4FO9A

Crystal structure of the e3 sumo ligase pias2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
282
structure length
261
Chain Sequence
b'QGQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLATCPQEDNYPNSLCIKVNGKLFPLPGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKIRNPDHSRALIKEKLTTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEGSWCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase PIAS2
publication title Crystal structure of the E3 SUMO Ligase PIAS2
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 60
structure length 261
sequence length 282
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fo9A01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fo9A02
2LXHC 3SOXA 4X3GA 3HCTA 2K1JA 2YYRA 5B75A 5DKAA 2MUMA 4R7EA 3ZVYA 2F6NA 4GNGA 4R8PK 5FB0A 2ECNA 3C6WA 1X4UA 1WEPA 4YADA 2FSAA 2KU3A 4MVTA 2MA6A 4FO9A 4GB0A 4UI9B 1RMDA 3FL2A 4WZ2A 4ZQLA 3U5MA 4V3LC 2EA6A 2KE1A 2MD8C 3ZPVE 3PUQA 3HCUA 3PURA 3O36A 2YW8A 5H1VA 5TDWA 4AYCB 4A4CA 2YREA 3O70A 2HDPA 4LADB 4WZ0A 3KV5A 1HYIA 4WZ3B 1WE9A 2VJEA 2VJFB 3EB5A 3LQHA 4YAXA 4W4UA 1VD4A 5LKZA 5KH7A 5B77A 2YT5A 1HYJA 2G45A 2MIQA 5B79A 2DX8A 5TABA 2ZETC 2ECTA 4GNFA 5KH3A 2LGKA 1WIMA 2MT5A 2ECIA 2FUUA 3RPGC 2Y1MA 3ASLA 2E6SA 2MD7B 5G05B 2CSYA 2C2VS 2KIZA 2UZGA 5FERA 1WEWA 4BHWA 2VPDA 1WILA 3LQJA 4CA1A 2LGGA 4I7CA 3O34A 4XI1A 4YC9A 3I2DA 2KWKA 2QJ0A 1LDJB 1WEUA 5EYAF 1K2FA 1T1HA 3L11A 5TRBA 2AN6A 5G0FA 4Q6FA 4AYCA 3DPLR 4YABA 3MHSA 2YHOA 2YURA 2LN0A 4UP5A 2EODA 5TBNA 2ECVA 3O35A 2VJFA 3M62A 5D1KB 1JM7A 2MNZA 1WEQA 5DINA 1E4UA 2VP7A 4R2YA 3RTRB 4AP4A 2YUCA 4I7BA 3ZYQA 2LDRA 2PNXA 2JMJA 3IHPA 4P5OB 1V87A 2K4DA 1Z6UA 4O64A 1U6GB 4B86C 5B8DA 1WEOA 1ZBDB 1LDKC 2M3HA 3N9LA 2K16A 3U5OA 2CT2A 4MSXA 3N9NA 1FBVA 2L0BA 5C13A 3N9QA 1WEEA 2ECWA 2YHNA 4PPEA 2LXPC 1WESA 2RSDA 2L80A 2LV9A 3N9OA 3MHHA 1JM7B 3GV4A 4LK9A 4YATA 4AUQB 2LRIC 1VYXA 5H1TA 1VFYA 5B76A 4FK5A 4I7DA 5LKXA 2YQMA 4N4FA 3ZVZB 2MNYA 2XEUA 3L1ZB 4QF2A 2D8SA 2KWOA 2LQ6A 5KH9A 4ZUXU 1MM3A 2YU4A 2M1RA 3RPGB 3EB6A 2JRJA 2H0DB 2KGGA 4YBTA 5C11A 4B7YC 4NN2A 2LGVA 5AIUA 3LRQA 1Z60A 4FIPA 4GNEA 3L1XA 3M99A 3SOUA 3SHBA 4UP0A 4S3OB 3V43A 4WA6A 2JMIA 2L75A 1MM2A 5G04B 1FP0A 2VPBA 3ZTGA 4V3KC 2VPEA 2KYUA 4TKPB 1X4IA 2EGPA 2LGLA 3PHDA 2G6QA 2M85A 4YBSA 1WFKA 2KFTA 3QZVA 2KR4A 1BORA 4ZDTA 2KWJA 2KWNA 2F42A 4N3WA 5LCWB 5B78A 3ZNIA 3HCSA 2HYED 3KV6A 3O7AA 2KGIA 4LJNA 4A49A 3C5KA 3VK6A 3U5NA 1WGMA 4A0CD 5JG6A 1XWHA 2H0DA 2Y1NA 1X4JA 5AITA 5H9MA 2CKLB 5FEYA 2I50A 2Y43A 2RI7A 4LLBA 2VPGA 1Z2QA 4YBMA 1G25A 2QICA 5D1MB 5H1UA 2OXQC 1JOCA 3O33A 3KNVA 2YSMA 5J3XA 1F62A 4F52B 1N87A 3NG2A 3N9MA 1CHCA 4PTBA 5D1LB 2IDAA 3M63A 3T6RA 3DQVR 1IYMA 3KQIA 3GL6A 3O37A 1WENA 2L5UA 2NAAA 2YSJA 2ECGA 2FUIA 5I3LA 2ECJA 2KREA 4QF3A 3T7LA 2C2LA 4BBQA 1WEMA 2K17A 2XB1A 2PUYA 2MA5A 2JMDA 3ZPV1 2F6JA 2M6MA 4GNDA 4IC3A 4L58A 2CSZA 3SOWA 5LKUA 4LKAA 2YQLA 2BAYA 3LQIA 4IC2A 4L7XA 1DVPA 2QIZA 3U5PA 2L43A 2E6RA 5FB1A 4CCGX 2CKLA 5LKTA 3N9PA 4A4BA 2VJEB 4S3OC 1WEVA 4FJCA 2G43A 5TDRA 3HTKC 4AVXA 4C9ZA 2VNFA
chains in the Genus database with same CATH superfamily
3HN1A 3X29B 3U78A 4RGAA 1W8FA 1W2AX 1QJU1 2XUMA 4TSVA 3OTFA 5H9QA 5C33A 3VBUA 4BH9A 4TZDA 3HCTA 1BBT2 1GZCA 2YYRA 5B75A 5K4LA 1OA4A 4A44A 4RR3C 5KC6A 2AH2A 1DLLA 2Q5TA 2MUMA 2PHFA 4HVQA 3VDCA 2W95A 1XNAA 3GJAA 3HWJA 1TE1B 5SVYA 1DQ4A 1UYYA 2Y6KA 3O0VA 3C6WA 3RPQA 1I1EA 1N1YA 1S0JA 2KU3A 1YNAA 4L92A 4HLTA 1DF0A 3W9AA 3BI3A 4Y3OA 1F31A 2MA6A 4PDWA 4RQPB 2QQOA 4GH4B 4AEDA 4LORA 4M3CA 1WBLA 1W99A 3MFCA 4JGZC 4CXXA 4IEOA 4YVSC 1ACCA 2ZAAA 4RHV2 3JU9A 4NAOA 4CP0A 1H6YA 2WSVA 1AVBA 1BK0A 2XVGA 1DYPA 5FYVA 4HFSA 2YBKA 3PUSA 4AVVA 2X05A 3BB6A 1FYUA 2ZX0A 2UY8A 2RS13 4R4XA 2EA6A 4KQ7A 1HW5A 2R071 3VHPA 3HPNA 4OGCA 4FP2A 5F7UA 4XQ4A 2MD8C 3PUQA 3ACLA 3B01A 5DDJ3 4BE3A 3POJA 2XH6A 4Q4X2 1U5YA 5H1VA 4AYCB 5EHDA 2YBPA 3ZXGA 4LKEA 2YREA 3N35A 3KGZA 2DYCA 2RM22 1JODA 2PHLA 2VVEA 3LVRE 1YIPA 2VZTA 3DXUA 2DUOA 1W8WA 1Y9GA 5IVEA 4IV1C 2WNOA 2J42A 4V2WA 5FZKA 4FPKA 1SBFA 3OJBA 4TYSA 4IEQA 1RJ7A 5FZGA 1ND3C 3WP5A 2VJEA 1QY4A 1KITA 1MQTC 4CDXC 5FZ4A 3UKNA 5K8SA 4LMFA 4W4UA 2VL4A 4IEXA 1VD4A 5DABA 2QUOA 5FPLA 5KH7A 5LKZA 2OZJA 2JX9A 2P3JA 1POV3 1YFYA 2RMU2 3HAGA 1PGW2 3FLPA 3O5SA 5GZFA 3WDUA 4J6GA 3T30A 4PBOA 4QB2A 2WNUC 2EIDA 2WZEA 3EXUA 4NHLA 1A34A 1H8TC 4HN0A 5TABA 3ZVXA 3HBZA 1DQ5A 2ZMKA 5FMOL 5I0RA 5C8CB 2ECTA 2ZETC 2Y0OA 4HKWA 5IT6A 4YW3A 5L73A 1MS8A 1QNYA 4HK9A 1UF2C 2IZWA 2D6PA 2UU8A 4YZ2A 3WP3A 1AR92 1JYIA 3ZN4A 3FJUB 4LK7A 4D6SA 1LULA 1PK6C 1VRBA 5LA2A 1WWYA 1HXS3 2PLV3 3AYCA 1VBE3 2MD7B 3SUBA 5G05B 1VBC2 5LBFA 2GN7A 1RYYA 4Q4V1 2E31A 3RFRA 3VBRB 1WILA 3DGTA 3IZOA 2DCYA 1W6QB 2BTVC 3LEKA 1JOBA 4Y22A 3HEIA 3S57A 2LGGA 2VU9A 1CAWA 2ZGPA 3GCWA 1RUF2 3VDDC 3VDAA 3ZPOA 2R6QA 3AYEA 3E5UA 3WNPA 3IDCB 1G9FA 5KHGA 1AX1A 3C2UA 3I2DA 2C24A 1GQGA 3NVCA 4D6RA 3I4IA 4KU8A 3IB3A 4XZUG 2WJSA 1NA1A 4O9EA 1H4GA 2QJ0A 1UY4A 1OD5A 2RS32 1ULOA 2PMWB 2YG0A 2YUEA 3OPWA 4RS5C 4CDWC 4LQRA 4FPJA 2CHHA 4LITA 3UKTA 4CDQA 2E6VA 3VBOA 3BIEA 1RUNA 2JE7A 4XAAA 4IUGA 1CIWA 5TRBA 4CE8A 3WVJA 4AAPA 2FCUA 2P34A 4GJYA 2IXHA 1VRH2 2XKOA 5G0FA 1KGYA 1XQNA 5CNAA 2AUYA 5F3GA 3DPLR 4AVTA 5D8AC 3ASIA 1NQDA 2JD9A 2O1QA 1PMIA 3BPSA 4KH9A 3ZFGC 4MV2A 2I2SA 4P5YA 1MEC2 3OEBA 2YURA 2QQKA 4XIKA 5CFCA 1VBB2 1RUI2 3LIHA 4FTEA 5IUQA 5T3NA 4N43C 2EODA 2Q1MA 1NLQA 3T08A 1YQ2A 4S2GA 2XJTA 2HWD3 4NMIA 1CJPA 1RMU3 1IG0A 1EY2A 1JZ5A 2RJ2A 1J3RA 2HYXA 1ASJ3 2GZWA 2JENA 2R043 1W8ZA 2RS11 4G4FA 2VMFA 4QX8A 5A1FA 2XDVA 5FYTA 1N3PA 2OUJA 2BU9A 4TTGA 3JUUA 3RG0A 3EBRA 1HRI2 5KXEA 1WEQA 2G4IA 5LK5A 5DDJ1 2MNZA 1YIFA 3U11A 3SH3A 1BZWA 1GOFA 2VCBA 3A0NA 3HR9A 4AE2A 4LHLA 3CLPA 5EJZB 4DRVA 3FFZA 4RR3B 2D3SA 3OPZA 5A7PA 2L7PA 3WDTA 1ZBE2 4AP4A 3GJBA 4AYUA 5FZAA 2NMNA 1IS6A 5A6YA 3I59B 4I7BA 1DQ2A 4EWEA 3ZYQA 1IQDC 5BNNA 4FPOB 2B46X 3LSDA 1OPOA 5FY4A 1WW4A 4XAEA 5L7OC 1UPIA 1DU3D 3B02A 4KGQA 3QLQA 1YJLA 3ST7A 2JMJA 3LVQE 2A1XA 4PQQA 1V87A 1NA1B 4WM8A 4IE6A 3VBFC 1QMJA 3AP9A 5FLIA 1POV1 4JKLA 2BPA2 3I3QA 2DCKA 1IGOA 1GNHA 1XNKA 2ADDA 2Q4SA 3MPPG 5B8DA 1AJKA 5FO9B 2Q8EA 1EV12 2D6NA 4H2AA 5LA1A 3FL7A 2H0BA 2KKXA 1LDKC 1GFF2 3T0BA 2NLRA 3FX3A 4Z0OA 1GQHA 3ZXEA 3URFA 2IC1A 1N1SA 4I0BA 2BW8A 1GKBA 1REFA 4RYDA 1QOTA 3U5OA 1AUYA 3KM5A 3N9NA 3WP4A 2Y6GA 4KWKA 2L0BA 4Q4W2 2MEV3 3N9QA 5C13A 2B8MA 4MADA 2ZPXA 1O3TA 1BJQA 4GKYA 5JMOA 3R4SA 2PLV1 1HXS1 2GC1A 4HBNA 1VBE1 2EIGA 2W87A 2XMLA 5FAXA 5FP8A 4AVBA 4Q26A 5J98B 2WKKA 5T50A 5JSOA 4PPEA 3RWNA 4I3GA 3ZIWA 1C8M2 1LR5A 3P3PA 4QDRA 2UWAA 5T5OA 5FPXA 1KJRA 4JVAA 5I8SA 3W5MA 2OWAA 2JG8B 4IV1B 4GZ9A 4QHOA 1XYOA 1T2XA 4CRQA 3TEZA 5HV4A 3V0AA 2B9UA 1ND3B 4ZY9A 2A75A 1CVNA 2WS92 3EJKA 4DOUA 2XJPA 4B8EA 1PVC3 4COZA 2EIEA 4EWDA 4AVAA 4P9GA 2RS53 2RR12 1IOAA 1CAXB 2A6ZA 3PU3A 3T1MA 2Y34A 2A3WA 2JB8A 1G9BA 3NW4A 1E5SA 4QGNA 4C0HA 5K9YA 1PIV2 5LWBA 3P1IA 4LBLA 3BN6A 1CONA 4OUSA 1LOFA 3WX5A 5JOZA 2D8SA 4NPMA 3U07A 2E33A 2ZGLA 3WT3A 2Q8OA 3UK9A 1S4CA 3ACHA 4M01A 5ACA2 2DSMA 1OUXA 1Q5OA 1GOHA 3POWA 4LOTA 5JVVA 1C1LA 5KH9A 2CGOA 3WF4A 5IFPA 1XU1A 2M1RA 1PK6B 1WMFA 4PT6A 3BOPA 5AFEA 2Y64A 1W6MB 3M7KA 1VMFA 2OPWA 1D0HA 1WKYA 4HVRA 4YGEA 3EB6A 1R082 2KXLA 3POYA 2HWD1 5LBCA 1SEFA 1AXKA 4I0WB 4FPYA 2A6YA 3ZR6A 2HKXA 2ZJCA 2W08A 1YI7A 1ENXA 5J09A 1UZVA 2H6CA 1KEXA 2K2SA 3AZWA 3SKJE 1NKGA 3VDDB 5CU1A 1J3PA 2NM1A 3I49A 1MPXA 4AOCA 5C4WC 4NIDA 3MDBC 1ST8A 5FYBA 4MO3M 3M99A 2HWB2 3MIEA 4LEJA 4QT6A 2A6VA 5AC93 3O7OA 2HWE3 4Z82A 4QQ2A 3ITQA 3R6SA 4CDWB 3SHBA 5FYMA 3PUIA 3PIGA 4CCCA 3H7YA 4CTEA 3S30A 4L2NA 4UP0A 2QQJA 5EZWA 2CSVA 3O1MA 3D5OA 3WCSA 4YPJA 2C9AA 3ZN6A 5FK7A 3O0XA 4MXVA 2GH2A 3P6BA 3RDIA 2L75A 4YSFA 2HBUA 1FATA 1NCQC 4MH0E 3AZZA 2W39A 2BGOA 5L9VA 2WAOA 5F1RA 5T5LA 1IG3A 3ZFGB 1OURA 5K3QA 1QIQA 2ZACA 1Y7BA 1OI6A 1RVF3 2VW1A 4O61A 3B3QE 3FLRA 3V65A 2VMIA 2VJXA 5FPAA 2BQPA 4KG0A 4N43B 2YYOA 4QX7A 3DN7A 4AR2A 2G6QA 1Z7S2 2ZHMA 1OXCA 4IEZA 1W8HA 2ZGOA 1C5IA 3AXEA 2KR4A 3NJZA 3S5AA 1F2NA 4AQ2A 5J96B 1BORA 2AREA 1FMD2 3KF5A 3WSOA 4A4AA 1K5JA 4XXAA 4OUEA 4WVVA 3EYPA 4ZU5A 4A6SA 4UF0A 1TEIA 1QDOA 1YJKA 2CAVA 2W5FA 2W92A 4PI2A 5FZFA 5FPUA 4JHTA 1LGNA 4QPIA 3VBSA 2W1WA 1RUJ3 1W0OA 4DUWA 1CWPA 3OBZA 1Y43B 4A3XA 2R32A 3QH6A 1W6PB 2IXKA 5FPZA 5BV6A 4JHZA 1GZWA 3WG3A 5FOJB 1V6NA 1X82A 4L8QA 4GD4A 3KS7A 4MSVA 5GZGA 3C7OA 1LAJA 3DCQA 4CP1A 3BTXA 1ZA7A 2D5FA 2MPFA 2EAKA 2ARAA 4V1PA 5L7OB 1OLRA 1OOPB 2YB7A 3RI8A 3VK6A 3U5NA 1PGW1 4A0CD 1R1ZA 3NQHA 5JG6A 3J7HA 1QJU2 1DZRA 3VBFB 4BK4A 5JOXA 3MHZA 3WW3A 5IVBA 5CG8A 2Y1NA 2Q1FA 3U14A 3ZSJA 3U4SA 1OKQA 5J37A 2X5IB 1UN1A 1RUD2 1GR3A 3RJ2X 3V0BB 3KT4A 3AM2A 4UFMA 2JDMA 3LA7A 4EN8B 2AGSA 3PIJA 5G04L 1QKQA 2IQJA 3POSA 4LLBA 2CYFA 4YBMA 3FZ3A 1Q3EA 4IEWA 4JGYC 1XBFA 4D0QA 1VBC1 2XWJB 1DGRA 2ZZQA 3G6JB 3L9JT 2X10A 4QAWA 3J26N 4BQ5A 1FOD3 2QDNA 3C5KA 1WLDA 2FMYA 1ENRA 4OGEA 4XFIA 4A7KA 4LOSA 4QX5A 4XW3A 2VY0A 3NL1A 1GBGA 4N90A 2QZ3A 3GHNA 5J3XA 1RUF1 3LEIA 4N7UA 1LHOA 2FDGA 2UYBA 2P3YA 4H7MA 2X09A 4F52B 2F17A 2RDSA 1N87A 4XQWA 3NG2A 2BVBA 2R072 3KWVA 4HPKB 2WL1A 2JDNA 2JG9A 3J8F3 3NNFA 4R4ZA 4XBLA 3RQ0A 3WD5A 4Q2FA 5CAZA 5FO7B 1IKPA 1SLIA 3AC0A 3DPRA 4CCLA 4MGSA 2WQZC 4COYA 3M3IA 2V72A 2YZ4A 2JDHA 3GDBA 1W3XA 3RGBA 3ZYHA 1DG6A 5AC91 5JUVA 2HWE1 1ULPA 2BFUS 2ET1A 3VZMA 4NRQA 2VOTA 3GL6A 3O37A 2AEYA 2G1MA 1VRH1 2YSJA 2R16A 1RC6A 2ZS6B 4QM8A 4XJ8A 5ERLA 5LA0A 1VMJA 2IVJA 2ZA9A 3LE0A 5FZMA 5HXMA 3FUQA 1YWKA 5C3PA 2CGPA 2AYHA 1QQP3 2ZX3A 4L99A 4QF3A 3UYJA 3DYMA 4Q29A 5KBFA 2CRWA 4BBQA 3AJZA 3H3UA 3THDA 1RUI1 2WRAA 2IFWA 2WT2A 4CP9A 2A6XA 2PUYA 3I8TA 1O5LA 4NHMA 2E26A 1BEV3 1RVF1 1SLBA 2DCTA 2KD7A 4NE9A 4BHPA 4LBQD 5F2SA 2JMDA 3DKWA 5DUUA 3JCIA 4UXAA 3UNPA 1NT0A 1YO8A 4NWWA 4NO4A 5FPVA 4GNDA 5FLHA 4CUCA 3B9CA 2B0OE 1D0GA 1XC6A 5C71A 2J1RA 4XUNA 1UXXX 3ZFEC 4P02B 3GCXA 5SV8A 3WNMA 4L7XA 4P9JA 4TWTA 3RYRA 2OS2A 5JDBA 2QIZA 5FTTC 3WDYA 1OVPA 2GMMA 1DGWA 5FXZA 5FZ8A 5C4WB 5A7WA 3SXWA 2ORXA 3H9AA 1W8NA 4P9WA 1CR7A 1ZBE1 4UFHA 1Q8QA 3RS6A 5SVXA 5LKTA 5L9RA 1J84A 1SCSA 1Y9MA 2YC0A 2UWCA 1RUJ1 2HWC2 1NCRA 2QE3A 4XYXA 4CEWA 2D3PA 1OF3A 3PL0A 2JJ6A 3M1HA 4QPGA 5CYYA 5HPOA 2SLIA 5JZGC 4FJCA 2TUNA 3B94A 2G43A 1UD1A 3IMNA 3ZYFA 2LW8A 5FZ1A 5TDRA 5CG9A 1Q8SA 1G9CA 5FP9A 2L9LA 2DU0A 4R9DA 5KHJA 4C9ZA 4IEVA 4MXWB 3UJQA 1S0IA 1EV11 2VVDA 4ASKA 5FKCA 4KBZA 3ZO0B 2Q8DA 2LXHC 3LOIA 4X3GA 2RDRA 5ISLA 2PAKA 5JMCA 2WINB 1BHGA 1N3QA 2VQTA 3OGGA 5AVAA 4R9AA 1LU2A 5F8PA 3RVHA 3W58A 4GNGA 4R7EA 2VOWA 4XJWA 5DAVA 5C5TA 1XE7A 4NPLA 5KHIA 2ECNA 2A3XA 1WW7A 5KWRA 3I7DA 1Q8VA 2WUHA 3J9SA 4NRPA 3LCPA 1K42A 3LDRA 1UOBA 3J7LA 4XURA 3AKQA 3GZUC 1LESA 1FOD1 3K51A 4S2DA 1AR63 2D97A 4XABA 4FO9A 1WLCA 3AP7A 3WDVA 3U75A 3WW1A 4ZONA 5C9AA 4WZ2A 1PM4A 4WZFA 1B35A 1LTEA 2RS12 3MIBA 4ZQLA 2JB4A 3T09A 3PLWA 3J8F1 5BNQA 2QNKA 2ZEZA 3IDAA 3ZSEA 1F8VA 1JS9A 2ZEWA 5DDJ2 5FZ6A 1YXWA 3O47A 2ADEA 3AYDA 2ETEA 2YV8A 1S0CA 4QMAA 3T4VA 4DMIA 1RGSA 4R9BA 5FRAA 2C6SA 4CUBA 5LA9A 2VNRA 2WNVA 4QB6A 1HQLA 3A23A 2WN2A 4DXRA 5F39A 2C0ZA 4LLFA 4P5HA 5TDWA 3DKQA 4MGKE 4LNVA 1M4WA 4XTMA 1SDWA 3ILFA 4MX3A 3FANA 1LODA 5A3TA 1UX6A 3O70A 2W46A 5FZ0A 3ZKUA 2D93A 4LADB 4O7XA 1IYMA 1OC1A 3AB0A 4UT5A 3KV5A 4COVA 2VCMA 5DXDA 4YGCA 5EXOA 1SPPB 4RA0A 3A0KA 4W6XA 4XUTA 3MLKA 3EB5A 1DP0A 3LQHA 1IS3A 1W9YA 2WBKA 3K4AA 4YAXA 5LBBA 3GNEA 1MS3A 1K5MA 4GXLA 1W2OA 5IAXA 3OY8A 1UZZA 4EJRA 2VOVA 2YT5A 5FY0A 3VUOA 4Y1ZA 2EICA 3HNYM 1JYNA 2BGPA 2WWUA 3BCWA 5T52A 3AFKA 4FPFA 2VMEA 2F6JA 4A6OA 4FOYA 2C26A 2ES3A 5B79A 4ATEA 3NV3A 4FOVA 3S7IA 5J3UA 2MHFA 1UYPA 4LK6A 1VLNA 4X8PA 2PLV2 1HXS2 3E1F1 3GBFA 1VBE2 5IJRA 5KH3A 4N9HA 1MZEA 2BJSA 3WLUA 4F7ZA 4CDUC 2GC3A 2WO7A 4LT5A 1BCXA 2ECIA 3TRSB 4K9SA 2FUUA 4MZUA 3WW4A 4WM7B 2Y1MA 4IL7A 3FN9A 4AI9A 3OBAA 2C2VS 4HMZA 1W28A 2KIZA 2EF6A 2W94A 2D3RA 3MI8A 5FERA 3NNJA 2BRTA 3RZZA 4JRLA 1POQA 4BHWA 4RQPA 3H1WA 5A3OA 4GH4A 1EPWA 5F5CA 5E1RA 1YCIA 1GNZA 4BDVB 2VH9A 3O34A 5FMOS 1E57A 1DBNA 3ZYIB 2IVIB 4YC9A 5E88A 5EV7A 1Z7S1 1V6OA 1O8PA 1DQ1A 2C4XA 5GLWA 1MZFA 3GBGA 2V5YA 1C1FA 2SBAA 1HQWA 1KD7A 3LGRA 4Q27A 5FZOB 1Q8OA 3ZFEB 5IVCA 5FDBA 4YFZA 3A21A 1IKQA 4YG3A 4DZGA 1A8DA 3MF6A 2WZ8A 1K2FA 1REDA 4UOJA 2WFPA 3OGRA 1OLMA 5JSRA 3LDYA 1Q43A 3KF3A 1F5JA 2AN6A 1BVP1 3IKWA 4Y5SA 2DVAA 3DECA 3N7JA 3OBTA 4AYCA 4BOWA 1NUKA 1TME3 2GC2A 1R1A3 3R05A 3LEGA 3OG2A 4NIGA 5K0UC 2UWBA 4EN7B 3MHSA 1ULCA 2FD8A 2YHOA 3NAPC 1RMU2 3KB5A 4AQ6A 2LN0A 2ZHKA 4UP5A 4B4PA 1ASJ2 2R042 3LD8A 1QWRA 5JZGB 1W9FA 1ZM1A 2YBSA 3AVSA 3INAA 4CA9A 4ES9A 1JZ8A 3O35A 4A3ZA 4JDOA 2N7GA 2GALA 1XB9A 2J1UA 2PXJA 2XVLA 3K3OA 1UOFA 4L11A 4XF0A 4GQ7A 5F32A 1CN1A 2V4AA 5HCFA 1QDCA 4QX0A 5F5AA 3M62A 2F4PA 2FHRA 1JM7A 5FLJA 1YFWA 4WVMB 5JI9A 3TWIA 1RUD1 2XWBB 5DINA 3NO8A 4UWDA 1RUC3 1ULEA 3HT1A 1E4UA 1DFQA 3LB9A 3IIAA 4R2YA 4MGQA 5G05L 5GJ6A 2A6WA 4UYBA 5C8CA 3K46A 1JZ3A 2ARXA 1ENQA 4HETA 4PIZA 1VBD3 2VNOA 3UL2A 2O8QA 1OQDA 2WYSA 1LEMA 1AYN3 3OGJA 3T0AA 5T5PA 3N36A 4E2SA 1CAVB 1JUHA 1J1TA 2WN3A 1EUUA 3BYWA 3DUIA 2PNXA 1WCUA 1SLCA 1XRUA 1ZZCA 3MW3A 3H8UA 5FKBA 2B5HA 4Y1VA 2LROA 4XFHA 4MHRA 1G9DA 1CZSA 3IHPA 4QQOA 4LO4B 2GNBA 4G3YC 1XYPA 4BQ2A 1Z6UA 3CMGA 4UW4A 4P00B 3I2KA 2RVAA 3KCYA 3VBRA 1W6QA 1UU5A 5EFUA 2VG9A 5FXXA 1ZBDB 1IS5A 1GMMA 1KS4A 3OD0A 1S0FA 2R063 3CHXA 2DUPA 3EO6A 3OUIA 1JN2P 2MEV2 1FNZA 5FYUA 5T54A 4N9IA 3B69A 2BWAA 3SQOA 2BERA 5KC5A 2CT2A 5LEJA 1SFPA 1YHFA 4AQTA 4CDQC 2A7AA 2KA3A 3JB4C 4P9LA 1C4RA 4N7IA 1TNFA 1TG7A 1WMXA 4ISQA 4MG2A 2YU2A 1WEEA 2QTWB 3WG1A 1VB4A 2ECWA 4UAPA 2GSYA 3USUB 2OT7A 5FUNA 5IW0A 2YHNA 4GB33 3AZVA 2LXPC 4QU2A 3G7DA 3U0ZA 2EGMA 3K2OA 4YW7A 3RI9A 4I30A 2ZGTA 2L80A 4AGRA 4AGVA 1MBMA 5DZEA 1PVC2 1DDLA 3N9OA 4YGBA 1JM7B 5F37A 2RS52 5DZGA 3GBWA 3O1VA 1JH5A 1HJGA 2J1VA 2ZTNA 4X8NA 4QB1A 4XJUA 3ZXLA 4YATA 1W8TA 1CAUB 2B45X 4E4DX 1OFSA 4HKOA 5FQ0B 4ONUA 3T0DA 3SH4A 4AUQB 4EV0A 5JR2A 1UIJA 3WY6A 1VFYA 1VYXA 3Q8AA 2VBPA 1GUIA 1GNYA 2WA3A 3N7KA 4RGKA 2DBIA 4I7DA 5LKXA 3C7HA 4LK9A 2YQMA 2RJKA 4N4FA 5J48A 5FY1A 4DUXA 2LAUA 3TNPB 3ZVZB 2QFEA 5B4XA 2VQUA 4XF4A 4AI3A 4H14A 3POBA 3VKNA 4CCDA 3VDBA 1LEDA 4XUQA 3JQXA 2LQ6A 1VAMA 4HONA 3AK0A 1UU6A 2HWC1 3ZSMA 4ZUXU 4RR3A 4CDUB 1G86A 1QXJA 3AL5A 4ZHNA 2YU4A 3RWKX 4XETA 1KRIA 3I59A 3KVAA 3OYWA 5CZKA 1PGSA 3S6PA 1SBDA 2ZGKA 1X9TA 3PDQA 2ZCWA 3H42B 1OLME 3GHMA 4N53B 1LOCA 3KZ4C 4AG4A 2KGGA 1AL0G 3WOGA 1EAH3 2PHWA 4ZPIA 4QPWA 4PF1A 5GALA 3KHBA 4XZPA 4YM2A 4NN2A 5A7NA 5DUWA 2VXRA 4JGZA 3KT1A 1G6NA 3HVDA 4J1XA 3VZJA 3DYOA 4CXWA 5IK7A 3LRQA 1DQ0A 5AC92 1HB1A 2P4EA 2WO3A 2HWE2 3ELNA 4CEYC 4Q8KA 4ORFA 4C8DA 4FIPA 3IBMA 1EYBA 3R4UA 2XL9A 3I3EA 4JTNA 4BISA 2E7AA 1GQPA 1YC61 1OD3A 5JAXA 1C3HA 4M4PA 3SMHA 1LOBA 2E32A 2XQXA 1VBD1 4HXCA 2XONA 3CQOA 3VZNA 1AYN1 4YVWC 2XG3A 2YPDA 2I45A 5FP3A 3V43A 2QZ2A 3H50A 1W6NB 2VPVA 1RVF2 2KR2A 2ZKNA 4RSUA 4B1MA 4GWNA 1OA2A 2RR4A 3A22A 1NE4A 1PZ8A 1VAKA 3O12A 4LKDA 4KWUA 2Y6LA 5DUVA 3VGIA 2VZOA 5K0UB 4TXWA 1PGL1 3GALA 1DIWA 2IXIA 2IWGB 3NAPB 4QKFA 4TKPB 1X50A 2JG8A 3AXDA 4IV1A 5FZHA 1UQXA 3FBYA 4YARA 4C1WA 1S0EA 3D0SA 3POFA 3ZXFA 4IQPA 1ND3A 2R061 2LGLA 1PO23 4YM0A 1MQTA 2EA7A 4UFIA 4CDXA 4BIFA 1WMEA 2F4LA 3WNNA 4OYUA 1JYCA 4FI9A 4PF5A 1O3QA 1LU1A 4CZSA 1WFKA 2E51A 4FPHA 1XSQA 4Y1YA 1CAXA 2NN8A 5FYYA 2TBVA 3ALQA 5BXXA 2D98A 4NIHA 3D6EA 3OYWB 4ZDTA 1S0BA 4COWA 1CX4A 2KWJA 1SMVA 1RUJ2 2WNUA 3IT8A 3C8XA 3CKHA 4GB31 4N3WA 4LIUA 1WA6X 5EJ3A 2Y6FA 3MLJA 3HNBM 2AC1A 3CZUA 4P14A 2P6CA 3LQCA 3KV6A 4XCBA 4JGZB 2PA7A 4DXZA 1WD4A 4YVSB 3RMYA 1JYWA 1W2NA 2I07B 2KGIA 2AR6A 1PK6A 2OX0A 1HB2A 5FYHA 5DMYA 2XJVA 3E5XA 4A49A 4BQ4A 1W6MA 4L0PA 4WVZA 1WGMA 3MUY1 4M00A 4DNYA 1N1TA 3R4DB 4FAHA 2B9VA 2VMCA 3FE5A 4M0HA 3DQVR 5JWPA 4YG0A 3PU8A 1YEWA 4HK8A 4E8CA 5AITA 2IUWA 1WW6A 3VDDA 4X6QB 1COV3 1RXFA 4Z92B 1OH3A 4ITCA 4EQVA 4YW2A 2QQPA 2CKLB 3C7FA 4FOWA 2I50A 2E7QA 2B4KA 2XHNA 2ZGNA 1STMA 3B7MA 3ACFA 3BALA 1V6JA 3ILNA 2BZDA 1FOD2 4AL9A 5FIXA 4CDWA 1JHJA 2VMHA 5CKNA 1R64A 4PIYA 5H1UA 4FP3A 4BQWA 4BB3A 4Z07A 2Z4FA 3M70A 1MQTB 4CDXB 3SCHA 2BVVA 5LY1A 1S2BA 1IHMA 1Q8PA 1WLTA 4NHYA 5CBLA 1ZRFA 1MS9A 1JBCA 3I2HA 2RG4A 3J8F2 1EAH1 2YSMA 3AMMA 1LENA 5FXVA 1VALA 1RUH3 5BNOC 2VQ0A 3ZFGA 4ZS3A 3WUDA 1F62A 1W2TA 4ATFA 4E9KA 4NHKA 5I0TA 1CZVA 2JM3A 2WNUB 2ZXQA 1N3OA 1CHCA 2WLQA 4YM3A 1RIRA 4N43A 1H8TB 1WCDJ 2OXBA 5FP4A 1HRV3 3WQ7A 3M63A 1LGCA 5FXWA 1UNBA 2P3IA 1QHDA 4M3CF 4QX3A 1US3A 3T6RA 5C3OA 1H4HA 1QQP2 1SFNA 2EXKA 4CU9A 4XF9A 2ENRA 1WENA 3VHRA 2L5UA 4NOTA 4Y5Z0 4BQYA 2FUIA 2QCSB 2YC4A 1J1LA 2B7YA 5I3LA 3WNXA 3VBSC 3E97A 4BM8A 4AEJA 4YZ5A 1BEV2 4Z8BA 2HEYF 1LNSA 1QJFA 1RMU1 2EIBA 4HZFA 5ANQA 5LRRA 5JXIA 4CCOA 5JLVA 4WVWA 1ASJ1 2R041 1DCQA 3I97A 5A7QA 1W6PA 2D43A 5CADA 1UZYA 1E5RA 1XXNA 2JKBA 1ZREA 1QJX3 4Q0SA 3WINE 5L7OA 2Y0IA 1OOPA 5T55A 4ASLA 4H9DA 2GP5A 1I3HA 4XMIA 5EYXA 4PLMA 2CSZA 3ETQA 1PO13 2ILMA 2W0XA 3VBFA 4Z0RA 2WFF3 4EN9B 2DVDA 2ZZJA 4RS5B 2A71A 4OULA 1V6KA 3ZYRA 1DVPA 2ZKLA 4BXFA 4XBQA 3APBA 3H3LA 3PJQA 4CEYB 1UWWA 1K3IA 3MIGA 4UBGA 1V6MA 1BXHA 1L7RA 2VD7A 2X5IA 1O5UA 5FREA 3T2TA 4OI0A 1D4VB 3VKOA 3V0BA 3N9PA 1UXZA 2LM3A 4Q8LA 1OKOA 1GV9A 3HNMA 5D8AB 5FCCA 3TEXA 2G9ZA 3VB9A 3I2GA 2LTNA 4S3OC 4C0BA 4YVWB 3SC7X 1IQAA 2A3YA 1CIYA 4E4ZA 3K3NA 5FZ7A 4Z1VA 3E6BA 3ZFFC 1J59A 3GZAA 2DDUA 4K8RB 5FWEA 5F3IA 3W21A 3HTKC 1CPMA 1O3RA 4DPNA 5CFDC 4B4RA 2R1DA 2VZUA 2XL7A 4LO8A 2ARBA 4PBPA 4AEKA 5KXCA 1O4YA 3HOBA 1RITA 3LZZA 2VNFA 2JG9C 1YQ8A 4PQ9A 4D94A 5HV0A 3THTA 3POIA 2MEV1 5TSWA 1RB8G 4Y20B 4EZ4A 2J1EA 2ZGRA 2PYTA 2VMGA 2ZHNA 2PN5A 3IDBB 1D4M3 1FT9A 1AXZA 4HPKA 2XB6C 3ECQA 3K77A 2HBTA 4XFAA 4XDQA 4AHWA 2K1JA 3J4UH 2GMEA 1XNBA 4ZS2A 1UPSA 3JD73 2R30A 3FHIB 3QH7A 4WV8A 4Q0UA 5JOWA 2BP6A 4JTOA 1RUG3 5DKAA 4FPEA 2F6NA 3D3AA 3W5NA 1DYKA 5H9RA 4AF9A 1AR62 1Y9QA 2R7EB 5FB0A 1X4UA 1WEPA 4DFSA 2WNEA 4YADA 3CDZB 1NZIA 4DEVA 3PVBB 1B09A 3CU7A 4INDA 2VTXJ 5B4NA 4YWAA 4I02A 1HIXA 2D6OX 1PVC1 2DTWA 3AMNA 3MPBA 1RMDA 4GB0A 1W03A 3O1SA 4UI9B 1UKRA 2RS51 1JI6A 2VR4A 3M3QA 1RUH1 1NOVA 3BVCA 1ZNPA 3FUOA 1VBA3 5ABJC 1HX6A 5EYYA 5HCAA 3KV4A 3I2OA 1W2UA 2D7FA 3U5MA 1HRV1 2W91A 1HV0A 4XJ9A 4V3LC 3DYPA 2KE1A 1F15A 3Q8FA 3MEPA 4OMCA 2XJQA 4M4RA 1W9TA 4QX2A 4OI4A 3TN93 4B1LA 1AZDA 4U2AA 2JDZA 1ND2C 1OT5A 3PURA 4NROA 3GGLA 5T5JA 4CCEA 1UOGA 4R52A 1X36A 1OA3A 3AZXA 3ZR5A 3CIHA 2XBO3 5C4WA 1UY3A 3MUZ1 4HL0A 1QU0A 2CAUA 3RZJA 4F8AA 2J7MA 4AHYA 1WUVA 2VOXA 3PVOA 4K6BA 4W6YA 4CEWC 1F5FA 4I2OA 2CDPA 4IERA 3T9KA 1U5IA 1H30A 3WF3A 2XLFA 2VOKA 2NP0A 2JXAA 5FP7A 3O1UA 3ATGA 4WZ3B 4CP2A 2FDKA 4FAGA 2D6MA 3NNMA 4W50A 5FZIA 3T3YA 3D82A 1UU4A 3WEZA 5C3RA 2VJFB 4YW4A 1SBEA 4LO5B 3L2YA 3WG4A 4LHNA 1W3VA 1NCQA 1JHNA 5J36A 1PO11 1AL23 1GU3A 5BNOB 3TBDA 5JXJA 4MXWA 5FYZA 4FQ4A 4NPRA 4GMP3 4UW5A 5LCWL 4XFGA 1H2LA 3RZGA 1UCXA 2MIQA 1HYJA 4AAXA 5JSPA 2WZR3 1R093 2VUAA 4GKXA 3ZSKA 1OPMA 2DX8A 3E2DA 3ZXJA 1QNWA 3PUHA 2XP0A 4AI8A 1RJ8A 4GNFA 2H0VA 2LGKA 1W6OB 3VKMA 3EB7A 4LJHA 5FK8A 3VV1A 2QQVA 1S2EA 4O62A 1GZTA 1ZA4A 3OOXA 3RPGC 3OUJA 3BODA 5A33B 1UIKA 4BPZA 3P5BA 2CSYA 3IMMA 1POV0 3KV9A 2D8UA 5LZ6A 5A32A 2LS6A 1HN0A 2VPDA 3UGHA 2J22A 1W8UA 1HN1A 3KLSA 4FSJA 1IPJA 1B35C 1Z78A 4QX1A 4NRMA 1DGRN 3LFMA 4CA1A 1LOEA 2Y60A 1M06G 3MV01 5A3WA 2J1TA 2V09A 4O9GA 1Q56A 4AFBA 3QD6A 1JW6A 5LEKA 2DJAA 2Z42A 2BOIA 5J7MA 1YQ6A 4LUKA 3BTYA 4P9XA 2TEPA 1UL9A 4ES8A 4HSLA 3WQBA 2WIIB 3JD71 1LDJB 2VMDA 1WEUA 2DTYA 3RZKA 2DF7A 2JE8A 4CVUA 1RUG1 5EWSA 1AR73 1H9WA 2VBDA 2NYYA 1ZRCA 1TME2 1R1A2 4JAAA 1JZ6A 2DBNA 4ZXEA 3TEYA 3WNLA 2YROA 2ZOEB 3C3VA 4HANA 5KR7A 4LA3A 4YYOA 3N7MA 1W8OA 1NCQB 2AZ5A 5BPXA 3VLBB 4YABA 2PFWA 4KWLA 3MIDA 3LDKA 3LA2A 1NY72 2OA2A 2IXJA 3T2QA 3KD4A 4I3PA 3FLTA 1ULGA 2PQQA 1AXYA 1V6IA 4CSWA 1SPPA 5TBNA 2ECVA 2E7TA 3SCFA 2VTFA 1UO9A 4LBMA 1UMIA 2BV4A 3KGLA 4TLFA 1RUC2 5KXBA 4RL7A 3KCCA 4D3WA 5I0DA 5D1KB 1FX5A 1ALYA 2BOJA 1TMF3 4NUBA 2VNGA 3N7LA 5FZDA 1VBD2 3SNMA 4KL1A 3JBG3 1AYN2 4FXGB 4EE2A 2HWF3 1AYM3 5A1LA 1QJZA 5A32B 4JV4A 1KDKA 2R1BA 1HJFA 2X8KA 3QACA 5F2WA 2D6LX 4LUMA 3WUCA 2LDRA 4IXLA 2ZEYA 1MS1A 1L7QA 3LWCA 4BWOA 1PGL2 4WM7A 1NXMA 1APNA 2BYVE 2WO1A 4XMAA 4IV3C 3U4XA 3FEHA 3ON7A 4PI0A 3JUEA 2DVFA 4GWIA 4FVVA 3NNGA 1SFYA 2ZX2A 2R062 1AX2A 5F3CA 4META 4OFGA 5C3QA 3SKVA 1ZX5A 1ODMA 1ULDA 3VBHC 1WEOA 3LDBA 2BNMA 3UETA 4GMP1 5ABJB 1GYKA 3D8CA 1ZZ7A 2D6KA 1VAVA 5FUIA 4BMBA 4BJ0A 3ZPYA 3WDWA 2JWPA 5HXVA 2WZR1 3OUHA 1R091 4Q4Y3 4PIXA 3AKPA 3FAOA 5K7PA 1G9AA 1PNGA 3LA3A 4MSXA 1K12A 4GB32 4IEYA 1DQ6A 1QQP1 3ZX7A 2ZAHA 1VIWB 5FZOA 3ZFEA 5BNPC 5DAQA 1GWKA 1GP6A 1I6XA 2QKDA 5JCTA 3FMGA 1ND2B 1MS5A 3CJIC 2WQ4A 2BDRA 3M4FA 2YDEA 2GNTA 4JGYB 4MUVA 4OHZA 1BEV1 2PHXA 2QQMA 4OHYA 4LBNA 3UESA 3VKLA 5IK5A 2RSDA 1LCLA 5C5UA 4FCAA 2OXQC 4D7TA 4E4SA 2FD4A 3SITA 2LV9A 1KXGA 2LALA 4AWDA 3RZHA 1QH7A 2EXHA 5CEHA 1SDDB 2W52A 5JXGA 4K1ZA 4Y4RA 1OLQA 3OBRA 1A78A 3FHQA 2IXLA 5JOYA 3VBUC 5M0TA 3GV4A 3OGVA 2W47A 1PZ7A 1AJOA 2FMDA 4MGYE 3BTZA 1ZRIA 5JZGA 3AZYA 4HN1A 3PTYA 3T2PA 1RXGA 3ZKYA 4EZHA 1V00A 3PMSA 5H1TA 2R0HA 4IEUA 5B76A 1VR3A 3KSCA 4UFJA 5GM0A 1VMHA 2E63A 1HB4A 2WWJA 4NAMA 4KU7A 4XCAA 3W59A 2MNYA 4WVMA 2GMPA 3GZEA 4PDWC 3ME2A 4RFT0 3OD4A 4AEDC 4EN6B 2PELA 3THCA 3FJSA 3AVRA 5A1AA 1XNTA 3IAPA 1IZ3A 2KWOA 3LJUX 4QHBA 4WBBA 1I5ZA 2XOCA 4GA9A 1ZBA3 2Q0AA 3K48A 3OCPA 4URAA 1MM3A 1NX9A 4Q0VA 1D2SA 2GC0A 3OF1A 2G9GA 2NPIA 4Y1UA 4FT8A 3RPGB 1EAH2 1W0PA 2CL2A 3LFIA 3ZDSA 5B77A 1OMIA 1CAVA 1LOAA 2VUDA 2XJSA 3HJRA 2WLPA 3VL8A 1HDKA 1FNYA 2B42B 2FZ2A 4PHZA 1QH6A 2J1SA 2VZSA 1WCQA 2FDHA 4AFDA 2H0DB 4A41A 5C11A 2ZGUA 4B7YC 3WF0A 3ZOIA 4E4HA 3HN3A 2LGVA 4NWVA 2QBXA 3KVBA 3NNLA 4IGQA 4OI1A 4LBQB 2VUJA 1RHI3 3B5LB 4QU1A 4UFKA 5D2AA 5AIUA 1X9PA 1ENSA 1TMF1 3MIHA 4W8JA 4YZ4A 3VD5A 1YFXA 1Z60A 2YPJA 4GNEA 3L1XA 2HWF1 4MGZE 2K9ZA 2OYZA 4BK5A 1C57A 1MS4A 3TYJA 3ABZA 3I2JA 1AR61 1KQRA 5FY7A 1SQ4A 4B7EA 1URXA 3THPA 4XOGA 3RRDA 1DYOA 1FAYA 4I09A 5DG1A 1FI2A 2Y6JA 3U10A 3USUA 3LOBA 1IPSA 3BPZA 4OHWA 4GIQA 4IEPA 4I0AA 4SBVA 5FYCA 1DHKB 3MGUA 3O0WA 1XU2A 3E6DA 5C7GA 2ZHLA 3AKTA 1H2MA 2VPBA 3R0RA 4FBFA 2GNDA 3ZTGA 4V3KC 1PO22 1SLAA 3IPVB 5KXDA 1U5ZA 4P9YA 4XFCA 2DFBA 1X4IA 2KYUA 2ARCA 4OVEA 1TVGA 3WF1A 4HOOA 1BLZA 2C5DA 3HIFA 2EGPA 3TOJA 4Q4V3 4ZKTB 3KHCA 3PHDA 4A7ZA 1CAUA 5FQ0A 1YLLA 4YGDA 1KFXL 3HMYA 4Q5OA 4BMEA 3TNQA 3ZXAC 2CDOA 2PAEA 3QZVA 1WA4A 3VD7A 4RD7A 4IE7A 2RE9A 3W20A 3NV4A 3PVEA 4YM1A 5IK4A 1UY2A 2F42A 4D7SA 2W9XA 3IM0A 2XVKA 2R49A 2A73B 5IVFA 4AXOA 1ODNA 2ET7A 4RGGA 5L19A 2VZPA 4XC9A 4IETA 4JCKA 3ZNIA 2JDYA 2VC9A 2PHUA 3HCSA 3P3NA 4GWJA 4CDUA 4Y24A 1WW5A 1VB2A 2G9FA 3O7AA 3IN9A 2JDKA 3LPFA 1BMV1 3EQEA 4CCMA 4YZ1A 2FCTA 3LPGA 3MV11 4XTPA 5FZ3A 4IV3B 4XPVA 2VZ3A 4LTAA 1NA1C 4OI2A 1LHVA 1OSGA 1VE0A 3PMEA 4N53A 3IIIA 5FMDA 1LHUA 5LBEA 4B4QA 5F9TA 1COV2 3AMHA 4XQDA 4FPCA 5F3EA 3VBOC 2HJIA 1D7PM 3VBHB 4LHSA 1V6LA 2RV9A 5FMBA 5FUPA 4NHXA 3B00A 4H55A 5A6XA 5JXHA 2JICA 4SLIA 4COUA 3SLIA 4CYDA 4JZRA 5FEYA 2GH8A 2Z5WA 2ID4A 1LKNA 4OQ9A 2XHKA 1ZBA1 4E8DA 1SACA 4KNCA 3S7EA 5CKQA 5CFCC 5BNPB 5J1XA 4AFAA 3HBKA 1G25A 3Q1DA 2QICA 1DLCA 5D1MB 3CJIB 1QJY3 3ZYBA 1BVVA 2O0OA 4ASMB 4XFFA 4OZXA 1GWMA 1RUH2 1UY1A 2VM9A 3GZTB 4NR1A 4WZCA 2P3KA 3WQ0A 5C6CA 1W6NA 1A6CA 1FPN3 3OGSA 4QXBA 2YHJA 3AMQA 4JQRA 2JG8C 5FZLA 3ZYPA 1GICA 1NYWA 2OQ6A 3KNVA 3O1RA 5A6ZA 1HRV2 3KT7A 1JTZX 5K0UA 4ZU7A 2D40A 3NAPA 5HCBA 1RHI1 3H3ZA 3N9MA 4CPBA 3VBUB 1WEVA 3JQWA 3RZLA 4K40A 5D1LB 1GANA 5GLVA 3IDEA 3ZIXA 4CXYA 2YFUA 2Z2SB 2IDAA 4OLLA 1V9U3 2YGMA 2ZX4A 3BGAA 4YW1A 4AFMA 4A45A 1X8EA 2K0GA 1TME1 3AMPA 1R1A1 5DAPA 3OEAA 5KHKA 2PHDA 2JKXA 4X6RB 5BNNC 4AQSA 5JPMB 4AHXA 3KQIA 1XE8A 2AENA 2VW2A 2LUWA 4CUGA 2NAAA 1CZTA 4LKSA 4PDWB 4P9IA 4AEDB 2XLGA 2KREA 4M3CB 4WM8C 5I0UA 2VECA 1H1MA 3RZMA 4IE0A 2C2LA 4J1WA 4BQXA 1NY71 1SLLA 1H2NA 1QJX2 1VPHA 2YU1A 1UYZA 1PMHX 1NLSA 2E61A 3H7HA 2UURA 1JYVA 4JQTA 3MICA 1LOGA 1UOJA 2JIJA 1JXNA 5I0SA 1PO12 4YVSA 2MA5A 3ZPV1 1AR83 2WFF2 3IWZA 2QQIA 4BQ3A 2KKYA 5EP9A 1JUIA 3ZXDA 2C1FA 1O6UA 1RUC1 2EXIA 2PHRA 1ULFA 2QVSB 4GJZA 4GMP0 4IC3A 4NVPA 1ZZ8A 2BEOA 3LIGA 3H8RA 1UMHA 2YFZA 3QBQA 1RL3A 4AVCA 2XUEA 5IVYA 3VL9A 2BAYA 2YQLA 4QM9A 4IC2A 4Q1PA 1AHSA 1V0AA 2BGCA 3U5PA 4XHXA 3M3OA 5GLTA 2JUNA 4I01A 5DQ0A 4HVOA 2VO5A 2E6RA 2DVGA 1RUE3 1MVEA 4CCGX 2CKLA 4LULA 1ZVFA 2Q8CA 3T1LA 5CISA 2XLAA 4W65A 5I93A 2VBBA 4D6QA 4AEMA 4A4BA 4E2QA 3POGA 4Y33A 5FY9A 2VJEB 2ZGQA 2A70A 2BNNA 2MKEA 4QKBA 5ANNA 5SVIA 2Z79A 4FFFA 1O7FA 4DRRA 4AVXA 1I5PA 2E53A 2FDJA 3F95A 4XBNA 1J58A 4XJAA 5GKAC 5GZCA 1D4M2 4DB5A 4Y1XA 3ORJA 3ZYGA 2VNVA 3NWKA 3JD72 1LOFC 4MLOA 1YQ5A 1RUG2 3HT2A 5A7SA 2OZ6A 1ZZBA 1CGPA 3SOXA 1KS5A 4DQAA 5DG2A 4PJYA 2WR9A 1H8TA 2WWSA 1BQPA 1UZ0A 4XILA 4BCUA 1J3QA 1I9RA 4M3CE 4XIOA 3Q8CA 3ZVYA 2O14A 2XJUA 5HBAA 3PUAA 4HT1T 3NJXA 4R8PK 1BBT3 1YUDA 1ZYBA 3KQ4B 4LO6B 4QPYA 4Y26A 2FSAA 5DN2A 1S0GA 2VE1A 1QJY1 4MVTA 1NXD1 3CEWA 1PNFA 1YI9A 4JKKA 5A3NA 4ZZ5A 1QGLA 1FPN1 1VBA2 4UBHA 3WZ1A 1CD3G 2VZRA 4QQHA 4Y22B 2HH9A 2DCZA 5FOBB 2CRRA 1W9SA 2GNMA 1CAWB 3ILRA 4K8FA 5D21A 2OKXA 3FL2A 1FV3A 4XACA 2DFCA 4H3WA 1NE6A 2QQWA 2P2KA 3BUCA 2WC2A 1L3JA 1O59A 1OOPC 2WT0A 3AP6A 3OSDA 4LPLA 5GLZA 5LY2A 1OF4A 2Y8KA 3LAGA 2Y38A 4KGGA 3I3DA 4RHV3 4YRDA 3TN92 3SISA 3CZJA 3POEA 1C28A 1V9U1 4R9CA 2F6BA 1GZ9A 1LB2A 2XBO2 3WHUA 4CDQB 4IGOA 4K7JA 3VBOB 3ZPVE 3HCUA 2VXJA 4KI5M 2EALA 2X5IC 2XOMA 4RS5A 5AFBA 2PHTA 3O36A 1H1AA 3AJYA 4CUAA 4DUVA 2YW8A 2ATFA 3BU7A 4CEYA 5SVIB 4A4CA 2VCCA 1MS0A 4IDZA 2YGLA 3H1MA 4LE4A 4PLNA 1W90A 2RDQA 2HDPA 1KDMA 4QD2A 2GDFA 4QHZA 4Z2WA 3F2ZA 4Q4X3 4FFGA 1N1VA 4QWNA 5CFCB 3RNSA 4WZ0A 2CWSA 5D8AA 1HYIA 3DL3A 3VD3A 1WE9A 3DDTA 2RM23 4ET7A 1JYXA 3DEMA 4Q0PA 5A80A 3H8OA 4QKNA 1RUOA 2DCJA 1AL22 2WSUA 4YVWA 1AR81 4LHKA 2HEVF 3GF6A 4HSJA 1BYHA 3VZLA 4CCJA 5F6KA 2IFRA 2ZBJA 3WXPA 4LO7A 2WZR2 2RHPA 1R092 3ZLIA 5FPBA 2E9QA 1NQJA 1HQNA 3WNOA 5I91A 3TB0A 1G8WA 5C70A 1O91A 2G45A 1DGLA 2RMU3 1O4ZA 4TN7A 4Y20A 3O1TA 1QXPA 3I54A 3MBWA 3NKTA 5IAVA 3AKRA 5B2GB 1RUE1 4QPIC 4BQ1A 3EHKA 2YXSA 5IHRA 1J83A 3J7NA 2FQPA 4O65A 1WIMA 5DPNA 2MT5A 1H2KA 4K1YA 3VD9A 5BY5A 5SV5A 5BNNB 3KDEC 4BIOA 4LR4A 4UI9L 3C7EA 1WCKA 5FBZA 3UKVA 4V2VA 4B7KA 2E6SA 1F35A 1SLTA 1S1AA 3ASLA 2UYAA 1FXZA 1AR93 1S2KA 4JDNA 2UZGA 5EQUA 4XF3A 4WM8B 1QOOA 2CGNA 5A70A 1WEWA 1PO21 4J25A 1JYTA 5JIUA 3RYPA 1YRZA 3WQ1A 3LQJA 2W2IA 4AVSA 2ZGSA 1LECA 1VBC3 3PTRB 3PVNA 4HKLA 3VHNA 4I7CA 4DEQA 2XXZA 1P8JA 4XI1A 4NIAA 1F9KA 1CJDA 4LA2A 1OUSA 2Q30A 2CY6A 1AR72 5DAWA 4F3JA 5BYNA 2KWKA 3ACIA 4IGPA 2EXJA 3WHTA 4G9SB 2JE9A 5APAA 5HCHA 4RN5A 1RUF3 3HQXA 2P1BA 2OUHA 4XVHA 2XGXA 5EIYB 4QXHA 4E2GA 5EJ1B 4EROA 5EYAF 5FZCA 5LATA 4CCNA 2A5ZA 4NJ4A 1BBT1 4YW6A 1T1HA 3SHRA 1QXRA 4QDSA 3NSTA 4LBJA 5FY8A 5FZ9A 3L11A 1UW8A 3M2MA 1QJEA 3VZKA 1DCSA 1OHFA 2DVBA 2JDPA 2RS33 5L9BA 2CU5A 2VW0A 1TQ5A 5CIRA 1XOYA 4K3UA 4Q6FA 3ES1A 3WDXA 1O3SA 1WZXA 1PZ9A 1RINA 4QQ4A 3ZN5A 1DZTA 3V0AB 5F6LB 1VRH3 1UYXA 3UGGA 3AL6A 4URTA 4YG6A 3JXSA 4XDOA 1C8NA 1BKZA 2JEMA 1XNDA 3M3CA 2VJFA 3DPRC 1H8VA 2X29A 4DXTA 1MEC3 1COV1 1GP4A 1OH4A 3CBNA 4RHV1 1VBB3 1TMF2 1RUI3 2J1AA 2I74A 2VQAA 1GP5A 3RMXA 4E27A 2LRPA 3JBG2 1Z0HA 2HLEA 2HYKA 2HWF2 1AYM2 2VGDA 3K75B 2WYFA 4QQLA 3PHMA 4Z2AA 1JZ7A 5IK8A 5BNOA 4FTBA 4GWMA 4GALA 5FMCA 3ZXKA 1WCSA 3FWEA 4MYEA 2P5BA 4QXCA 2VP7A 1YQCA 4QQPA 1HKDA 1HRI3 4DXSA 3V56A 3RTRB 1LHNA 5H9PA 2YUCA 5GLUA 1AX0A 1W6OA 2EVXA 5FBJA 5A3PA 5IYYA 4Q4X1 4DS0A 2CONA 2RM21 1ZBE3 1UKGA 5A33A 3ETPA 5L36A 4NN0A 5FZBA 4P5OB 2VZQA 5FJKA 1OFNA 4EWAA 5E6HA 5CA6A 2K4DA 2Y33A 1WGPA 5GZDA 2YMZA 4LBKA 4L97A 3WR0A 4Q4Y2 2VTXA 2WT1A 4O64A 1U6GB 4B86C 1PX3A 5AVPA 4H7LA 4ARYA 2RMU1 2ZEXA 2ZMNA 1JU4A 4DY3A 4BLJA 2M3HA 1UZWA 2QQUA 3N9LA 2K16A 3SEPA 2QQNA 3N4MA 2FZ1A 2PAMA 1EV13 3KCXA 1NCRC 4N8MA 3UGFA 3PJYA 2BWCA 1FBVA 4JDMA 2JIGA 2XR4A 3NMBA 5E8AA 4ISRA 4F1PA 4OHVA 4XUOA 1US2A 3K4ZA 4QPGC 4ZXKA 4BA6A 4A2UA 4OZOA 3ZN6B 2WABA 2FBEA 3OB8A 3D4KA 1W39A 1TZOA 4F83A 1AR91 3QCWA 4Q4W3 1W04A 3T2OA 4BZ4A 1WESA 1VP6A 2G19A 3H1YA 4XFBA 1QJX1 5GZEA 1BMV2 3I3MA 1YFUA 1LRHA 3A7QA 3HQUA 1IS4A 4PLOA 1PVXA 1SHWB 4XHBA 3SH5A 3U1XA 3H0OA 4MGIE 1HV1A 3MHHA 5LASA 2OPKA 3AYAA 2WFF1 3TAYA 3HQRA 3ENRA 1C8M3 2ZGMA 3VHOA 3VN4A 4AGGA 1UY0A 3PNAA 5FWJA 1O8SA 3GXUA 4EN0A 4KMQA 4AI0A 3E6CC 3O14A 3M7AA 2FDIA 3ZFFA 1G7YA 4DIQA 2XPJA 3SEEA 2LRIC 1EPZA 1BK1A 1OQEA 1PX4A 5IVVA 4FK5A 3CL1A 2DU1A 2WS93 3B9IA 1TNRA 4MOAA 3BTAA 4FFIA 4GULA 5CFDA 1ZZ9A 2DV9A 1ZZ6A 4LIVA 3RJRA 5JPNB 1JZ4A 1ZBA2 2XEUA 4IE5A 2GU9A 5F5QA 1O4TA 2RR13 3L1ZB 4JX0A 3CJXA 3Q9OA 4UF0B 4QF2A 4ARXA 3L2HA 2XOYA 2RS31 4IESA 3ZMNA 2Q1ZB 3NV1A 1GOGA 1XSRA 4QPIB 3VBSB 4PCRA 3LSEA 4UFLA 3UV9A 1PIV3 4JC1A 2ZMLA 3I2FA 5C9AC 1NAEA 1GZWB 1QEXA 4WM7C 3ZSLA 3DWDA 2YVRA 4XJZA 4S2HA 4AI2A 4A7YA 4IE4A 5ACA3 5I8YA 1MZ5A 1XPWA 2H6BA 1SZBA 1H9PA 1HB3A 1RHI2 3AKSA 4L9BA 4DY5A 3FFQA 1MEC1 3CF6E 3WCRA 1U0AA 5A3UA 3MZHA 1D4M1 1VBB1 5A3LA 1JOJA 2JRJA 4YBTA 5A7OA 1RTVA 3AP5A 1R083 3M8LA 2QJVA 1A3KA 3ES4A 1FV2A 2EAAA 2WNVC 2Y26A 1WMDA 4LKFA 5FV3A 4FTSA 1XJAA 1ZRRA 3LKJA 5E89A 5ABJA 2ORZA 2P6HA 4YLZA 1E5HA 2NMOA 2UY9A 5F5IA 4AFCA 3NJVA 4BU2A 1QF3A 4KBBA 1Y3TA 2VZ1A 5LW9A 2OQ7A 3K4DA 1HRI1 1OQ1A 4MHUA 3ZYJB 4B3NA 4EYUA 4U36A 3SOUA 5C8WA 1GLHA 1IPKA 3LF7A 3AP4A 1S55A 2JECA 4FFHA 1MVQA 1H6XA 2AACA 2WA4A 3UJOA 2CWMA 2BBVA 1KJLA 2TNFA 4S3OB 2HWB3 1X33A 1ND2A 1U5XA 4FQZA 1W0NA 4JGYA 1VBA1 4XEZA 2JMIA 4WA6A 1K5MC 4D8MA 1MM2A 3ZFFB 5G04B 3A4UA 2V73A 2W1QA 1JMUB 4YNIA 1FP0A 1KFUL 4Q4V2 1YYNA 5CFDB 2VPEA 1QOSA 1GWLA 1GSLA 1XNCA 3CNAA 1UX7A 2JG9B 1JZ2A 2XOZA 3FBMA 2GN3A 3TN91 2X53S 4S2FA 4Q1RA 3DPRB 2WQ8A 5JR7B 3S5QA 4CU6A 2C9KA 3OPTA 1UAIA 3C7GA 5IATA 2M85A 4M0NA 2XBO1 4YBSA 2FFWA 3TEWA 2KFTA 1A8MA 4XF1A 4IW3A 1C5HA 3PLQA 2P37A 2W68A 3AX4A 4FPLA 4A42A 5JI7A 3FHAA 3MW2A 1VJ2A 1H1IA 2VCAA 1Z7S3 3FM8C 4QGLA 3H7JA 1EUTA 4K20A 2WO2A 2JD4A 2KWNA 1MZ6A 3V64A 1MACA 3E5QA 1CX1A 5DAXA 3NRUA 2R0FA 4RQPC 4KWJA 4Q4W1 4GH4C 5LCWB 4FXKB 5B78A 2P57A 4OQ8A 4QKDA 1FMD3 2VAUA 3J7MA 5DUXA 1OBNA 4CP9B 3M3EA 4QXKA 5FYSA 5I8TA 2HYED 4JRAA 1SCRA 2CNAA 1MR5A 2P17A 5LK7B 5FO8B 1T6GC 5LB6A 1AL21 4LJNA 1PMJX 2JDUA 3USSA 5IWFA 1C8M1 2OVUA 1DGWX 3WG2A 5JIAA 4BYYA 4LLOA 3BU0A 2CV6A 3EMRA 1XYNA 1JOPA 2GP3A 3QOPA 4OHXA 4XXPA 1XWHA 1L7LA 3I2IA 4YW5A 2H0DA 1U12A 5HI0A 2WS91 2B39A 3UT0A 1X4JA 1K45A 2QQLA 1UMZA 2MNGA 2DWRA 2XKPA 4HG6B 4TLGA 4LBQA 1QJU3 1X8MA 5A7WB 1AF9A 2VUCA 1V70A 5H9MA 4FOQA 2RR11 4Q0QA 5D1IA 4D7YA 4R8HA 2RDNA 1DZQA 2ZX1A 4ZU4A 1Y4WA 1NG0A 4YZ3A 4C91A 4CU7A 2Y43A 3Q8EA 1QJY2 2RI7A 5CB7A 1NCRB 1PIV1 2FDFA 4XE9A 3JZVA 1F4AA 4CEWB 4LXLA 1FPN2 1Z2QA 1RUD3 2CSGA 2ZABA 4QPGB 2VPGA 5FY5A 2W3JA 2KM2A 1S0DA 2BFUL 5ACA1 4C1XA 2OW4A 3MLLA 4MGTA 4CCKA 3FC0A 3WP6A 4YFWA 5DZFA 1JOCA 1CPNA 1NLRA 1ZRDA 1H0BA 3O33A 3KMHA 5H9SA 1EP0A 2NQYA 3T4HB 4AZZA 3NKGA 4ZZ8A 3BIWE 3IPVA 1R081 1V9U2 2OIIA 4QGMA 1AR71 1NZCA 4W4ZA 4KG8A 2BUKA 3ACGA 1REEA 5LRSA 4PTBA 2XQRA 3N3HA 3D0JA 3DXTA 5E16A 5C8CC 4LE3A 4BXSV 1WLWA 5FZEA 3NJYA 2VVFA 3HD8B 2PQSA 5EPAA 2R073 1N47A 4P08A 2DUQA 3DF0A 1LHWA 2ERFA 4Y4YA 4XDPA 2WAAA 3O1PA 1LGBA 3KQRA 4XUPA 2ECGA 2HWB1 2V5DA 3SCGA 2ECJA 2BNOA 1W9WA 2PTMA 3VZOA 1W05A 3T7LA 1D2QA 2IXCA 2K46A 2O8OA 2QDRA 2YY1A 3VBRC 4OUMA 1AR82 1WEMA 2W1SA 2YC2A 3WW2A 4BLIA 1CQ9A 5C9AB 2K17A 2XB1A 3RSJA 3B93A 2VULA 3MYXA 3O1OA 1WD3A 1B35B 3CO2A 3WV6A 1OVSA 1CESA 4D69A 5A3MA 1E5IA 2FCVA 3GYDA 4DINB 3ROUA 4N53C 5FFOC 5IFTA 2HEWF 2DURA 1F4HA 1XE0A 3MF9A 2RJLA 5FJHA 4C90A 4CU8A 3MW4A 1W06A 4IV3A 4NIIA 3RYKA 4JKMA 5C3SA 3S0MA 2M6MA 3JBG1 5CKMA 4DO0A 5A6QA 4L58A 3SOWA 1AYM1 4OCTA 3Q8BA 3U37A 5LKUA 3ZMOA 1PM7A 2D5HA 4LKAA 1PHMA 1RUE2 3VD4A 3LQIA 2WNVB 5IVJA 1HLCA 2BBAA 3BOWA 3VBHA 3DV8A 4QDQA 3GM8A 3ZM8A 2L43A 3IAQA 5BUVA 4AW7A 5FB1A 3JB8A 2CTVA 2NZ9A 3I3BA 2WZPP 2Z69A 1ONAA 4FPGA 1FMD1 1JU3A 5FYIA 3NV2A 1LJ7A 1SG3A 2M13A 1T6BX 3MO4A 3MDPA 1X7NA 3LEMA 2D44A 3AFGA 3MFAA 4GAZA 5CVRA 4OMDA 4AI1A 5BNPA 3WNKA 2VZVA 2Y6HA 4Y5TA 2AEZA 3MIFA 3VKFC 4B29A 4LBOA 4CPBD 2V4VA 3BKZA 2W1UA 2WDBA 2JDAA 3CJIA 3WF2A 2HWC3 1K5MB 5FR3A 1WBFA 2EXUA 3OY8B 4UW6A 2XJRA 3ZDVA 3H8XA 2GAUA 4Q4Y1 4RFRB 2HWD2 5KHHA 4W6WA 4AK3A 4UW3A 4AHZA 4K21A
chains in the Genus database with same CATH topology
3HN1A 3X29B 4RGAA 1QJU1 2XUMA 4TSVA 3OTFA 5H9QA 5C33A 3VBUA 4BH9A 4TZDA 3HCTA 1BBT2 1GZCA 2YYRA 5B75A 1OA4A 4RR3C 5KC6A 2AH2A 1DLLA 2Q5TA 2MUMA 2PHFA 4HVQA 3HWJA 1TE1B 1DQ4A 3C6WA 3O0VA 3RPQA 1I1EA 1N1YA 1S0JA 2KU3A 1YNAA 4L92A 4HLTA 1DF0A 3W9AA 1F31A 2MA6A 4PDWA 4RQPB 4AEDA 4GH4B 4M3CA 1WBLA 3MFCA 4JGZC 4IEOA 4YVSC 2ZAAA 4RHV2 3JU9A 4CP0A 2WSVA 1AVBA 2XVGA 1DYPA 4HFSA 4AVVA 3BB6A 1FYUA 2ZX0A 2UY8A 2RS13 4R4XA 2EA6A 4KQ7A 1HW5A 2R071 3VHPA 4FP2A 4XQ4A 2MD8C 3PUQA 3ACLA 3B01A 5DDJ3 4BE3A 4Q4X2 2XH6A 1U5YA 5H1VA 4AYCB 3ZXGA 2YREA 3N35A 3KGZA 2DYCA 2RM22 2VVEA 2PHLA 1YIPA 2DUOA 4IV1C 4FPKA 1SBFA 3OJBA 4TYSA 4IEQA 1RJ7A 1ND3C 3WP5A 2VJEA 1QY4A 1KITA 1MQTC 4CDXC 3UKNA 5K8SA 4W4UA 1VD4A 4IEXA 2QUOA 5LKZA 5KH7A 2OZJA 2JX9A 2P3JA 1POV3 1YFYA 2RMU2 3HAGA 1PGW2 3FLPA 3O5SA 5GZFA 3WDUA 4J6GA 4PBOA 2WNUC 3EXUA 4NHLA 1H8TC 4HN0A 5TABA 3ZVXA 3HBZA 1DQ5A 2ZMKA 5FMOL 5I0RA 5C8CB 2ECTA 2ZETC 2Y0OA 4HKWA 5IT6A 4YW3A 5L73A 1MS8A 1QNYA 4HK9A 1UF2C 2IZWA 2D6PA 2UU8A 4YZ2A 3WP3A 1AR92 1JYIA 3ZN4A 1LULA 1PK6C 2PLV3 1HXS3 3AYCA 2MD7B 1VBE3 5G05B 1VBC2 2GN7A 4Q4V1 3VBRB 1WILA 3DGTA 2DCYA 1W6QB 2BTVC 4Y22A 2LGGA 2VU9A 1CAWA 2ZGPA 1RUF2 3VDDC 2R6QA 3AYEA 3E5UA 3IDCB 1G9FA 5KHGA 1AX1A 3C2UA 3I2DA 3NVCA 1GQGA 3I4IA 4KU8A 2WJSA 1NA1A 4O9EA 1H4GA 2QJ0A 2RS32 1OD5A 4RS5C 4CDWC 2YUEA 4FPJA 3UKTA 4CDQA 1RUNA 2E6VA 3VBOA 2JE7A 1CIWA 5TRBA 3WVJA 2P34A 2IXHA 1VRH2 2XKOA 5G0FA 1XQNA 5CNAA 2AUYA 3DPLR 4AVTA 5D8AC 3ASIA 1NQDA 2O1QA 1PMIA 4KH9A 3ZFGC 4MV2A 2I2SA 1MEC2 2YURA 4XIKA 5CFCA 1VBB2 1RUI2 4FTEA 5IUQA 5T3NA 4N43C 2EODA 2Q1MA 4S2GA 2XJTA 2HWD3 1CJPA 1RMU3 1EY2A 1J3RA 2JENA 1ASJ3 2GZWA 2R043 2RS11 4G4FA 4YGEA 1N3PA 2OUJA 3JUUA 3RG0A 3EBRA 1HRI2 5KXEA 1WEQA 2G4IA 5LK5A 5DDJ1 2MNZA 1YIFA 3U11A 3SH3A 1BZWA 3A0NA 3HR9A 4AE2A 4LHLA 3CLPA 4DRVA 3FFZA 4RR3B 2D3SA 3OPZA 3WDTA 1ZBE2 4AP4A 4AYUA 2NMNA 1IS6A 4I7BA 3I59B 1DQ2A 4EWEA 3ZYQA 5BNNA 4FPOB 2B46X 3LSDA 1OPOA 1WW4A 5L7OC 1UPIA 1DU3D 3B02A 4KGQA 3QLQA 1YJLA 3ST7A 2JMJA 1V87A 1NA1B 4WM8A 3VBFC 1QMJA 3AP9A 5FLIA 1POV1 2BPA2 2DCKA 1IGOA 1GNHA 1XNKA 2Q4SA 3MPPG 5B8DA 1AJKA 5FO9B 1EV12 2D6NA 2H0BA 1LDKC 1GFF2 2NLRA 3FX3A 1GQHA 3ZXEA 3URFA 2IC1A 1N1SA 4I0BA 2BW8A 1GKBA 1REFA 3U5OA 1QOTA 1AUYA 3KM5A 3WP4A 3N9NA 4KWKA 2L0BA 4Q4W2 2MEV3 3N9QA 5C13A 2B8MA 2ZPXA 1O3TA 1BJQA 4GKYA 3R4SA 2PLV1 1HXS1 2GC1A 4HBNA 1VBE1 2EIGA 5FAXA 4AVBA 5JSOA 4PPEA 4Q26A 5J98B 2WKKA 5T50A 3RWNA 4I3GA 3ZIWA 1C8M2 1LR5A 3P3PA 2UWAA 5T5OA 5FPXA 1KJRA 4JVAA 5I8SA 2JG8B 4IV1B 1XYOA 4CRQA 3V0AA 2B9UA 1ND3B 2A75A 1CVNA 2WS92 3EJKA 4DOUA 2XJPA 4B8EA 1PVC3 4COZA 4EWDA 4AVAA 4P9GA 2RS53 2RR12 1IOAA 1CAXB 2A6ZA 3T1MA 2A3WA 1G9BA 3NW4A 4QGNA 4C0HA 5K9YA 1PIV2 4LBLA 4OUSA 1CONA 3WX5A 1LOFA 5JOZA 2D8SA 3WT3A 3U07A 2ZGLA 2Q8OA 3UK9A 4M01A 5ACA2 1Q5OA 3POWA 5JVVA 5KH9A 1C1LA 2CGOA 1XU1A 2M1RA 1PK6B 1WMFA 3BOPA 5AFEA 1W6MB 1D0HA 4HVRA 3EB6A 1R082 2KXLA 3POYA 2HWD1 1SEFA 1AXKA 4I0WB 4FPYA 2A6YA 2HKXA 2ZJCA 2W08A 1YI7A 1ENXA 5J09A 2H6CA 2K2SA 3AZWA 3VDDB 5CU1A 1J3PA 2NM1A 5C4WC 3M99A 2HWB2 3MIEA 4LEJA 4QT6A 2A6VA 5AC93 3O7OA 2HWE3 4Z82A 4QQ2A 3R6SA 4CDWB 3SHBA 3H7YA 4CTEA 3S30A 4L2NA 4UP0A 5EZWA 3D5OA 3WCSA 2C9AA 3ZN6A 3O0XA 4MXVA 2GH2A 3RDIA 2L75A 4YSFA 1FATA 1NCQC 4MH0E 3AZZA 2W39A 5F1RA 5T5LA 3ZFGB 2ZACA 1Y7BA 1OI6A 1RVF3 2VW1A 3B3QE 3FLRA 3V65A 2VMIA 2BQPA 4KG0A 4N43B 2YYOA 3DN7A 2G6QA 1Z7S2 2ZHMA 4IEZA 2ZGOA 1C5IA 3AXEA 2KR4A 3NJZA 1F2NA 4AQ2A 5J96B 1BORA 2AREA 1FMD2 4XXAA 4WVVA 4ZU5A 1TEIA 1QDOA 1YJKA 2CAVA 1LGNA 4QPIA 3VBSA 1RUJ3 1W0OA 1Y43B 4A3XA 2R32A 3QH6A 1W6PB 2IXKA 5FPZA 5BV6A 5FOJB 1GZWA 3WG3A 1V6NA 1X82A 4L8QA 4MSVA 3KS7A 5GZGA 4CP1A 3C5KA 2D5FA 2MPFA 4V1PA 2EAKA 5L7OB 1OLRA 1OOPB 3RI8A 3VK6A 3U5NA 1PGW1 4A0CD 1R1ZA 5JG6A 1QJU2 1DZRA 3VBFB 5JOXA 3WW3A 5CG8A 2Y1NA 3ZSJA 1OKQA 5J37A 2X5IB 1UN1A 1RUD2 1GR3A 3RJ2X 3V0BB 3KT4A 3AM2A 4EN8B 3LA7A 2AGSA 1QKQA 3POSA 4LLBA 2CYFA 4YBMA 3FZ3A 1Q3EA 4IEWA 4JGYC 1VBC1 2XWJB 1DGRA 2ZZQA 3G6JB 3L9JT 3J26N 2QDNA 1FOD3 1WLDA 2FMYA 1ENRA 4XFIA 4A7KA 4QX5A 4XW3A 2VY0A 3NL1A 1GBGA 4N90A 2QZ3A 3GHNA 5J3XA 1RUF1 4N7UA 1LHOA 2UYBA 4H7MA 4F52B 1N87A 4XQWA 3NG2A 2BVBA 2R072 4HPKB 2WL1A 2JG9A 3J8F3 4R4ZA 3WD5A 3RQ0A 4XBLA 5CAZA 4Q2FA 5FO7B 1IKPA 1SLIA 3DPRA 2WQZC 4COYA 3M3IA 2YZ4A 5AC91 1DG6A 2HWE1 2BFUS 2ET1A 3VZMA 3GL6A 3O37A 1VRH1 2YSJA 2R16A 1RC6A 2ZS6B 4QM8A 4XJ8A 2ZA9A 3FUQA 1YWKA 2CGPA 4QF3A 2AYHA 1QQP3 2ZX3A 4L99A 5KBFA 4Q29A 4BBQA 3AJZA 3H3UA 1RUI1 2IFWA 2WT2A 2A6XA 2PUYA 3I8TA 1O5LA 4NHMA 1BEV3 1RVF1 1SLBA 2DCTA 4BHPA 4LBQD 2JMDA 3DKWA 5DUUA 3JCIA 4UXAA 1YO8A 4NWWA 4NO4A 4GNDA 5FLHA 3B9CA 1D0GA 3ZFEC 5SV8A 4L7XA 4P9JA 4TWTA 3RYRA 5JDBA 2QIZA 5FTTC 3WDYA 2GMMA 1DGWA 5C4WB 3SXWA 3H9AA 4P9WA 3RS6A 1CR7A 1ZBE1 1Q8QA 5LKTA 1SCSA 2YC0A 2UWCA 1RUJ1 2HWC2 1NCRA 2QE3A 4XYXA 4CEWA 2D3PA 2JJ6A 3M1HA 4QPGA 2SLIA 5JZGC 4FJCA 2TUNA 3B94A 2G43A 1UD1A 3IMNA 5TDRA 5CG9A 1Q8SA 1G9CA 2DU0A 4R9DA 5KHJA 4C9ZA 4IEVA 4MXWB 3UJQA 1S0IA 1EV11 2VVDA 3ZO0B 2LXHC 3LOIA 4X3GA 2PAKA 5JMCA 2WINB 1N3QA 3OGGA 3W58A 5AVAA 4R9AA 1LU2A 4R7EA 4GNGA 2VOWA 4XJWA 5KHIA 2ECNA 1XE7A 2A3XA 1WW7A 5KWRA 3I7DA 1Q8VA 3J9SA 3LCPA 3AKQA 3GZUC 1LESA 1FOD1 3K51A 4S2DA 1AR63 2D97A 4FO9A 1WLCA 3AP7A 3WDVA 3WW1A 5C9AA 4WZ2A 4WZFA 1B35A 1LTEA 2RS12 3MIBA 4ZQLA 3J8F1 5BNQA 2QNKA 3ZSEA 1F8VA 5DDJ2 1YXWA 3AYDA 2ETEA 2YV8A 1S0CA 4QMAA 4DMIA 1RGSA 4R9BA 5FRAA 2VNRA 2WNVA 1HQLA 2C0ZA 4LLFA 4P5HA 5TDWA 4MGKE 4LNVA 1M4WA 4XTMA 1SDWA 3ILFA 4MX3A 1LODA 3O70A 1UX6A 4LADB 2D93A 3AB0A 3KV5A 4COVA 5DXDA 4YGCA 5EXOA 4RA0A 3A0KA 4W6XA 3MLKA 3EB5A 3LQHA 1IS3A 4YAXA 3GNEA 1MS3A 1K5MA 4GXLA 3OY8A 1UZZA 4EJRA 2VOVA 2YT5A 3VUOA 4Y1ZA 3BCWA 5T52A 3AFKA 4FPFA 4FOYA 2ES3A 5B79A 4ATEA 3NV3A 4FOVA 3S7IA 5J3UA 2MHFA 1VLNA 4X8PA 2PLV2 1HXS2 3GBFA 5KH3A 1VBE2 4N9HA 1MZEA 3WLUA 4F7ZA 4CDUC 2GC3A 4LT5A 1BCXA 2ECIA 3TRSB 4K9SA 2FUUA 4MZUA 3WW4A 4WM7B 2Y1MA 4IL7A 2C2VS 4HMZA 2KIZA 2EF6A 3MI8A 2D3RA 5FERA 3RZZA 4JRLA 4BHWA 4RQPA 3H1WA 4GH4A 1EPWA 5E1RA 1YCIA 1GNZA 2VH9A 3O34A 5FMOS 1E57A 1DBNA 3ZYIB 4YC9A 5E88A 5EV7A 1Z7S1 1V6OA 1DQ1A 5GLWA 1MZFA 3GBGA 2V5YA 1C1FA 2SBAA 1HQWA 1KD7A 3LGRA 4Q27A 1Q8OA 3ZFEB 5FDBA 4YFZA 1K2FA 1IKQA 4YG3A 4DZGA 1A8DA 3MF6A 1REDA 2WFPA 5JSRA 1Q43A 1F5JA 2AN6A 1BVP1 3IKWA 2DVAA 3N7JA 3OBTA 4AYCA 4BOWA 1TME3 2GC2A 1R1A3 3R05A 5K0UC 2UWBA 4EN7B 3MHSA 1ULCA 2YHOA 3NAPC 1RMU2 3KB5A 4AQ6A 2LN0A 2ZHKA 4UP5A 4B4PA 1ASJ2 2R042 1QWRA 5JZGB 1ZM1A 3INAA 4ES9A 3O35A 4JDOA 2N7GA 2GALA 2XVLA 4XF0A 4L11A 4GQ7A 1CN1A 5HCFA 1QDCA 3M62A 2F4PA 2FHRA 1JM7A 5FLJA 1YFWA 4WVMB 5JI9A 3TWIA 1RUD1 2XWBB 5DINA 3NO8A 1RUC3 1ULEA 3HT1A 1E4UA 1DFQA 3LB9A 3IIAA 4R2YA 5GJ6A 2A6WA 5C8CA 2ARXA 1ENQA 4HETA 4PIZA 1VBD3 2VNOA 3UL2A 2O8QA 1OQDA 3OGJA 1LEMA 1AYN3 5T5PA 3N36A 4E2SA 1CAVB 1JUHA 1J1TA 3DUIA 2PNXA 3MW3A 1SLCA 1XRUA 1ZZCA 3H8UA 2B5HA 4Y1VA 1G9DA 4XFHA 3IHPA 4QQOA 4LO4B 2GNBA 4G3YC 1XYPA 1Z6UA 3VBRA 4UW4A 3KCYA 1W6QA 1UU5A 5EFUA 2VG9A 1ZBDB 1IS5A 1KS4A 3OD0A 1S0FA 2R063 3EO6A 2DUPA 5T54A 1JN2P 2MEV2 1FNZA 4N9IA 3B69A 2BWAA 5KC5A 2CT2A 5LEJA 4AQTA 1YHFA 4CDQC 2A7AA 2KA3A 3JB4C 4P9LA 1C4RA 4N7IA 1TNFA 4ISQA 1WEEA 3WG1A 1VB4A 2ECWA 3USUB 2GSYA 2YHNA 4GB33 3AZVA 2LXPC 4QU2A 3G7DA 3U0ZA 3RI9A 4I30A 2ZGTA 2L80A 4AGRA 4AGVA 5DZEA 1PVC2 1DDLA 3N9OA 4YGBA 1JM7B 2RS52 5DZGA 3GBWA 1JH5A 4X8NA 4XJUA 2ZTNA 3ZXLA 4YATA 1CAUB 2B45X 4E4DX 1OFSA 4HKOA 5FQ0B 4ONUA 3SH4A 4AUQB 4EV0A 1UIJA 3WY6A 1VFYA 1VYXA 2WA3A 3N7KA 4I7DA 5LKXA 2YQMA 2RJKA 4N4FA 5J48A 3ZVZB 3TNPB 2QFEA 4XF4A 4AI3A 4H14A 3VKNA 1LEDA 3JQXA 2LQ6A 1VAMA 3AK0A 1UU6A 2HWC1 3ZSMA 4ZUXU 4RR3A 4CDUB 1G86A 1QXJA 2YU4A 4XETA 1KRIA 3I59A 3OYWA 1PGSA 3S6PA 1SBDA 2ZGKA 2ZCWA 4AG4A 3GHMA 4N53B 1LOCA 3KZ4C 2KGGA 1AL0G 3WOGA 1EAH3 2PHWA 5GALA 4YM2A 4XZPA 4NN2A 5DUWA 2VXRA 4JGZA 3KT1A 1G6NA 4J1XA 3VZJA 5IK7A 3LRQA 1DQ0A 5AC92 3ELNA 2HWE2 4CEYC 4Q8KA 4ORFA 4FIPA 3IBMA 1EYBA 3R4UA 2XL9A 4JTNA 2E7AA 1C3HA 3SMHA 1LOBA 1VBD1 3VZNA 1AYN1 4YVWC 2XG3A 3V43A 2I45A 2QZ2A 3H50A 1W6NB 2VPVA 1RVF2 4RSUA 2ZKNA 4GWNA 1OA2A 1NE4A 1PZ8A 1VAKA 3O12A 3VGIA 1PGL1 5DUVA 5K0UB 3GALA 1DIWA 2IXIA 2IWGB 3NAPB 4TKPB 1X50A 2JG8A 3AXDA 4IV1A 3FBYA 4YARA 4C1WA 1S0EA 3D0SA 3ZXFA 4IQPA 1ND3A 2R061 2LGLA 1PO23 4YM0A 1MQTA 2EA7A 4CDXA 4BIFA 1WMEA 1JYCA 4PF5A 1O3QA 1LU1A 4CZSA 1WFKA 2E51A 4FPHA 4Y1YA 1CAXA 2NN8A 5BXXA 2TBVA 3ALQA 2D98A 3D6EA 3OYWB 4ZDTA 1S0BA 4COWA 1CX4A 2KWJA 1SMVA 1RUJ2 2WNUA 3IT8A 4GB31 4N3WA 5EJ3A 3MLJA 4P14A 3KV6A 4JGZB 2PA7A 4DXZA 1WD4A 4YVSB 3RMYA 2I07B 2KGIA 2AR6A 1PK6A 4A49A 2XJVA 3E5XA 1W6MA 4WVZA 1WGMA 4M00A 4DNYA 1N1TA 3R4DB 4FAHA 3FE5A 4M0HA 5JWPA 4YG0A 4HK8A 5AITA 1WW6A 3VDDA 4X6QB 1COV3 4Z92B 2CKLB 4ITCA 4YW2A 2QQPA 2I50A 4FOWA 2E7QA 2ZGNA 3B7MA 3BALA 1V6JA 3ILNA 1FOD2 4CDWA 2VMHA 4PIYA 5H1UA 4FP3A 4Z07A 3M70A 1MQTB 4CDXB 3SCHA 2BVVA 1ZRFA