3ETQA 2CHHA 3WP4A 1W2UA 1IYMA 3EYPA 3PNAA 1JYNA 4LTAA 2DVDA 2KGIA 2YGMA 1V6KA 2PAKA 1ASJ1 3VD4A 4PIZA 3LVQE 4LJHA 3DDTA 1CAVB 1N3OA 1PIV3 1V6MA 4FPOB 4FPKA 4XDOA 1MEC2 5BYNA 2KU3A 2PTMA 2PHWA 1F4AA 1VBB2 5BNPA 3WG3A 2WNVB 1DLLA 4RS5A 2VOWA 4HK8A 3M1HA 2IXHA 4KH9A 4G9SB 3U10A 1JYIA 5D1KB 2EIBA 3U37A 3WINE 3AJZA 1JXNA 2QZ2A 2WT0A 4KG8A 4D7TA 3B94A 3CU7A 4N4FA 5C13A 4B1MA 3USUB 2Y26A 5FMBA 2ARCA 4GJZA 5C3QA 1CAUB 2VW1A 3C7EA 2EGMA 4META 3VZOA 5LBBA 3RNSA 4DUWA 4MGIE 1U6GB 2LGVA 3H8OA 5GLVA 4BQWA 2PFWA 4R52A 2ZPXA 3DUIA 5FKCA 4MGKE 3SOUA 1TZOA 3LVRE 3WQ1A 4LT5A 3I3DA 4AAXA 2ZEXA 1N1VA 2R1DA 2X5IC 4FFFA 5FLJA 2NP0A 1KITA 1VBC3 3FLPA 1W6NA 2EXIA 2XHKA 3PU3A 5FZOB 3QACA 2DX8A 4A4BA 1HB1A 1YQ8A 2VNRA 4NHXA 1KRIA 3M70A 4FFHA 2OPKA 3BODA 3P6BA 5DUUA 3SLIA 1GLHA 1QJX1 3WW1A 4E4ZA 1RUC2 3SOXA 5BUVA 2IXLA 3O12A 1OFNA 1K42A 3PMEA 1E5RA 1ULGA 3GNEA 1O91A 2B42B 2DVGA 3A21A 4GB0A 4UI9B 2ZABA 1ZRDA 3ZYHA 2ERFA 2P17A 4CEYC 2XUEA 3RYRA 2FFWA 1WA4A 3GBFA 2HYXA 3GV4A 4JGYA 3OSDA 3K48A 2Q30A 4LBQB 3PUQA 1DGRA 1JTZX 1OVSA 2GNTA 1G9DA 1HW5A 2W5FA 5TSWA 1O59A 5H9RA 3VV1A 4BMBA 1JN2P 3MLKA 1LEDA 1PNGA 4UFKA 3KSCA 3LPFA 5AITA 1W0PA 2EIDA 5FZAA 4CEWA 1NLRA 1CZTA 1POV1 4KGGA 3B93A 4KNCA 4YGCA 4P02B 1CN1A 5CNAA 2G45A 1WW4A 3CKHA 3GHNA 4PI0A 5HXVA 2JDNA 1H30A 5D8AC 5FWEA 1LECA 3ZXJA 3A0NA 2HWC1 1J59A 4N53B 2UYBA 4YZ4A 2XWBB 4C90A 5L19A 1VYXA 2ZEYA 5LEJA 1EPZA 3WUDA
chains in the Genus database with same CATH topology
2ETEA 2VUAA 4Y26A 2VY0A 4N43B 2NQYA 1U5XA 5FO9B 4CDUB 1HV0A 3UKTA 1FI2A 3WP6A 1AX1A 5KH3A 1XQNA 2XJUA 3VBFA 4JCKA 4FQZA 1U12A 3LWCA 3B7MA 3HQXA 2XPJA 3AZZA 4IV1A 5B8DA 1Q8QA 5IK4A 1JYCA 1SCSA 4R4XA 5A3MA 1D2SA 4EWAA 2EIGA 3H3UA 3LQHA 1NCRC 4Q0PA 1F5JA 3VZNA 1JW6A 2GN3A 2DU0A 3AM2A 4COVA 5JSPA 2RS51 3VZKA 2VU9A 5BNNC 2NAAA 3DN7A 1HXS3 1MACA 4AI0A 3LRQA 2HWB3 2MA5A 2BEOA 2HKXA 2RMU3 3B01A 2YMZA 4P5OB 4Q0VA 4Q27A 4DQAA 5CADA 4C1WA 3ZFEC 2KIZA 4EN9B 2XJSA 4JAAA 3L2HA 2VPEA 1QDOA 5B79A 1ND3C 4AP4A 3KCCA 1BCXA 3WXPA 5LEKA 1UU4A 3P3NA 2WFPA 3TN92 1CQ9A 5A32B 4YARA 3WCSA 4OI1A 3AP9A 4GMP1 2YGLA 4X6QB 2Z79A 5CIRA 1VBE3 3I7DA 2CGNA 1WW6A 2O0OA 4P9JA 2QUOA 2QDNA 4AWDA 4ZU4A 2I07B 1O7FA 3M2MA 1FXZA 1BZWA 3N36A 2JD4A 2RS12 5BNPC 1LEMA 1OQ1A 1QOOA 2CL2A 3PVEA 2ZZJA 2F6BA 1OFSA 3PVBB 4RS5C 4AGRA 2L80A 5I0RA 5DDJ3 3MICA 4WVMB 2WSUA 5T5JA 2NZ9A 1X4UA 2ES3A 4B86C 2O8OA 2CV6A 3ZN6A 5JCTA 4I09A 2E51A 5K0UB 3DV8A 4OHWA 4CDQB 1XNDA 2HJIA 3W59A 4R7EA 5H1UA 3EJKA 5EYYA 1SBDA 3UJOA 1EAH1 4IEZA 5F6KA 5CAZA 1QNYA 1WGPA 1TE1B 1V70A 4NVPA 1RUG3 1KFUL 5KHIA 5SV8A 2D6KA 4TWTA 2VPDA 2CWSA 4RQPA 1FATA 3AKSA 3WW4A 2JRJA 1HRI1 4YNIA 1H0BA 4LLFA 3R05A 3OY8A 5E88A 2D6NA 2WZPP 1BBT3 1O5LA 2MPFA 1D4M3 1DGWX 1WCDJ 4MXWA 4TLFA 1PGW1 2KA3A 1XU2A 3WZ1A 5C11A 4GKXA 2R49A 4XBQA 4QQPA 2ET7A 1GSLA 1RUOA 2TNFA 2YUEA 1ZRCA 4HT1T 4JGYC 2YT5A 1JM7B 3AP4A 1XRUA 1RL3A 4ISRA 1R1A1 1Y9QA 2XLGA 5DDJ2 3IBMA 4CEWC 2EA6A 4OHVA 4K8FA 2E6RA 4OVEA 5IK8A 4QGLA 4S2GA 4FQ4A 3WCRA 4Q4V3 2WFF3 4FPHA 5GLZA 5CFDA 5JMCA 1G86A 5CFCB 1QQP1 4WM7A 2HYKA 4QPGB 4M3CF 1B35B 2WA4A 2A7AA 1W6NB 4FPJA 3IDCB 4AQ2A 2XWJB 1QXJA 1RUG2 2Z69A 5J7MA 4W6XA 1DBNA 1WD4A 3LA2A 5LKZA 4UXAA 1DFQA 3THTA 1EPZA 4FOVA 2VVDA 4GNEA 1YHFA 5C6CA 1H1AA 4COYA 1C1LA 3I2DA 1MR5A 1QY4A 3PLQA 1LJ7A 4IV1C 2B7YA 4M3CB 1BJQA 2GN7A 4FCAA 5BNQA 1FV2A 1T6GC 2DCKA 4Z07A 3ZIWA 3M8LA 2JEMA 3EB6A 4UP0A 3O7OA 4KU7A 4K6BA 2GNBA 3VN4A 4YLZA 1DU3D 3AKQA 3NV3A 1LCLA 2VOKA 2A70A 4HKWA 3AMNA 1C5IA 1RHI3 4AGVA 1JOJA 4LO4B 2IXJA 1G6NA 3RI8A 5T5OA 3SH3A 1ZBE2 1W39A 2MEV3 3LSEA 4Q6FA 3MIBA 2A75A 1MQTB 4QQOA 2GMMA 2RR13 2B46X 3GL6A 4ITCA 3VBRA 4L58A 2W39A 3VHNA 3S7IA 4DY3A 4Y5Z0 2PHDA 3C3VA 1Y7BA 2K16A 4YADA 3N9PA 1NY72 2AR6A 5JI7A 1YYNA 3J4UH 3VBFB 2CT2A 3DF0A 4LBMA 4Y1VA 2PAMA 2YHNA 3LGRA 2WJSA 3AP5A 1DQ2A 4IV1B 4HANA 2M3HA 2DF7A 3TWIA 1PVC1 4MVTA 5LK7B 4Q4Y2 5B2GB 3TNPB 1OD5A 1BMV1 4XJZA 4DZGA 3E5QA 2GNDA 2JG9A 4M0NA 3N3HA 2Q8OA 5KC6A 5JVVA 2FUIA 1LHUA 1RHI2 3H7JA 3POWA 1FNYA 3WY6A 1AYN3 4WZFA 5FO7B 5ACA1 3ZPYA 4LK9A 2ZZQA 2CGOA 5HCFA 2MEV2 1EPWA 5BNOB 2LRIC 4XFCA 5D1IA 4QHBA 1GQGA 2WIIB 1J1LA 5T55A 2TEPA 2RR12 2VUJA 2VMHA 2VJEA 4MSVA 4Q0UA 2BFUL 4E27A 1WCSA 1OPMA 1RUJ1 4XJUA 1YLLA 1ZBA3 3H8UA 2FUUA 4RQPC 4IEWA 4QPIA 4PLMA 2M85A 3N9NA 3A4UA 5EYXA 3FHIB 3RQ0A 3ZFFB 2BNNA 5JI9A 4P9WA 4C0BA 1WEUA 2GC2A 1BXHA 1FPN1 1TME2 2KE1A 2Y0OA 2ZOEB 4AVTA 3JD71 5ABJB 4A2UA 4HFSA 4MLOA 4ISQA 4XFGA 4ZUXU 4HETA 4JC1A 3LCPA 1VFYA 2YREA 1YFWA 2P37A 3O0VA 1IPJA 4GH4A 4OHXA 4EROA 1VALA 1RMU1 2PLV1 3RPGC 4AE2A 2GC0A 2QE3A 2P3JA 1AYN2 4Q8LA 3VZMA 4OLLA 2ZX3A 4EN7B 3DPRA 3E5XA 5CFDC 3J8F1 1CAVA 3BCWA 2E53A 1D0GA 1OKQA 1X36A 3KNVA 2RM21 5FFOC 4WM7C 3B9CA 2CNAA 2WNVA 3URFA 2ZGRA 2UWAA 2GC1A 4E2GA 2BWCA 3HD8B 3RJRA 4O9GA 1ZBA2 2JG8C 2Q1MA 4UW6A 4FIPA 4PPEA 3USUA 1G9FA 3M62A 3IN9A 4FOWA 4MXWB 1MS0A 3JBG3 4E4SA 1YJLA 2PNXA 1IS6A 5DUVA 1WLDA 3MW4A 2XJTA 4IEUA 1DQ5A 1AR63 3P3PA 4ES8A 1FX5A 3N7JA 2NMNA 1SLLA 4MYEA 4Y24A 2A6WA 4OI4A 4XQ4A 3MHSA 5DZEA 1PO11 5A33B 2VOVA 4LBJA 2AYHA 3I4IA 4I30A 4I7BA 2D98A 3ZX7A 1T1HA 2R16A 2CWMA 1J58A 3H1MA 3GHMA 4YGBA 3RPQA 1LHVA 4W6YA 3NWKA 3ZO0B 3HCTA 2JX9A 1C57A 1PNFA 1Z7S3 4WM7B 2EODA 3O37A 3RS6A 4PJYA 3WW2A 1FV3A 1LB2A 1QJU2 3H3ZA 5DXDA 4JGZC 4PCRA 3FLTA 4INDA 4YAXA 4A7YA 1AVBA 1PVXA 2XBO3 3D5OA 2IDAA 3W9AA 4Z1VA 1ZZBA 1HRV3 2YPJA 3NV4A 1ZRRA 2TUNA 1W6OA 3SH4A 3VDDB 3HWJA 4WM8A 5I3LA 5H1TA 2MA6A 2RS31 3ZYRA 1AR73 1FNZA 5JPMB 5H9QA 4N53A 1RC6A 4R8HA 3HCSA 5IT6A 2R073 3AMPA 3IDBB 1H8VA 1HDKA 4N43A 2ECNA 1R091 5FREA 1VBD1 3DPLR 1BKZA 1HX6A 3OGGA 4K20A 2ECVA 2JG9C 2C2VS 3EBRA 1O4TA 1OA3A 1BEV3 1IOAA 3IKWA 4YVSB 3KGLA 1IPKA 3WDTA 1AHSA 4XF9A 1Q8VA 1MM3A 5FMOS 3VBUB 2HYED 4OHYA 2HWE1 2DCJA 4Q4W2 4D69A 1A3KA 3VGIA 2AUYA 4A0CD 1F62A 2LV9A 1WLWA 2NLRA 1MZFA 3N7KA 2EA7A 3VBRB 3ZNIA 1OA2A 4ATEA 2GDFA 2VW2A 1S0JA 4CYDA 5E8AA 1V00A 4RHV2 3RRDA 2YQMA 2F6JA 1ULFA 1FOD3 5DUXA 1AR92 3PVNA 2QCSB 1HRV2 4MGZE 5GM0A 1J3QA 1ZBDB 2ZJCA 2EGPA 1EV11 4ES9A 1DQ6A 4DRRA 4QPIC 1H4GA 2ARXA 4FPGA 2RE9A 1AXYA 4YYOA 4LHKA 4M0HA 3E6CC 1SEFA 3WG4A 1C8M1 1LGBA 2R072 4AFDA 5CVRA 2M6MA 2VH9A 3U5PA 2D3RA 1O4YA 4XW3A 4XF0A 5TBNA 4KBBA 2BNMA 1A6CA 3ZSKA 3ZYIB 3RYKA 1H2NA 1V6LA 5A32A 3MI8A 1FBVA 1APNA 3C6WA 4K1YA 1Z78A 5DZGA 5GALA 5FCCA 3LQIA 1WBLA 1VLNA 1C4RA 3AYAA 3FUOA 1UZYA 2FHRA 4Y4YA 1MEC3 1UAIA 1NQJA 1YUDA 1RUE1 3KCXA 1DZRA 5DUWA 3B3QE 2BVBA 2R061 3AYEA 2VJEB 1UMZA 1O4ZA 1NOVA 3OBTA 1AX2A 2WNVC 2QVSB 4Q4X3 2A6VA 2PQQA 1NG0A 4WVMA 1ENXA 3AK0A 3IMNA 3JCIA 2R041 1RUH3 3GALA 3G7DA 2GMEA 2HWD1 1OI6A 5K0UA 2Y1MA 4C1XA 5JDBA 2C5DA 2F4PA 5KXEA 4CCGX 3KB5A 3MFAA 3USSA 2OYZA 3MLLA 2P3IA 2LGKA 5J3XA 4B7EA 1H4HA 3ZXFA 1PO22 1KS4A 1J3PA 1RUC3 4GH4B 1LDKC 4CDXA 4P9IA 2VQ0A 5CU1A 2WZR1 5J37A 5EFUA 1POV0 5LRRA 5FEYA 1X8MA 3DPRB 2W68A 2GSYA 2EXJA 1R081 4FK5A 3TOJA 2EXHA 4O64A 3QOPA 1DIWA 1JM7A 4XFAA 4HKLA 4F52B 1TMF1 1QWRA 4IEOA 3M99A 4Q4X2 1MM2A 4S3OB 1WW7A 3WDWA 5FLIA 2GH8A 1UPIA 4A7ZA 4LBOA 1DDLA 1RUH2 4GB32 5FOBB 3GYDA 3GZTB 3JU9A 4F8AA 2WA3A 4WM8C 4NWWA 3R6SA 4AEDB 1PIV1 4L97A 5CFCA 4D7SA 3AX4A 3WP3A 1COV2 3B02A 2MUMA 1K2FA 3VZLA 3MIEA 1I9RA 4N53C 4NN0A 4QPGA 2YURA 4GNDA 1B35A 2BTVC 3HMYA 1S0BA 4IERA 2UWCA 3ZXAC 1QHDA 1GFF2 1GR3A 1ULCA 1EYBA 4FSJA 4N43C 1AR82 2WNUB 3APBA 4AI1A 4CDUC 1KJRA 2WQ4A 1V9U2 1UN1A 1FP0A 2A6XA 3NL1A 4M3CA 2DVAA 4LLBA 4LUMA 4HLTA 4QU2A 1VBC1 2GAUA 1OLQA 1IQAA 4AVVA 4FTSA 1D4VB 3SOWA 5FQ0B 2RSDA 3WG2A 1NXMA 2HEWF 4AEJA 2KGGA 1CIWA 3IIAA 1H9WA 5BV6A 1M06G 3MF6A 1W0OA 4BE3A 1W6OB 3I54A 3H7YA 1HIXA 4WM8B 3MLJA 4AI3A 2OVUA 3CO2A 2AZ5A 2VQAA 5CB7A 5HCAA 3IDEA 4GMP0 2FQPA 1Y3TA 5KHHA 1UKGA 1MQTA 3B9IA 5CG8A 3IPVB 1HLCA 2XH6A 4IESA 4ASMB 4HL0A 3IM0A 3TN93 4FVVA 3UK9A 5LK5A 2A3YA 1DYKA 2I50A 1QJX2 4EN8B 4AVAA 4AHYA 2LALA 1VRH1 5G0FA 4RD7A 5JG6A 3ZXEA 4LHNA 5KHGA 2LDRA 2Y1NA 3PMSA 5JOXA 4QQ2A 4AFAA 5IK5A 4JV4A 4R9AA 2RS13 1ZZ6A 3ELNA 3PHDA 5JOYA 3RTRB 1OSGA 2E6SA 2BWAA 4UBGA 4YW5A 4QF2A 2PHLA 5FTTC 3ZTGA 5EXOA 3JQXA 3FJSA 4RR3B 2PUYA 1H8TB 1WILA 1H9PA 4ZKTB 3ILNA 3WP5A 4WZCA 5BNOA 5K0UC 1WIMA 2CSZA 4CDQC 4NOTA 4XFBA 3RG0A 2HWC2 2Q1ZB 5IK7A 2JXAA 2Q5TA 1W6QA 1ZZCA 2XEUA 3N9QA 5GZFA 5I0TA 1XYPA 1ONAA 4MSXA 2B5HA 2XB6C 4OI2A 3V43A 3SNMA 3MGUA 1HXS1 4CDXC 1UX6A 2HWB1 4AEKA 2RMU1 5K8SA 4FJCA 1A8MA 4AQTA 2P2KA 2YHJA 4DOUA 3ZFFA 2EAAA 3B69A 1RB8G 2H6BA 3AP6A 3BPZA 5B76A 1GKBA 2IXCA 3AB0A 4B29A 2ECGA 2XJVA 3O5SA 5ABJA 3ILRA 1RUI3 3MF9A 3ZN4A 2VGDA 1AJOA 4BCUA 5FOJB 2ZMLA 2VPVA 3MFCA 2EALA 4Y20A 4DB5A 1J3RA 2RS52 1VBE1 3L2YA 2VULA 3NV2A 1N1YA 4C9ZA 5JZGB 1SBFA 3NSTA 4DMIA 1WMFA 4XHXA 4DFSA 3IWZA 1H2KA 5CFCC 3FWEA 3I8TA 5T5LA 2ENRA 4XJAA 2XUMA 3OPZA 4QPGC 1B35C 3VBHB 1WEPA 1RUNA 1Q56A 3AZWA 4HN0A 1X33A 4Z82A 5E16A 4CDXB 1KJLA 4R4ZA 4WV8A 5LKTA 3S7EA 1HRI3 4L92A 3AJYA 2A3XA 1REDA 1NZCA 2RJKA 4Q1RA 1Q8SA 2ZX4A 3NJZA 1QXPA 4NR1A 3VKOA 4A7KA 1WEQA 3WD5A 3LAGA 1EY2A 3FFZA 1RUG1 1PGL1 1RUI2 4IEVA 2K0GA 4MXVA 1WE9A 2AH2A 3KQIA 1WD3A 3O70A 4AQSA 1O3TA 1DQ0A 1GYKA 4NHKA 5A33A 5KC5A 2PHRA 5H9SA 3W58A 4L2NA 1ZBE3 4LEJA 5FDBA 3IHPA 1BBT1 4CP1A 4BBQA 1D4M1 2DYCA 2HEYF 2DFCA 1CR7A 4JTOA 1OQEA 3NKGA 4AFBA 3JQWA 1YCIA 4J1WA 2FSAA 4S2FA 1EAH2 1Q43A 2UYAA 1MQTC 1O3SA 4XI1A 4QGMA 1YFXA 2C2LA 1SACA 5FAXA 3ZVZB 5F1RA 1ZZ9A 5I0UA 3V56A 4B3NA 1F31A 4PBOA 4NHLA 3L1XA 1S0DA 4KWJA 2BPA2 4YC9A 3VBFC 2A73B 4BM8A 1HRI2 1Q8PA 5KH7A 3VDDA 4Q4V1 2WFF1 1CAXB 2YSMA 2W08A 4ORFA 1AJKA 1S0CA 2JMDA 1PGW2 1DGWA 3FX3A 1Q5OA 4Q4Y3 3S30A 1ENRA 4XQWA 1X7NA 5AVAA 5FB1A 4M01A 1NY71 1HQWA 2KREA 4Z92B 2VG9A 4RGGA 4HN1A 1R1A2 3WDUA 1Q8OA 3WW3A 3N9MA 4YVSA 2XLAA 1G25A 3SH5A 1W6PA 2Z42A 3AYCA 1J1TA 4CTEA 4YVWB 3VBUA 1BVP1 3UL2A 2LN0A 5GLWA 2NPIA 5BNOC 5JIAA 3R4DB 1QQP2 2PHFA 5J48A 2YC0A 1MS9A 4QF3A 5JSOA 2HDPA 4Y1UA 2OW4A 4AVSA 1NCQB 2ZKLA 1OOPA 2QDRA 4AK3A 3L11A 1RHI1 2K2SA 1ENSA 1LDJB 2PYTA 3FFQA 2MEV1 1SFYA 4Q8KA 3FL2A 1QH6A 4E4DX 1RJ7A 4I7DA 4YSFA 2V5YA 3MDPA 3AZVA 4XIKA 3T1LA 1PVC3 1DQ4A 3ZFFC 1TME3 3SCGA 1LKNA 1QKQA 3BOPA 1RGSA 3WDVA 1U0AA 3CJIB 4QXKA 2MT5A 1CJPA 1FAYA 1XE8A 1PK6A 3QCWA 4FAGA 4YG3A 2R6QA 5ABJC 3RI9A 5KXDA 3AMMA 4HMZA 2JICA 2DTWA 1MS3A 2E63A 3V0AB 1DZQA 1ZYBA 1RINA 1LGCA 4OI0A 2ZHNA 5GLUA 5L7OB 3OYWA 2WSVA 4FAHA 2LTNA 2ZCWA 4V3KC 2DU1A 2LGGA 2I74A 3KD4A 3OTFA 4LO6B 2YUCA 3MW2A 1W6QB