4FO9A

Crystal structure of the e3 sumo ligase pias2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
282
structure length
261
Chain Sequence
QGQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLATCPQEDNYPNSLCIKVNGKLFPLPGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKIRNPDHSRALIKEKLTTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEGSWCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase PIAS2
publication title Crystal structure of the E3 SUMO Ligase PIAS2
rcsb
source organism Homo sapiens
total genus 60
structure length 261
sequence length 282
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fo9A01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fo9A02
4B86C 4YABA 4ZUXU 1MM2A 2VPGA 2CKLA 3N9PA 2E6RA 1HYIA 2YQLA 2QICA 2YT5A 5FB0A 4BBQA 1E4UA 4Q6FA 2ECWA 2QJ0A 4AYCA 4FO9A 2L80A 4WA6A 1Z60A 3FL2A 3ZVYA 5B77A 2VP7A 3N9LA 4V3KC 2KFTA 4V3LC 1WILA 4N3WA 5LCWB 4QF3A 2LRIC 4YC9A 3U5NA 5D1KB 3ZPV1 3N9QA 3DQVR 2EODA 5G05B 2XEUA 4GNFA 4I7BA 4MSXA 5DKAA 3U5PA 2D8SA 2F6NA 4X3GA 2M6MA 4I7CA 2VJEA 5KH3A 2PNXA 1X4UA 3ZTGA 3O33A 5JG6A 4WZ2A 2YREA 5TDWA 3HCSA 4GNGA 2XB1A 3MHSA 2VPEA 3LQJA 2CKLB 4CCGX 5KH9A 2KGGA 5KH7A 2ECJA 1DVPA 3LQIA 3V43A 2YSJA 4UP0A 2ECTA 3N9MA 5LKXA 4N4FA 2LGKA 3SOXA 1LDJB 1BORA 5TRBA 2LXPC 2C2VS 2MNYA 2L0BA 2ECNA 4C9ZA 2LGLA 4WZ3B 4I7DA 4GB0A 3O36A 1WEPA 4A0CD 3KV6A 2KWOA 5D1MB 2BAYA 2YURA 2K17A 2ZETC 2YHOA 5C13A 2ECGA 4QF2A 3N9OA 2QIZA 4S3OB 3ZPVE 2KGIA 2JRJA 4AVXA 1JM7A 1WEWA 2CT2A 4R8PK 5H9MA 3I2DA 5B75A 2LN0A 5G04B 2KR4A 3HTKC 4WZ0A 3T7LA 1WEQA 4IC2A 5LKZA 4YAXA 1WEMA 5B79A 4O64A 2K16A 2F42A 5H1UA 4FJCA 4YBTA 1V87A 2HYED 4LADB 1Z6UA 3ZVZB 5AITA 4L7XA 4LK9A 3RPGB 2VNFA 4ZDTA 1WEUA 2KWNA 2EGPA 2YU4A 2ECVA 4FK5A 1JOCA 3LQHA 3NG2A 4LJNA 4B7YC 2L5UA 5FERA 4A49A 4AP4A 3KQIA 1JM7B 3SHBA 5TABA 4ZQLA 2YSMA 3IHPA 2CSZA 3KNVA 2MIQA 2E6SA 3L11A 2MT5A 3L1ZB 3U5OA 2M3HA 3MHHA 1XWHA 3VK6A 1F62A 1U6GB 2Y43A 2KYUA 1WEVA 4YADA 3O35A 2HDPA 2F6JA 1VYXA 3M62A 2KE1A 1WE9A 3O34A 4YBSA 3EB5A 3EB6A 1WEOA 2G6QA 5FEYA 2UZGA 3PUQA 3T6RA 2I50A 2PUYA 1VD4A 4L58A 1T1HA 2LGVA 4TKPB 2LQ6A 1FP0A 3ASLA 1CHCA 1K2FA 2OXQC 5LKTA 2YYRA 2ECIA 2K1JA 2MA5A 5H1VA 1ZBDB 2KU3A 1VFYA 1X4JA 2VPDA 4XI1A 3SOWA 2K4DA 5B8DA 3PHDA 2LDRA 2KWJA 4PTBA 3N9NA 3GL6A 1G25A 4IC3A 4BHWA 4LKAA 4W4UA 1WGMA 4PPEA 4FIPA 1X4IA 2MA6A 4YATA 2EA6A 3QZVA 1WESA 5I3LA 2L43A 2FSAA 2JMDA 2LXHC 3M99A 4AUQB 2RI7A 3SOUA 1Z2QA 2M85A 5EYAF 3KV5A 4CA1A 2JMIA 5D1LB 5C11A 2VPBA 4P5OB 3O7AA 2C2LA 2H0DA 2Y1MA 4MVTA 2G43A 2KIZA 4UI9B 3L1XA 3GV4A 3O70A 2YW8A 4R2YA 1MM3A 2VJFA 3U5MA 5FB1A 3LRQA 3HCTA 5B76A 2NAAA 2YQMA 3C5KA 5G0FA 1FBVA 5DINA 1RMDA 2M1RA 3O37A 4GNEA 2MD7B 3DPLR 2G45A 2AN6A 1N87A 1LDKC 1WIMA 2DX8A 4S3OC 4YBMA 5J3XA 2CSYA 4A4CA 2MD8C 2MNZA 4AYCB 1WFKA 4NN2A 2L75A 1IYMA 2FUUA 3ZNIA 3ZYQA 2FUIA 2LV9A 3PURA 2YUCA 5TBNA 1WENA 2KWKA 4UP5A 5AIUA 2H0DB 3M63A 2IDAA 2LGGA 1WEEA 4GNDA 4R7EA 4F52B 2VJFB 2JMJA 2VJEB 3HCUA 4LLBA 5TDRA 4A4BA 3RPGC 3C6WA 5B78A 5LKUA 2KREA 2MUMA 5H1TA 2Y1NA 1HYJA 3RTRB 2RSDA 2YHNA
chains in the Genus database with same CATH superfamily
4MGQA 3CL1A 3IDBB 1AR93 1MS5A 4K20A 1DBNA 2Z42A 1MM2A 1W2OA 1PO11 1IPKA 4U2AA 2IFWA 4EWAA 4W6WA 3USSA 4GB31 5LZ6A 2IXCA 1UOBA 2RM21 2A7AA 4I30A 4OQ8A 1GICA 2DFCA 4BBQA 1FX5A 1DFQA 2VG9A 5FXZA 4Y33A 4XILA 4DY3A 5FY0A 3H8RA 3LPFA 4AYUA 4AYCA 1VBA1 5FJHA 4L99A 4AG4A 4WA6A 5DZGA 1JYIA 4QM9A 1Z60A 3HQRA 4IEPA 3SXWA 5B77A 3WQ7A 2JKBA 2HWE1 3LCPA 1JUHA 1W2TA 1VPHA 2DJAA 1QQP1 1MS9A 3VZNA 4QKBA 2KFTA 4LPLA 4V3LC 1AR92 2RS31 1I1EA 1D0GA 1AR81 1JW6A 2I45A 1OF3A 1PIV3 4PBOA 4CEYA 1OI6A 4N3WA 2RHPA 5LY1A 2Y6KA 2LRIC 4XBNA 4JRAA 4KNCA 4P5HA 4LO8A 1OURA 3WY6A 3ZXJA 1VBC1 5JSRA 3U5NA 4BZ4A 4Z82A 2KKXA 1X36A 1YIFA 3OBRA 5JXGA 5CG9A 5ANNA 3TOJA 1UU6A 3QH6A 4OI0A 4Y1XA 3V0BB 2EALA 3OGVA 4F83A 4XPVA 3AMQA 4YVSA 2XJQA 4QPGB 3EHKA 2VNRA 1WCQA 1EY2A 2HWD3 4OUMA 3T2PA 4XJUA 1GMMA 1V00A 4MGTA 2ES3A 2M6MA 1FYUA 4AEMA 4LBKA 3K77A 5FZ8A 2ARAA 2JG9A 1H30A 2WSUA 1B09A 2XUMA 1KGYA 4QQLA 4RR3C 5FZ9A 3DYOA 2JG8C 3O33A 3VDDC 2ID4A 3GNEA 1VP6A 5JG6A 1D2QA 2EXHA 2V4VA 4N9IA 3AK0A 5D21A 3ZMOA 4MLOA 4CDXA 5TDWA 4ARXA 3J8F2 3LKJA 3TNPB 2QQOA 3BOWA 3RI9A 2ORXA 1UF2C 1EAH1 1ND3A 1WD4A 4NHLA 4A45A 1LJ7A 3NJYA 1S0FA 1WBLA 5FP8A 1KJLA 1XNAA 1MZ5A 2ZOEB 2CNAA 1VBE3 1AYN3 3WQBA 3LIGA 3NJXA 5L9VA 2KGGA 1WMXA 4Y20A 1S55A 1F8VA 1ZBA3 1F35A 2PAKA 2C0ZA 2JECA 4GZ9A 4YG0A 3VD7A 4CP2A 2DBNA 5IHRA 4GH4A 5BNPB 1DVPA 2DWRA 4HMZA 2ECJA 2DVFA 2WNVC 1XU2A 4MADA 3WF3A 3LA3A 2W1WA 3F2ZA 2WZPP 1Q3EA 2FZ1A 3SLIA 4AHYA 2XJVA 4R52A 4YZ2A 5FY1A 2CGPA 3JQWA 1PMHX 1W04A 2DCKA 2BNMA 2Q5TA 3FZ3A 3NKTA 3V43A 3JB4C 4UP0A 2OZJA 1YQ8A 1T6BX 4N7IA 1R1A3 1W8FA 4Q4V1 4HVQA 4ZZ8A 2XQRA 4AXOA 2YUEA 4WVWA 4YARA 1CAXB 1OA3A 2G4IA 3BTXA 2LGKA 2AZ5A 1FPN2 4J25A 4OFGA 5JIAA 5HXMA 1JZ6A 2JD4A 2WO3A 2RS13 1VBE2 1AYN2 4XVHA 4CEYB 2LXPC 4IV1A 2FBEA 3AKPA 3AC0A 4FXKB 4LHNA 1R1ZA 5CNAA 2CTVA 2ZJCA 2QJVA 2IXHA 3GYDA 2PHLA 5ABJC 3MPPG 2DU1A 2OWAA 2WAAA 4MG2A 3EB7A 2VBPA 3MI8A 4P9JA 4UWDA 2LGLA 2QQWA 4GWIA 1V6MA 1E5SA 3OGSA 5IK8A 3O0VA 1YRZA 4YVSB 1UCXA 4Q8LA 4I7DA 1S0DA 1JOBA 1W6NA 2WFF2 3VBRB 1U12A 1WEPA 3UKVA 3IWZA 3WD5A 4NIDA 3LA7A 1A3KA 1COV3 3AMNA 3OSDA 2VZPA 3TWIA 3KV9A 1ONAA 2WINB 1GZTA 3W9AA 4HXCA 1HV1A 3AZVA 4RQPC 1DLCA 5C4WA 5JOZA 4Q4W3 4XJAA 2KWOA 1MZEA 1QJX3 4CE8A 4XDOA 1QH7A 5EQUA 5CBLA 4M00A 4DEVA 5FMDA 1ENXA 2A6YA 3RSJA 3ZFFA 2K17A 4XW3A 3H8XA 3U0ZA 5BPXA 4BH9A 2W2IA 5F7UA 2ZETC 1OA4A 5BY5A 1ZBE3 3B3QE 1ND3B 5I91A 3KDEC 2BW8A 5FPAA 1S2KA 3IDAA 1JYCA 4QX2A 1IKPA 1FMD3 4NROA 1OVSA 1R093 4CP0A 4EZHA 3JCIA 5FZDA 1QJFA 1K45A 1UY1A 4Y20B 3ELNA 2XXZA 3WF4A 4BQYA 1H0BA 3DF0A 3PHMA 4K21A 5CFCA 4AVXA 2CT2A 2UYBA 2B5HA 3CJXA 1HIXA 4NWWA 4YW5A 3I2DA 4E27A 4R8PK 4IEZA 3O1OA 4Q4W2 2KR4A 1QJX2 4XJZA 5FUIA 1EV11 4AVVA 3T7LA 1OKQA 1GUIA 1GLHA 1FV2A 1WZXA 2VXRA 5A1FA 5A7WA 1AR61 2RR13 4XFIA 4UOJA 1UO9A 1NY71 2RV9A 4CPBA 5J3UA 4YAXA 4BQ4A 1XRUA 1PNGA 3ACHA 4XUNA 4YRDA 2QNKA 3B9CA 1DYKA 5C9AC 1BORA 4PI0A 3HNMA 4O64A 1RUI3 4IV1B 2KXLA 3VBSC 3FL7A 4FPEA 3SQOA 4CCOA 1MQTC 2XJUA 3POJA 2ZACA 3VBOC 1C3HA 3O1RA 1HN1A 4QX8A 5LATA 4CXYA 3Q1DA 1UXXX 2CDPA 2X5IB 4M3CF 2Y33A 3E6CC 3OF1A 4L8QA 4YM2A 2VMHA 2GSYA 1W6NB 2WZ8A 4KU8A 1ASJ3 3U37A 2HYED 1UMHA 3ECQA 3LDBA 3UK9A 5D2AA 3CHXA 3VBFA 5A6XA 1IPSA 5FREA 5AITA 1PO13 4A41A 1O4TA 4LK9A 5C4WB 2XLGA 4GB33 2VE1A 2HKXA 4JRLA 2RM23 3CJIC 2J1EA 5KHJA 3MZHA 1X9PA 2LW8A 2R0FA 4Y22A 2Q0AA 4QDQA 5FBJA 4G9SB 5JZGA 1JOCA 2P4EA 4BXFA 1YFUA 2WZEA 3JBG2 3OUHA 4BQ3A 4Q0SA 3AMMA 3ZYJB 5DINA 2WAOA 2XGXA 4L9BA 2VM9A 3NG2A 3ZFGA 3OGGA 4A4AA 4MO3M 3ZYIB 5FERA 1AX1A 2DTYA 4MV2A 1W8OA 2VZSA 1R64A 1OUSA 4XEZA 1QQP3 4W4ZA 5CFCB 3KQIA 3RZKA 2XOYA 2JDMA 1AR83 1GQHA 3SHBA 1JUIA 2CONA 1Z7S2 1NCQA 3M3IA 4DXSA 2C5DA 1KFXL 5AC91 3SHRA 1G7YA 2MIQA 2RE9A 4OZOA 4J1WA 4DMIA 2J1TA 2VW1A 1NQJA 1GBGA 4GJYA 4BYYA 4AVBA 1WD3A 2W1QA 4OI2A 1HLCA 2K2SA 3L11A 4XTMA 3S5AA 2ZGMA 4JGZC 2MT5A 2VMCA 3L1ZB 5L9BA 4A6SA 1DZTA 2IXIA 5FDBA 1XE0A 2PA7A 1LOCA 1RJ7A 3KHBA 1P8JA 4FPFA 2GN3A 2YFUA 4JDNA 2Y60A 1KITA 4Y1YA 1K12A 4P9IA 1VB4A 1BXHA 1UNBA 2XQXA 3T09A 1WEVA 4YADA 3O35A 1I5PA 2KWNA 2HDPA 3POFA 3BI3A 3LPGA 2I2SA 3O34A 1ENRA 2FZ2A 2ZGTA 3HR9A 3OBZA 3OD4A 4JTNA 1EPWA 2WABA 2WT1A 2DUQA 2YU2A 1EAH3 1H1IA 5IFPA 3VBFB 1GR3A 5JOYA 2X29A 4H14A 3I2KA 2VQAA 3THDA 1GNZA 4HN1A 5EYXA 3ZXFA 5FPXA 2ZEYA 1UY2A 2ZGOA 1H9PA 4WV8A 1J3PA 3ASIA 2I50A 3I59A 4LBNA 1VD4A 5HCAA 4COVA 4OHWA 1HB4A 5GALA 5K0UA 2UURA 2QZ3A 4L58A 5JZGB 1HKDA 1D4M1 2Q4SA 1W39A 3KCYA 2A70A 1ZA7A 4BOWA 4DRVA 4ASLA 5JPMB 2FCVA 2WYFA 5LBCA 3ZFGB 5IATA 1F4HA 4OZXA 5FPBA 4FK5A 3M4FA 2Y6GA 3NNLA 4H7LA 5A3PA 2HJIA 4R8HA 5IK4A 1ZRIA 5F5IA 1CWPA 2HWC1 1MZFA 2B9VA 2PHFA 3CNAA 1GZWA 2ECIA 2VH9A 4LHKA 3AZYA 3VKOA 5LA9A 2OZ6A 1C5IA 2QQKA 2YV8A 4QT6A 3D8CA 3WHUA 2R073 4AFMA 1EUTA 3FJSA 4IW3A 5DDJ2 2KU3A 1VFYA 1ZZCA 1LHVA 1VBB2 2R32A 2YYOA 4O9GA 4QPGC 3RJRA 4D6SA 4PJYA 4HSLA 5B8DA 3PHDA 2OUJA 2LDRA 1DLLA 1O8PA 3WF1A 1RUH2 1G8WA 3WEZA 4EN7B 1A8DA 1W3XA 4CP1A 2YGLA 1FOD2 3N9NA 2VMEA 3WHTA 1G9CA 1O4ZA 4NAMA 5LKXA 1REDA 4YWAA 2VZOA 4X6QB 4LO7A 4QU1A 4E8DA 4ET7A 1HJGA 1WCKA 2MHFA 3MLKA 3WF0A 5F37A 2FDFA 2MEV1 2LROA 3ZSKA 2WIIB 1PGW2 5A3NA 1F5FA 3SMHA 1CN1A 1IQDC 1UOJA 1SDWA 2PLV3 3ROUA 1RXFA 3AZZA 1J58A 3ZIWA 1UZ0A 4YFZA 4HLTA 1RUD1 3ZYGA 2R072 3QZVA 1CONA 1JMUB 4BISA 1WESA 1YQ6A 1LOFC 2LXHC 4XTPA 2X05A 4AWDA 3M99A 5D1IA 3PJYA 5KHGA 2DTWA 2XVLA 4FFGA 2HWF2 5BNPC 1AF9A 3I59B 4GA9A 1POV1 1W6MB 3OBTA 2BBVA 1K5JA 4H7MA 1VAMA 2IXLA 2HBUA 4RR3A 1JOPA 5KC6A 1QJZA 2JM3A 1BMV1 1GSLA 1EV13 2Y6JA 2W91A 3EO6A 4DUVA 4CA1A 4Q26A 2GP3A 5A3LA 5HCHA 1BQPA 2PLV2 4FPOB 1SG3A 5D1LB 5C11A 4P5OB 4LKEA 4CEYC 2BNNA 2WNUA 2B8MA 4RYDA 2BDRA 4ZXEA 3ON7A 2UY9A 1GZWB 5FZHA 2G43A 1V9U2 1VB2A 1WW4A 2RDRA 3GDBA 1W9YA 3KS7A 3BYWA 3IB3A 4HL0A 4NIGA 4PLOA 3OTFA 2WDBA 3H9AA 5AVAA 4R2YA 2BRTA 5DXDA 4YVSC 2W5FA 2VO5A 3ACIA 1QKQA 3VBRC 1UX7A 3AKRA 3POWA 4TZDA 1WA4A 2GALA 5GKAC 3GZAA 1PGSA 2B4KA 2NAAA 3C5KA 3AZXA 2XHNA 2FQPA 2UWBA 3Q8CA 5G0FA 4UFLA 1GQPA 1S0GA 2Y0IA 4CYDA 1Y9QA 5IK7A 2CYFA 2DBIA 4MOAA 5A7NA 3THCA 4OVEA 2E6VA 2V73A 3AVSA 1FBVA 4YG6A 5A3OA 4CDXC 2M1RA 3O37A 3DPLR 4LE3A 1CQ9A 1GP5A 1CAVB 4YW2A 4PT6A 4QQ2A 3FC0A 1LOAA 1ND3C 3D0JA 3SKJE 1UY3A 4YM0A 3CEWA 3VZJA 2OVUA 1KFUL 2VY0A 2RJLA 2EIBA 5EXOA 4GULA 5DAVA 4OI1A 2D6OX 5ABJA 5DUXA 2JDYA 4N53A 3ACFA 1UMZA 2GC3A 3W58A 4CXXA 2O14A 3HWJA 3KMHA 1X82A 4L92A 5K9YA 3N36A 3LB9A 1PX4A 1S4CA 1U0AA 2V5YA 1N47A 3PJQA 4BJ0A 3QACA 4ZHNA 3MV11 3AJZA 2FUUA 5DABA 4RSUA 4CXWA 3ZYQA 1POV0 1UW8A 5L36A 5A80A 2XMLA 1QJEA 1ULDA 1SMVA 3UETA 1N87A 4XJ8A 1G86A 4LBQB 4PDWA 1AR91 1NCRB 1OKOA 1PZ8A 3BU0A 3M3OA 2BFUL 3OY8A 4MGIE 1WENA 4GALA 3A0KA 2KWKA 5J7MA 1QJY2 5FZKA 1I9RA 2QQPA 1LTEA 2Y34A 3K3OA 4XFCA 3FFZA 4IV1C 1UPSA 2WNUB 2VQUA 5FYBA 3V0AB 4NRMA 3M63A 1KS5A 2VXJA 4XQ4A 2P1BA 5EFUA 1ULOA 5CZKA 4A3ZA 5GJ6A 5CISA 1VMHA 1WEEA 2YXSA 3GBWA 5IVYA 3KV4A 4KH9A 1UN1A 1GWLA 2X5IC 3QCWA 3SEEA 4F52B 2VW0A 4GIQA 5FZFA 1O59A 4IGQA 4WBBA 1TQ5A 2AEYA 1PO22 1X33A 3KGZA 1D7PM 2VVFA 4QXHA 4RGKA 4AVTA 5TDRA 1W8HA 1V6IA 1W06A 1YO8A 1YQ5A 5D8AA 5F6LB 3VBHA 5K4LA 2Q8OA 5FZOA 5C4WC 3C6WA 2VZUA 5LKUA 5C3RA 3HOBA 5L73A 1UYXA 2B0OE 2BZDA 3CKHA 3J8F1 4C1WA 3MDBC 4AL9A 2ZGQA 5KHHA 4LHLA 1UOFA 2MUMA 1YQCA 1AL23 2XONA 4XCAA 2WLQA 2BV4A 4FQ4A 2J1AA 2ATFA 4G3YC 5C9AA 5HI0A 4V1PA 3A23A 3NSTA 4NRPA 2D93A 1DZRA 2YHNA 4JHTA 4B86C 4FOVA 2VMDA 4YABA 1AR72 2I74A 2V09A 3MW3A 3Q8BA 1ZRFA 1VE0A 2VPGA 5A70A 4FVVA 2CKLA 3D0SA 3N9PA 1D4M3 1HRV3 1QXRA 1Y7BA 3KQRA 4N53B 4S2FA 4AEKA 2E6RA 1HYIA 2VMFA 1CAUA 2CSGA 3P3NA 2QICA 3EQEA 5FB0A 1KXGA 2HH9A 1MACA 4LOSA 5CFCC 1E4UA 2WLPA 3LDKA 3U14A 4CZSA 2QJ0A 1S0EA 5FY9A 3X29B 3VD9A 4FO9A 1C8NA 2RDNA 1GNYA 1SHWB 2D6LX 2HWC3 3D3AA 3K4DA 4UXAA 2IUWA 2L80A 4XYXA 3LSEA 3ZYRA 4AFCA 4INDA 5KXCA 4PDWB 1AL22 1H8VA 2ZMNA 1W99A 3OY8B 2G9ZA 1FPN1 1NXMA 2Q8EA 3FHQA 1VBE1 1AYN1 1QDOA 2WT0A 1REFA 3LZZA 1IS6A 2XL9A 3PLQA 5A6ZA 4KQ7A 4Q27A 1IKQA 1HRV2 4DO0A 4LT5A 3IZOA 3N35A 5LCWB 2IXJA 3FHIB 4QF3A 4XABA 5BYNA 3P5BA 4QGMA 5T54A 3RZLA 5A3UA 4YM3A 1ZZBA 3DN7A 1RYYA 2BEOA 2PMWB 2VCBA 3N9QA 4AR2A 1NKGA 3I2JA 4YGCA 3BGAA 3NWKA 2WFF1 5F3CA 4F7ZA 3H7YA 3TEZA 3APBA 4CDUB 1V0AA 2XEUA 3GCWA 4GNFA 4I7BA 4MSXA 1XNKA 2YFZA 4AK3A 4BCUA 3M1HA 4W8JA 5A3WA 4E2QA 2VBBA 2D8SA 3VBFC 2QDNA 3Q8AA 1PM7A 3B69A 5D8AB 1V6KA 5IWFA 3VBHB 3S0MA 5KH3A 3DECA 1XNBA 5L9RA 5GLZA 1JYXA 1E5HA 4WZ2A 4Q1RA 4JGZA 2VCMA 1BCXA 3LAGA 1ACCA 4K3UA 1N3OA 1PMJX 5I8SA 5JZGC 1OF4A 1YQ2A 3O0WA 5DN2A 4BB3A 2WA4A 1LHWA 4PQQA 4CDQB 4FFHA 1PK6A 1OFSA 1VALA 3CIHA 4ZKTB 1TEIA 1W6QA 4JQRA 4LNVA 2CKLB 1LEMA 3FE5A 3ZFGC 3K2OA 4EV0A 4YGDA 4IEOA 4MH0E 1XNCA 3RRDA 4DS0A 5FOBB 5KH9A 1XNTA 5KH7A 5IVCA 5A7OA 4F3JA 1OUXA 2JWPA 4Q4W1 4X8NA 5FPZA 5FZAA 4COZA 1QJX1 4A6OA 5J09A 3H3UA 3B9IA 3OB8A 4LLFA 5FYZA 1F5JA 3BVCA 2FMYA 3OD0A 4IXLA 2UY8A 5E6HA 1OQEA 3WCSA 1AXZA 1I6XA 2XLAA 4IESA 2VPVA 3WNLA 3ZN6B 5J37A 2R043 4C0HA 2YSJA 1OMIA 3A0NA 2OQ6A 4IE6A 5FRAA 1O8SA 3KVAA 1VAVA 4YGBA 5T3NA 5FZCA 2GU9A 3LOIA 3UGFA 1GV9A 1U5XA 1QEXA 5IAVA 2TNFA 3WNMA 3PIJA 1S1AA 2VOTA 2EXKA 4JKLA 3G7DA 3KF5A 5DUUA 4DPNA 2MNYA 1OLQA 4AI2A 5HV4A 3OBAA 3IMNA 2ZHNA 3AP6A 4D69A 2R49A 3VD4A 1SLBA 3POGA 4CCEA 5AFBA 5DPNA 4AHXA 2QQUA 3IN9A 4QGLA 1UOGA 2VMGA 4Y4RA 3L9JT 5FLIA 4EJRA 4NJ4A 4XBLA 2AH2A 1RUJ2 2H0VA 5A33A 3O1SA 2XP0A 1OLRA 4LO5B 1PGL2 4WZ3B 4GB0A 1QJU2 5GLTA 3O36A 2ZEXA 5LW9A 4PQ9A 2JDHA 2J1VA 2R042 4M0HA 2MKEA 2A3XA 2A71A 4E4SA 1G6NA 5IVJA 2GC2A 2F4PA 3LA2A 4AI1A 4AQTA 2XR4A 2YPDA 4QPGA 1HDKA 5BV6A 3M3CA 1X8MA 4M3CB 4RN5A 3R4SA 2ZA9A 2QKDA 5HBAA 2EICA 5I0UA 3JBG1 4UT5A 3U10A 1G9BA 1W9TA 5J1XA 2CU5A 2ZZQA 3BALA 4LQRA 2ECGA 1PK6B 4NOTA 4QQ4A 2QIZA 1E57A 2Z69A 1W6QB 1NE6A 1VRH2 4YW6A 1M06G 4DINB 4FAHA 4DOUA 1YXWA 4AQ6A 2Q1MA 1PNFA 2OA2A 2VBDA 2WJSA 1M4WA 3K46A 4ARYA 2JRJA 1CX4A 1MS8A 3ZR5A 5BNOA 2JUNA 4Z2AA 1Z7S1 3GHMA 4QB2A 2JE7A 4LIUA 1SFPA 1BKZA 1Z78A 1LOFA 2R30A 2RDSA 3AL5A 5DAWA 5H9SA 2YVRA 2FCUA 2MNGA 2WFPA 3HTKC 1TMF3 3S30A 3HQXA 5GZDA 4B4RA 4CEWB 3WCRA 5BNPA 3ZXLA 1NLQA 1WEQA 4META 5FMCA 3ST7A 2QVSB 2JEMA 3VL9A 3B7MA 4HG6B 5FXVA 5LKZA 3NJVA 4N8MA 4BDVB 5HPOA 5JXHA 1N1VA 1XOYA 4YZ3A 2UWAA 3N4MA 2XJRA 5FJKA 1SLAA 3PMSA 4AFAA 2GN7A 3LQCA 2EVXA 5H1UA 1CAXA 4I3GA 4RHV3 3HPNA 3URFA 2E7AA 1JYTA 4FJCA 4NIHA 3SH5A 3BTYA 3NVCA 3ES4A 3KB5A 4Q0QA 5C5TA 2BBAA 2WN3A 3J8F3 4LIVA 5FKBA 5A33B 4DUXA 2WO2A 4LO6B 4FPKA 4YG3A 4YBTA 3BUCA 1SBDA 1ZZ9A 2J1UA 1TMF2 1CX1A 2Y6HA 3ENRA 1Z6UA 1Q43A 3H8OA 2VUJA 2DFBA 3SITA 5F3EA 3ZVZB 4LKFA 5EJZB 2QDRA 4LJHA 3AJYA 1L7RA 2E32A 4XUTA 5LRSA 4FP3A 3VBRA 2BVVA 3RWKX 3RYKA 4K9SA 1L7QA 4LEJA 2PYTA 3H42B 5KBFA 1AX2A 5F39A 4KMQA 5A32A 1W8UA 4V2WA 1DYPA 1CVNA 4RHV2 4UW6A 3NL1A 1NCRC 1JS9A 2BU9A 3IMMA 3I54A 2ETEA 2W3JA 4TYSA 1J3QA 3LEIA 1NLSA 4JGYB 2XJSA 1RGSA 1MS0A 4LJNA 3GF6A 2L5UA 1UY0A 4B7YC 1MZ6A 1QF3A 1WBFA 1YNAA 1AJOA 1OA2A 4KU7A 2VECA 2WNUC 1FPN3 3UKNA 1DIWA 4FXGB 4BA6A 1UXZA 3MF6A 4IE4A 4LUMA 3IPVB 3VHPA 1WMEA 1HN0A 3T0AA 5HXVA 4PIXA 5C8CB 3K4ZA 5K7PA 1RUOA 5DDJ1 3KNVA 1VBB1 1O3RA 3HT1A 5HCBA 3R4UA 3WSOA 1SDDB 1ZNPA 1RUH1 3MLJA 4AI3A 2WFF3 1FOD1 4K8FA 2BVBA 2W68A 3LGRA 2OIIA 1KS4A 1XYPA 2ZX0A 4AI8A 2BUKA 5ANQA 3MHHA 1XWHA 3ZDSA 1BVVA 1X7NA 1LB2A 3VGIA 2Y43A 2VCCA 1PGW1 4MXWA 4AVCA 3S57A 1CGPA 2NQYA 2W87A 2F6JA 1O3SA 3J7LA 4LOTA 4PCRA 2R071 5JVVA 4TLGA 5FYHA 1J59A 2PHWA 3I2GA 5FZ7A 1H8TA 3AVRA 5T5OA 4QKFA 1LGCA 4RGGA 3T2QA 1OLMA 4N53C 1V6OA 4ZS3A 2X5IA 2DURA 1EYBA 2WWUA 3B01A 4HFSA 4XUQA 4YFWA 4CDWA 2HWF1 4I0BA 1WEOA 4OMCA 1OH3A 2WKKA 4RGAA 2G6QA 5FPLA 1Z0HA 5LK7B 4FPCA 4OHZA 1UYYA 1Y3TA 2WS93 4Q0VA 5FP4A 2YBKA 3I2FA 1IGOA 2VQTA 2ZMKA 3PL0A 1WW7A 5A7QA 4LORA 5A32B 3O5SA 2J22A 4ZZ5A 4LA2A 3A21A 4PDWC 2LGVA 5LEKA 1DQ1A 4LO4B 3PLWA 1T6GC 4BIOA 4EWEA 2PLV1 5A1LA 3VD3A 3E6BA 4IQPA 2TBVA 3ASLA 1REEA 5C8WA 2JD9A 4HONA 2ZS6B 4JQTA 3AX4A 2XKPA 3ILNA 1V9U1 3HJRA 2YYRA 2W92A 3VBUB 3CO2A 3B5LB 4IE7A 4KI5M 4P9GA 2ZHMA 2VCAA 1JU3A 2WWJA 4YW7A 4B4PA 3VHOA 1UYZA 3KVBA 1W28A 2WS92 4CDUC 1UU5A 1BVP1 2IVIB 2QQMA 3OOXA 2VPDA 4EN8B 3WW3A 3D5OA 3EXUA 4XACA 1DQ5A 4FOQA 4I01A 4IV3B 4QGNA 5E8AA 4FTSA 2K4DA 3DPRA 2D97A 1J84A 5JR2A 3ZXKA 1KJRA 5D8AC 3VBHC 3MPBA 2D3SA 4QHBA 1FAYA 2GC1A 2VZQA 3GL6A 4ISRA 4MXVA 2VR4A 4W65A 4BHWA 2VTFA 3HN1A 5BXXA 3LFMA 4MXWB 3I3DA 2BERA 5CA6A 3WNOA 1UPIA 3CLPA 3LD8A 4O61A 2QQVA 4AAPA 2IVJA 3HEIA 4CDQC 4E4HA 4PPEA 4HOOA 3OYWB 4E4DX 1NA1B 1HX6A 3TRSB 5FR3A 1H8TB 4EE2A 3JBG3 2GH8A 3LWCA 3PNAA 3FUOA 2JDKA 1H2NA 1HQNA 1PM4A 4CDWB 5I3LA 2L43A 3UGGA 3RG0A 1LHOA 3ZLIA 4BMEA 2A3WA 1DGWA 3EBRA 4DEQA 1XNDA 5M0TA 5FAXA 3ZSMA 2VUCA 1VRBA 2VMIA 4UBHA 4Q4Y3 4C1XA 3TEWA 5FZIA 1ZRCA 4AVAA 2RR4A 5A7SA 1Z7S3 3WDYA 3ZXGA 5IVFA 4IEYA 1JODA 3H50A 4DNYA 3IKWA 2OW4A 3TEYA 3I3MA 1XSRA 5EYAF 3KV5A 3GXUA 2PQQA 1QJY1 1VLNA 2AYHA 4LBJA 3IDCB 4U36A 4ZY9A 3UL2A 3AYCA 4NPMA 3WDUA 2JKXA 5H9QA 4UW3A 3RFRA 3W5NA 1S0JA 2JJ6A 1XSQA 1N1SA 3QOPA 3UJQA 2EGMA 4IEVA 2ZEWA 4CTEA 2H0DA 2ARBA 2K46A 4BIFA 2Y1MA 1HRI3 2P3KA 4MVTA 4C8DA 2KIZA 1GZCA 3PMEA 4B1LA 1LHUA 5DUWA 4ITCA 1GP4A 4Q4Y2 3SNMA 3AYEA 2ZABA 2XVKA 3GV4A 2BQPA 1PO21 4HETA 5FZ4A 1OQ1A 1YJKA 2OKXA 3RS6A 5FK7A 4I09A 5F3GA 3BCWA 5FB1A 2EIGA 3LRQA 3DPRB 3HCTA 5CKNA 3T4HB 2H6BA 2YY1A 2HYKA 2J1RA 5CB7A 3WINE 2PHUA 4PLMA 2FDKA 4JHZA 3GALA 4E4ZA 1JTZX 4C90A 2W1SA 3AP4A 3H7JA 4JX0A 3E1F1 5DQ0A 4AVSA 5K3QA 4QHZA 1MR5A 2JIJA 4H3WA 1WLCA 3ZKUA 4XBQA 3H1YA 1AR71 4NAOA 1PMIA 1HRI2 4IETA 3T4VA 1PK6C 1C8M2 3J26N 4K40A 3RJ2X 5I8YA 1LDKC 5E16A 3DCQA 2O8OA 4XFHA 4XXAA 4LULA 2PAMA 3DKQA 4Q0PA 2RMU3 4M0NA 2VL4A 2D43A 2Z4FA 2VZVA 4JCKA 5CEHA 1DP0A 1W6OA 4CCJA 4NN2A 2OUHA 1B35A 1RINA 1CZVA 3PVNA 5F32A 1L7LA 2HEYF 1V6NA 4ZU4A 5EIYB 1LOEA 4P9XA 1US3A 4ZU7A 2DU0A 2FMDA 4NIAA 5F8PA 2Z79A 1LHNA 2ZTNA 3NW4A 2ZZJA 1APNA 5EP9A 3SKVA 1AL21 3PUHA 4COWA 4UBGA 1BLZA 5DUVA 3RNSA 4CEWC 1NOVA 2DYCA 2XDVA 3ME2A 5TBNA 1UZVA 1H6YA 1W6MA 4K6BA 2RJ2A 5DDJ3 4D6RA 3M8LA 4YW3A 1VBB3 2KM2A 1RB8G 2DCJA 1HB2A 3VKLA 3C7OA 1HRV1 2XLFA 4UP5A 4QPIA 2RMU2 2Y6FA 5FO7B 1RUH3 4Y5TA 1W8NA 2D6KA 2H0DB 1FOD3 3DXUA 5JAXA 1Q8QA 1TG7A 3MDPA 5FPVA 2IDAA 2LGGA 1XYOA 4RS5B 5GLUA 4ZXKA 2CWMA 3CZUA 1W0OA 1E5IA 2DVAA 3V65A 4XQDA 1H4GA 2ADEA 2JMJA 1KDMA 2NN8A 3TBDA 2VJEB 4XIKA 1UQXA 4OGCA 1ULFA 3N7MA 2FDHA 5IFTA 2P3YA 3HCUA 4LLBA 5FMOL 4QU2A 3W5MA 2PTMA 1H6XA 5A7PA 5SV5A 1RUG2 2J1SA 4N90A 4BM8A 4A4BA 3WX5A 3WW4A 4FPJA 1GNHA 2D6NA 5SVYA 4LKSA 3E5QA 4IGOA 3Q8EA 2HWF3 3H1WA 1JBCA 4XF3A 3H0OA 3EYPA 1O5UA 2BGPA 1H9WA 3HIFA 1LDJB 3RTRB 3T0DA 1DCSA 2AACA 2B42B 2GH2A 4ES8A 4ZUXU 4MHRA 5E1RA 5K8SA 1ODNA 4JGYC 4EN6B 1CAVA 2PAEA 1FNYA 1LNSA 4XZPA 4ZS2A 2YQLA 1N1YA 2K9ZA 2JB8A 1W6OB 1QHDA 1W2UA 4CVUA 5BNOC 1B35B 1OLME 2DF7A 1MBMA 1J83A 5C70A 4Q6FA 3JUEA 1MPXA 4DXTA 3MGUA 5C8CC 2GC0A 4UFHA 5FIXA 3MIHA 5LK5A 2WSVA 3OPZA 1V9U3 5J98B 2WUHA 3JUUA 5JSPA 3ETQA 3RMYA 3FL2A 3FFQA 3ZVYA 3AFGA 5G04L 1V6LA 5FWEA 3V56A 5T50A 4ZONA 3N9LA 1MEC3 1JU4A 3FWEA 3PU3A 4QPYA 3VKFC 4QPIB 3FUQA 1SBEA 3SUBA 3SCFA 5FMBA 4LBQA 1NCRA 2Z2SB 1WILA 4NO4A 1C5HA 1F31A 4HPKA 3IM0A 4LITA 2R7EB 2IZWA 2PN5A 3N7LA 5LB6A 3ATGA 2C26A 3POBA 4HKOA 4P9WA 3R05A 4B7EA 1JYWA 3LIHA 2NP0A 2UWCA 2WNEA 1RUJ1 3DQVR 3OPWA 1PGL1 1QJU1 3V0AA 3GJAA 2EXUA 4YLZA 1UY4A 2WO7A 3MF9A 5CYYA 2D3RA 2R041 2DVGA 1QNWA 4P9LA 4XFFA 3WW2A 1UIJA 4AW7A 5HV0A 2FDIA 5DKAA 1QY4A 3ILFA 4LBLA 3HD8B 5KXEA 4MGKE 2D5HA 1MEC2 2NYYA 4I7CA 1JYVA 4MZUA 3ZTGA 3AMHA 1GYKA 1JN2P 3LDYA 2NLRA 2O1QA 2G1MA 2YREA 1BBT2 1DU3D 4NWVA 4QD2A 2Z5WA 4XIOA 4Q8KA 1CZTA 3U1XA 2CGNA 1VRH1 4WM8B 4GNGA 4AQSA 3MHSA 3GZEA 2VPEA 3LQJA 1I3HA 2HEWF 3I2OA 4QX1A 3FEHA 5A1AA 3K4AA 1SPPB 1LENA 5FYUA 3WP5A 3ZYFA 4D0QA 1LGNA 3KCXA 3WW1A 4A44A 4CCGX 1XJAA 4XDQA 3BPZA 1OOPA 2C9KA 5FY8A 5DG1A 1QJY3 3AKQA 3KF3A 1GOGA 4X6RB 3VBUC 3HBZA 5FMOS 1GOHA 1RUC3 2EXJA 2J42A 1AXYA 3LQIA 4Z1VA 4JVAA 4YW1A 2AEZA 3JZVA 4FI9A 4BQXA 1RC6A 2EAAA 3MYXA 5CADA 4XCBA 3FBMA 4JKMA 3IT8A 3ILRA 1WLWA 4Y5Z0 1QH6A 4MHUA 4KWJA 3VLBB 5BUVA 4IV3C 2Q1ZB 4GAZA 5ACA3 5F6KA 2ECTA 1GQGA 4E2GA 1NX9A 2R063 3POEA 2DCYA 1OXCA 1TME3 1PO23 3T2OA 4N4FA 1KEXA 3SOXA 2ZPXA 1BEV3 3INAA 2BNOA 3RZGA 1HXS3 4HPKB 4NMIA 4BK4A 5SVIB 5KWRA 4N43B 3USUB 2JE9A 2XOZA 1UIKA 2WQZC 4FOWA 4ZPIA 4JC1A 5LA2A 1AXKA 1RUC2 4C9ZA 1DZQA 4O65A 3WG2A 2SLIA 1TMF1 3UV9A 3ABZA 5TRBA 1NA1C 3HBKA 2P6HA 1H8TC 3DGTA 3O14A 4EN9B 2ZX1A 3P3PA 1X9TA 5KHKA 2A6XA 4DXRA 1AR73 2VD7A 1YI9A 4CDWC 4A0CD 2EA7A 3DV8A 1DF0A 3MIGA 3R0RA 1ZYBA 4CDUA 2YDEA 3H3LA 5ACA2 4D94A 1IQAA 1C57A 2JDAA 2R062 3RYRA 5J36A 2FD4A 1TME2 2D7FA 5LRRA 3LSDA 3DYPA 1XQNA 5D1MB 4CCNA 1BEV2 1HXS2 2CGOA 3HNYM 4RHV1 2QQIA 3JB8A 3VB9A 3NAPA 3VKMA 4CUBA 1SACA 1UKRA 4LK6A 4WZCA 4ATEA 4QF2A 5C13A 3VZLA 5F9TA 3NRUA 4Y1VA 3WDVA 4XDPA 3LJUX 5EWSA 4F1PA 3AXDA 4KWLA 3KT1A 1PVC3 2XOCA 2RJKA 4XMIA 3FN9A 4AE2A 4CDQA 1OOPB 2WYSA 4OI4A 5H9RA 1D0HA 1GU3A 4MGZE 3WNPA 1XBFA 2BTVC 1C4RA 1WKYA 1F2NA 3MIDA 5C3OA 3SH4A 3IIAA 3ZFEB 1UZZA 2W39A 1JM7A 3ZSJA 2IC1A 2V72A 3GBGA 4HSJA 2EXIA 1RHI3 5H9MA 1RJ8A 5G04B 4BLJA 5DAPA 1WLTA 4PHZA 5FLHA 2K0GA 3HN3A 1QXJA 3E97A 4CCCA 1PX3A 2ZX4A 4DY5A 2VAUA 3DPRC 3SISA 1RUE3 4KBZA 3VDBA 1K42A 4IDZA 1O7FA 4LKDA 3KT4A 2A6WA 3BIWE 3ZVXA 3CZJA 3ZN6A 1WMDA 4QAWA 4QXBA 1YYNA 1PVC2 3NNJA 3T3YA 5B79A 2ZGUA 4YNIA 2K16A 5FFOC 2AENA 3BB6A 2TUNA 1Q8SA 2P3JA 1YUDA 2Y64A 1TVGA 3TN93 4R9BA 5EJ1B 2V5DA 3O7OA 3T2TA 4PBPA 1RHI2 4W50A 3TYJA 4CCDA 3KQ4B 4QX7A 4FPLA 3SCGA 1AUYA 3LDRA 4OUEA 1WA6X 4XMAA 1V87A 4JKKA 5I0RA 5T55A 3U11A 2BGOA 4RQPB 1O5LA 2Y6LA 3A7QA 1JHJA 3KCCA 1L3JA 2JB4A 2WN2A 5IUQA 2Q8CA 1OBNA 2WR9A 1ULGA 3ZPYA 3NMBA 3JD73 5GZCA 4HVOA 1RUE2 3LFIA 4O7XA 1WW6A 2D40A 1H2LA 4QPWA 4QKDA 4ZDTA 1SQ4A 3RPGB 1VBD2 4NR1A 3KSCA 2W46A 3IDEA 4NIIA 4WM7B 3ZKYA 3MUZ1 3ETPA 4QXCA 1GOFA 1POQA 3NAPB 2BFUS 4Y24A 2ECVA 1CAWA 1DDLA 1JZ3A 5GLWA 2Y0OA 2XH6A 1J1TA 2JDZA 2JDUA 2VJXA 2ORZA 4M3CA 3TN92 3ZX7A 3RZJA 1MVQA 1OT5A 5GM0A 1FNZA 3JXSA 2D6MA 1IG3A 5ERLA 4N7UA 3RI8A 4AZZA 4DB5A 1AYM3 2QUOA 4FAGA 2WBKA 3AKSA 4LE4A 5EHDA 1W0PA 4KL1A 4A49A 2D5FA 1SLIA 2BJSA 2ZGRA 4AP4A 4XZUG 1KQRA 4D7TA 4EN0A 4Y4YA 1RL3A 2HEVF 1FI2A 3J4UH 4P00B 4TXWA 3THTA 1RVF2 1US2A 3KM5A 1JM7B 4RS5C 3TNQA 2LRPA 2WS91 5FZMA 3JD72 1W9FA 2IFRA 5A3MA 5IVBA 4ZQLA 2YSMA 3IHPA 3BU7A 2CSZA 2VU9A 4YGEA 1UX6A 4FBFA 2VVDA 3CDZB 3WLUA 1W0NA 4UI9L 1RUJ3 3QBQA 1IS5A 2UYAA 4Y5SA 5C3QA 2BP6A 1NE4A 1QJU3 3NJZA 3WG1A 2QFEA 5CIRA 4CEWA 5TSWA 3U5OA 1WMFA 1AL0G 2BYVE 5FZGA 4YZ1A 1HV0A 2QBXA 2P57A 1AYM2 2F6BA 3VK6A 4R4ZA 1U6GB 1F62A 3TEXA 3U07A 1X4UA 3MHZA 4HZFA 4OHXA 2KYUA 1PZ9A 1DQ0A 2HYXA 2VC9A 3F95A 3OEAA 1YJLA 4CUAA 3WV6A 4QX0A 2AREA 4QB1A 4A42A 4QB6A 1DQ2A 3TB0A 5C3SA 1PVXA 4J6GA 4AOCA 4EROA 4DUWA 1VYXA 1CPMA 4NN0A 4BK5A 2KE1A 3M62A 3GM8A 4K7JA 2Q30A 2YPJA 4Q2FA 2VVEA 1IPJA 2E53A 5C3PA 1VRH3 1WLDA 5DAXA 2YROA 2NM1A 1YCIA 2QCSB 5ISLA 4JDMA 2B39A 3NQHA 4AFDA 1B35C 4DIQA 5FEYA 4LR4A 4IL7A 2C6SA 3PTRB 3N7JA 2F17A 2XWJB 3I3EA 5EV7A 2PELA 1IOAA 2CRWA 2JDPA 1CAWB 1BYHA 3KWVA 1W3VA 1Y9MA 2PFWA 1VIWB 4YVWA 5FCCA 4B29A 3DUIA 5FYSA 4CP9A 1QXPA 4HKLA 1VMFA 2H6CA 4CCKA 1OPOA 4QPIC 4AEDB 3LEGA 3K3NA 4E8CA 2GDFA 4LBMA 4MYEA 4Z2WA 4I2OA 1FP0A 3GHNA 4QQOA 3PDQA 4FFFA 1R083 4XHXA 2WNOA 1CHCA 1K2FA 2D98A 3RMXA 3GBFA 4CU6A 4JGYA 5EYYA 4Q4Y1 1LOBA 5JCTA 2K1JA 4KWUA 4AF9A 3H1MA 4UFIA 5H1VA 2ARCA 3IPVA 1HB3A 5C8CA 3NV3A 2CL2A 3ZDVA 1X4JA 3IAPA 3S7IA 3N7KA 2FFWA 2L7PA 3UESA 4LA3A 3WXPA 5A3TA 4P14A 3I3QA 3H7HA 1KD7A 4BMBA 3PVBB 1G9FA 1GFF2 1LRHA 1O4YA 2JXAA 4AQ2A 3MICA 4PTBA 2ZAAA 4FCAA 5LWBA 4ATFA 4FT8A 4Q4X3 1UD1A 2RS52 5T5JA 2ZKLA 4A7KA 2A5ZA 4IC3A 1HRI1 4O62A 2CDOA 1C8M1 1R082 3BPSA 4LMFA 4XETA 4W4UA 3ZXEA 3ZYBA 4I0WB 4JZRA 4XFBA 4WM8C 2C9AA 1QNYA 2P3IA 2ZCWA 3I97A 4FIPA 5FO9B 1S0BA 2JE8A 2MA6A 3PU8A 5A6QA 5FYCA 1LCLA 4YATA 4MSVA 4AFBA 2HWB2 2ZMLA 2W94A 2FSAA 1UYPA 5FP9A 1YI7A 2JMDA 2WZR3 4TTGA 2VQ0A 3J7HA 5JSOA 3B93A 1EUUA 5EJ3A 1WGPA 3GCXA 4ZU5A 5JWPA 4AUQB 3BKZA 4OULA 5IVVA 1QIQA 3ITQA 3I3BA 3SOUA 4BHPA 4Q4X2 2VNGA 3RYPA 5IT6A 1SLCA 4Z8BA 1RUF3 2FHRA 3ZXAC 5J48A 5BNNB 1OH4A 4W6YA 3I8TA 3MO4A 4YVWB 4Z92B 1IHMA 3M70A 4AI0A 1H4HA 5FZLA 1JZ7A 4CP9B 2RMU1 1JI6A 1IS4A 2DUPA 3VUOA 2ZXQA 1NUKA 5IW0A 2JMIA 1XYNA 3AP5A 2X8KA 2VPBA 3FANA 3DYMA 3OG2A 2C2LA 2EF6A 3KZ4C 5CFDA 4N43C 5SV8A 3FMGA 1W6PB 2WZR2 3A4UA 1CJPA 4I3PA 4NHXA 1UZYA 4D8MA 2WC2A 2JICA 4UI9B 4PLNA 3MIBA 2ZEZA 5FZ1A 1OHFA 1YEWA 3VBUA 3O1VA 1QOSA 3QH7A 4GWNA 2VJFA 1ODMA 1Q8PA 2ZGLA 5LBFA 1RUF2 3U5MA 1RUG1 2DDUA 2CSVA 4XF4A 3QLQA 5DG2A 5G05L 2OPWA 3NNMA 3KHCA 5FYTA 3VZMA 3M7KA 1JHNA 1PIV2 3SC7X 5JOXA 3T1MA 5JMOA 2WA3A 4IV3A 4NPRA 4OQ9A 4TLFA 1OFNA 4YZ5A 5FO8B 1TNFA 1OPMA 2XKOA 4GNEA 2MD7B 3E2DA 1SLTA 4D3WA 2ET1A 2P6CA 1ZX5A 4L11A 3VZKA 2AN6A 3E5UA 4BQ1A 1C1FA 2CV6A 2DCZA 4NHKA 4IE0A 4F8AA 3RDIA 4YBMA 3E5XA 3O47A 2HWD2 2CSYA 4A4CA 1OOPC 2B9UA 2OYZA 3RPQA 3VL8A 3OYWA 1J1LA 2BOIA 4AYCB 1NA1A 1WFKA 4EWDA 3ORJA 1KRIA 1D2SA 2CWSA 3ZFEC 1ZZ8A 1IYMA 4OGEA 3HNBM 3FX3A 3U75A 2DVBA 3WDWA 3DDTA 3ZNIA 4LLOA 1W9SA 2RDQA 2FUIA 1K5MA 1YLLA 3PURA 3W21A 1WUVA 5HCFA 2YUCA 4WVVA 4NPLA 4YM1A 5FXWA 2XG3A 4XJ9A 3J9SA 1AVBA 1JZ4A 1CIYA 3C3VA 5FQ0A 1VAKA 1OD5A 1HQWA 4C91A 2CHHA 4M3CE 1A78A 4NVPA 4A2UA 1UMIA 3BN6A 3DXTA 5L7OA 4D7YA 1ZBA2 3I4IA 4B1MA 2VOKA 5CFDB 5F5AA 4TWTA 1RMU3 3ZIXA 4FP2A 3HVDA 2B7YA 2PHXA 1SFNA 4EZ4A 4QKNA 3T0BA 4S2GA 4LBOA 5KHIA 4R7EA 2BGCA 3O1TA 3G6JB 4GWMA 2Q8DA 2VJFB 4B4QA 2ZGKA 4R9CA 1XU1A 5KR7A 1OC1A 1Y43B 4PIYA 4HVRA 1R1A2 1YIPA 2YBPA 4J1XA 2JG9B 5IK5A 1MEC1 3WNNA 4KG0A 3FLTA 2QQNA 5F3IA 2RS12 2LAUA 4NE9A 3RPGC 4CDXB 1BBT1 1GWMA 2AUYA 2NMNA 2VNOA 5B78A 4QQHA 4WM7C 1XB9A 1CZSA 3WDTA 4Y1ZA 2P5BA 1IG0A 2LS6A 3NAPC 5C6CA 3J7NA 1RMU2 4QWNA 4WVMA 3O1UA 5FKCA 3S5QA 1YHFA 2HBTA 3ACGA 2RSDA 3LF7A 2E7TA 5I93A 1TE1B 4XOGA 2YG0A 2I07B 2VUAA 2A6VA 3M7AA 4JDOA 4OYUA 4XXPA 5I0TA 4BWOA 1COV2 2GNBA 4GH4B 4GJZA 2OPKA 2TEPA 2V4AA 3D82A 2OXBA 3DL3A 2YT5A 2JIGA 1VR3A 5E88A 3IIIA 5JLVA 2XBO3 3AXEA 2ECWA 2A1XA 4UW4A 4AHZA 3L2HA 2P2KA 3ZR6A 2X53S 3LEMA 3P1IA 2E63A 1RXGA 2EIDA 2GAUA 1K5MB 4OLLA 1LEDA 3PUIA 2IWGB 3UJOA 3VDAA 3FJUB 1ZBE2 1ULCA 1A6CA 1ND2A 2N7GA 3U78A 2OS2A 2XOMA 5FQ0B 2VP7A 1Q8OA 2D8UA 5FWJA 1CR7A 2R0HA 1FMD2 1NZCA 4V3KC 4PF5A 4NRQA 1R092 3NV1A 2QTWB 3VV1A 2KR2A 5L7OB 1NXD1 4LXLA 2VULA 1LAJA 3B00A 1XE8A 2VOXA 3HMYA 3WR0A 3QD6A 3NNFA 2A6ZA 1ZM1A 2CAVA 4R4XA 3ALQA 4E9KA 4HANA 1X50A 1RUC1 4YC9A 3CQOA 1BK0A 5C5UA 5D1KB 4QM8A 3DWDA 2A73B 2VUDA 2XBO2 4HK8A 1AHSA 4M01A 4P9YA 4HKWA 2EODA 3ZPV1 2C1FA 5CKQA 1GWKA 1WW5A 4Z07A 2VTXA 1C8M3 3W59A 1ZRDA 4RS5A 2RR12 3LEKA 5G05B 1LECA 2WQ8A 3U4XA 2OX0A 3U5PA 2GMMA 1SEFA 5ACA1 2PQSA 2R061 4LUKA 4BU2A 2F6NA 1GKBA 1TME1 4X3GA 1HQLA 4M4RA 3ZFFB 3HQUA 1RUI2 1BEV1 4BQ5A 2VJEA 1J3RA 1HXS1 1LU1A 2ARXA 2GMEA 5J96B 2PNXA 2XWBB 2EIEA 3DEMA 4RA0A 4S2HA 1DGRN 3C8XA 1VBA3 3D4KA 3AP9A 2JDNA 4WVMB 1STMA 3HCSA 5FTTC 2XB1A 1XE7A 3AYAA 2HWE3 4FFIA 1ASJ2 4SBVA 4NHMA 4XURA 1UU4A 4L0PA 4AEDC 2RS33 4PI2A 3MUY1 4KGGA 1GP6A 5T5LA 1OVPA 5DMYA 3BTZA 1PO12 5FP3A 4CU8A 2VW2A 2ZHLA 5CKMA 4GB32 3ZYHA 1I5ZA 5DZFA 4I02A 1RUNA 5GZEA 4BLIA 2C24A 4URAA 5GZGA 2RM22 5FZEA 1JZ8A 1VBC3 4O9EA 3A22A 2D6PA 3PIGA 5A7WB 1YC61 3OGJA 1S2EA 1SBFA 3C7FA 4S2DA 2A3YA 3B02A 4ONUA 2ZGSA 4QHOA 3ZPOA 4COUA 4MGYE 2E7QA 4Q1PA 2B45X 1ND2B 3MV01 1VBA2 2SBAA 2ADDA 4XUOA 4CCLA 3ZM8A 1UL9A 4YBSA 3VN4A 3AMPA 4AEJA 5LEJA 4XJWA 1PVC1 1S0CA 1ZZ6A 3N9MA 4QQPA 1K3IA 1O6UA 2E51A 1SCSA 1X8EA 1QU0A 2HWE2 3GZTB 3PUAA 3OUIA 3POYA 5FXXA 3ZO0B 4XQWA 4CUCA 1QQP2 1RUG3 1SLLA 5LBEA 2RS32 1G9AA 5FLJA 2C2VS 1AR82 3R4DB 4QX3A 5FZ0A 2L0BA 4QMAA 4XE9A 1XC6A 5KXDA 1JZ2A 1RHI1 1ULPA 5JMCA 2ECNA 5B2GB 2XUEA 2B46X 2OQ7A 4CUGA 1VBC2 5I0SA 3PVEA 1DHKB 2YBSA 1LODA 1NLRA 2W47A 2DCTA 1W9WA 1NZIA 1HB1A 1RUE1 2WQ4A 3VDCA 3FAOA 2E26A 2X09A 3UYJA 1VBD1 1EP0A 5KXBA 4IGPA 5JPNB 1W90A 3BIEA 1U5YA 3KV6A 4Y22B 1JH5A 2BAYA 1QOOA 2YURA 1C28A 1KDKA 1H1MA 5AVPA 4QXKA 3S7EA 3RZMA 3TN91 3LOBA 2CRRA 1FT9A 5BNNC 4NUBA 5FK8A 5LY2A 3AB0A 3UNPA 2YHOA 5LA1A 1T2XA 1WCSA 3N9OA 3GJBA 4YVWC 4UF0A 1Y9GA 2YHJA 3I2HA 3BTAA 4COYA 1Q5OA 5FY7A 1MVEA 3K51A 2XJTA 3THPA 4S3OB 1ST8A 2EAKA 3ZPVE 1BHGA 1EAH2 2VZRA 2YZ4A 3GGLA 4Q4V3 4WM8A 1JYNA 2KGIA 2ZGPA 2WL1A 1N1TA 1RVF1 4K1YA 1N3PA 1NCQB 2G9FA 3PVOA 3JD71 3H3ZA 4GWJA 3C7EA 5JI7A 1SPPA 2Y26A 3SCHA 5JDBA 2BWAA 1YFXA 5JR7B 3UT0A 4ASKA 5JI9A 1WEWA 2W9XA 2LM3A 3CF6E 5IVEA 5B75A 3OEBA 3OPTA 4IUGA 4Q0UA 1SZBA 4NHYA 3C7HA 3WOGA 3DKWA 2LN0A 5SVIA 1XXNA 4P02B 3WG3A 4WZ0A 4XAAA 4EQVA 3HT2A 5EZWA 4IC2A 2R16A 3B94A 2GP5A 4Z0OA 1YWKA 1TNRA 5C33A 4JAAA 1AYM1 4JTOA 1WEMA 2W08A 1CJDA 3WDXA 4Q4V2 3M2MA 2W95A 4P08A 2QQLA 1DG6A 3WP3A 2VOVA 1DGRA 4DZGA 2F42A 1ALYA 4SLIA 1H1AA 4OMDA 4GMP1 1BBT3 2W52A 1PHMA 3Q9OA 4GQ7A 4YW4A 1VMJA 3D6EA 4RD7A 1GZ9A 3K75B 3O0XA 4N43A 2WRAA 3USUA 1AJKA 2A75A 5F2SA 1DQ6A 1HW5A 5H9PA 4LADB 3BOPA 4WVZA 5AFEA 4Y3OA 4FPGA 4IEWA 2KKYA 2BOJA 4OCTA 3NV4A 3VZOA 5K0UB 2QQJA 1CIWA 2HLEA 4L7XA 2VNFA 3U4SA 3EMRA 4IERA 5JUVA 4JV4A 2E31A 1NYWA 2XVGA 3MFAA 1WEUA 2EGPA 2JG8A 4Y1UA 2O8QA 5LBBA 3VDDA 3ZXDA 4IE5A 3FBYA 2YU4A 4XFGA 4CPBD 1F15A 1JOJA 3LQHA 4UF0B 3WP6A 1QMJA 4OHYA 3WVJA 1AR63 2GNTA 3O1MA 4H55A 1FATA 1H2KA 4Q5OA 4AI9A 1C1LA 4RFT0 4UW5A 4IEQA 1QDCA 2XB6C 4IEUA 5F2WA 4YSFA 5CFDC 5LCWL 1DCQA 3GZUC 2ZBJA 1F9KA 3NO8A 5TABA 2P17A 4QDSA 2YC2A 3AZWA 2WNVA 1AX0A 4Z0RA 2KA3A 3S6PA 2YC4A 3UKTA 3T9KA 3AYDA 3ZFEA 3I2IA 2FDJA 5EPAA 1S0IA 5CU1A 2E6SA 4FTBA 5JXJA 1EV12 2JG9C 3CMGA 3IAQA 4L2NA 5FZ6A 4BE3A 2RS51 1AR62 2VZ3A 1NY72 2M3HA 4XHBA 3W20A 2WO1A 4YYOA 3PUSA 1R081 3FLRA 1NAEA 4LHSA 5FZBA 3SH3A 4UYBA 2ZKNA 4ORFA 4UFMA 3RWNA 1WCDJ 1DGWX 1ZA4A 3Q8FA 5I8TA 2R6QA 1ZREA 3NNGA 2VNVA 4YZ4A 4GMP0 3WZ1A 2PXJA 3WQ0A 4FPYA 2HWB1 2R1BA 4AHWA 1WE9A 3POIA 1V6JA 4K1ZA 3EJKA 2E33A 3EB5A 1DGLA 3ZSEA 2NPIA 4GH4C 3AL6A 4CU7A 3EB6A 2E9QA 4UFJA 2G19A 3M3EA 1S2BA 1Q56A 1SFYA 4I0AA 2UU8A 3MFCA 3PUQA 3SEPA 3UGHA 2UZGA 4TSVA 3T6RA 4Q4X1 1OSGA 1DQ4A 4RQPA 1IS3A 2CY6A 3L2YA 4RR3B 2PUYA 5DZEA 2JG8B 3VDDB 5GZFA 4AAXA 3RZHA 1K5MC 2G9GA 5CAZA 3T1LA 1OD3A 3BODA 5AC93 2VZTA 1ENQA 1QOTA 1T1HA 2MPFA 1ZZ7A 2O0OA 4TKPB 4WM7A 4BQWA 4OHVA 1E5RA 2M13A 5SVXA 3N3HA 4RFRB 3CBNA 2H0BA 4GKXA 4TN7A 3T30A 1V70A 4AGGA 2LQ6A 4IEXA 3JU9A 1IZ3A 5L7OC 3AM2A 3I49A 1ZVFA 5F1RA 1FXZA 2WZR1 1LU2A 3FHAA 1PZ7A 3CU7A 4KBBA 4LK7A 2OXQC 1LESA 1A34A 1LKNA 3TAYA 2YMZA 4FPHA 4B3NA 2ENRA 5FYIA 5LKTA 3KD4A 1BJQA 2WNVB 1ZRRA 2MA5A 2DSMA 5CG8A 4KGQA 1RUF1 2WT2A 4H2AA 1ZBDB 3J7MA 1SCRA 2IQJA 1LULA 5AC92 3LVQE 4XI1A 3RGBA 4URTA 3O1PA 3SOWA 1PIV1 2BPA2 3VHNA 4MX3A 1O91A 3E6DA 4ISQA 3ZFFC 4D7SA 4GXLA 2KWJA 4N9HA 5L19A 2FD8A 2E61A 3ZN5A 4AGVA 1CESA 3VHRA 4CA9A 4XF9A 2IXKA 4C0BA 4MUVA 1G25A 3VBSA 4LKAA 1VBD3 1MQTA 2F4LA 3OUJA 4HN0A 1GANA 1NT0A 2VGDA 4RL7A 3NV2A 3VBOA 1WGMA 4UFKA 5ABJB 4KG8A 1RITA 3C7GA 4E2SA 4FTEA 4HK9A 2HWD1 1X4IA 2YU1A 4XFAA 1JZ5A 5CVRA 4LTAA 1MS1A 5T52A 5KC5A 4B8EA 2EA6A 2YC0A 1O3TA 2D3PA 4OUSA 4CU9A 4P5YA 2QZ2A 2ZX2A 1EPZA 2VOWA 4Q29A 1QGLA 3PTYA 2XPJA 5DAQA 1LOGA 1W8TA 4L97A 5F5CA 1RVF3 3FLPA 3WQ1A 2RI7A 5FY4A 1YFYA 4HT1T 2DV9A 4QX5A 2AC1A 3CJIA 4PIZA 2QE3A 5LA0A 5FOJB 2LUWA 1ND2C 2RG4A 1TZOA 2NZ9A 3IBMA 2ZAHA 3POSA 4XUPA 1Z2QA 2M85A 2CAUA 3K48A 5F5QA 5FV3A 1D4M2 1ZBA1 1LR5A 2FCTA 4UAPA 5A6YA 2LTNA 3RQ0A 5I0DA 4XAEA 5FY5A 4CRQA 1JXNA 3M3QA 2YB7A 3ZSLA 4XF1A 3O7AA 1YFWA 1NQDA 3R6SA 1H2MA 2GNDA 3VKNA 1D4VB 4AEDA 4BXSV 4GKYA 1LGBA 5B4XA 2HWC2 1WCUA 5T5PA 2MEV3 1UKGA 2XL7A 3L1XA 3C2UA 4FSJA 1MS3A 1R1A1 2Y8KA 2C4XA 4WZFA 4XF0A 5FYVA 2YW8A 3O70A 1U5IA 4Y26A 5IJRA 1MM3A 2AGSA 1ULEA 2Q1FA 3MW4A 4GMP3 3ACLA 1RTVA 2NMOA 1RUD3 2RS11 5FZOB 5FYYA 2J7MA 4M4PA 4A7YA 4FQZA 3ZN4A 2ZGNA 2ZX3A 3ES1A 5B76A 2LALA 5IAXA 2YQMA 1W8WA 5C9AB 3MW2A 3ZMNA 3AFKA 1G9DA 4XC9A 1W8ZA 4HBNA 2OT7A 1RMU1 5GLVA 3VBSB 1POV3 2BWCA 3MEPA 1MQTB 1UWWA 2L9LA 2W1UA 4LBQD 4A3XA 2ZHKA 1Q8VA 3MLLA 2RVAA 3VBOB 1RMDA 1HJFA 3LE0A 2G45A 2WWSA 4X8PA 3ZOIA 4AGRA 1CAUB 1COV1 4D6QA 5FYMA 3MIFA 2MEV2 3WF2A 1WIMA 2DX8A 2P37A 3MIEA 4S3OC 5J3XA 2YGMA 1CPNA 1NG0A 2MD8C 4YPJA 3WT3A 5C71A 2MNZA 1NCQC 4CSWA 1RUD2 1BZWA 4A7ZA 2JENA 5LASA 3ZYPA 2JX9A 3I7DA 1OQDA 2GZWA 2L75A 2ERFA 4ES9A 3NKGA 1ENSA 1ZBE1 2FDGA 3H8UA 3WUDA 4CCMA 3OGRA 4FOYA 1O3QA 3CJIB 3P6BA 5FBZA 2LV9A 5JIUA 4QDRA 3T08A 5JXIA 1URXA 5APAA 4DRRA 1FMD1 3AP7A 2R1DA 3RZZA 4V2VA 1QWRA 1R091 4DXZA 5B4NA 1RIRA 4G4FA 5FUPA 5BNNA 5BNOB 5JOWA 2Y38A 4DQAA 4B7KA 5BNQA 4GD4A 1W2NA 1W03A 2X10A 2XHKA 1BMV2 5AIUA 4KWKA 1U5ZA 2AR6A 2VZ1A 3OJBA 2XBO1 1CD3G 3WG4A 1DYOA 1UAIA 2RS53 2P34A 4BQ2A 4PF1A 2ET7A 2PHRA 4EYUA 3O12A 3WNXA 1WWYA 1MS4A 4H9DA 2XJPA 2DUOA 3JQXA 2RR11 4GNDA 1W05A 4ASMB 5FPUA 1W6PA 3V0BA 3WUCA 2DVDA 3AKTA 1FV3A 3HAGA 3V64A 2GMPA 1RUI1 4MGSA 1W2AX 3OCPA 4K8RB 1AZDA 2PHTA 5FZ3A 4DFSA 2HWB3 3KGLA 1XPWA 3KLSA 4JGZB 1Y4WA 5C7GA 5K0UC 4R9DA 1UZWA 1F4AA 3KT7A 3LVRE 1VJ2A 2ILMA 4W6XA 1BK1A 2D44A 3VD5A 2KREA 2VTXJ 3MBWA 5IYYA 5H1TA 2W0XA 2PHDA 2KD7A 1A8MA 5E89A 4BPZA 3WNKA 4R9AA 2Y1NA 1ASJ1 3RVHA 5FP7A 3WP4A 1N3QA 3FM8C 5FUNA 1HYJA 2GNMA
chains in the Genus database with same CATH topology
3CL1A 3IDBB 1AR93 1MS5A 4K20A 1DBNA 2Z42A 1MM2A 1PO11 1IPKA 4U2AA 2IFWA 4EWAA 4W6WA 3USSA 4GB31 2IXCA 2RM21 2A7AA 4I30A 1GICA 2DFCA 4BBQA 1FX5A 1DFQA 2VG9A 4XILA 4DY3A 4AYUA 4AYCA 1VBA1 4L99A 4AG4A 4WA6A 5DZGA 1JYIA 4QM9A 1Z60A 4IEPA 3SXWA 5B77A 3WQ7A 2JKBA 2HWE1 3LCPA 1JUHA 1QQP1 1MS9A 3VZNA 2KFTA 4V3LC 1AR92 2RS31 1I1EA 1D0GA 1AR81 1JW6A 2I45A 1PIV3 4PBOA 4CEYA 1OI6A 4N3WA 2RHPA 2LRIC 4XBNA 4JRAA 4KNCA 4P5HA 4LO8A 3WY6A 3ZXJA 3U5NA 1VBC1 5JSRA 4BZ4A 4Z82A 1X36A 1YIFA 3OBRA 5CG9A 3TOJA 1UU6A 3QH6A 4OI0A 4Y1XA 3V0BB 2EALA 4F83A 4XPVA 3AMQA 4YVSA 2XJQA 4QPGB 3EHKA 2VNRA 1EY2A 2HWD3 4OUMA 4XJUA 1V00A 2M6MA 2ES3A 1FYUA 4AEMA 4LBKA 2JG9A 1H30A 2WSUA 1B09A 2XUMA 4QQLA 4RR3C 1X4UA 3O33A 5JG6A 2JG8C 3VDDC 3GNEA 1VP6A 1D2QA 2EXHA 4N9IA 3AK0A 3ZMOA 4MLOA 4CDXA 5TDWA 3J8F2 3LKJA 3TNPB 3BOWA 3RI9A 1UF2C 1EAH1 1ND3A 1WD4A 4NHLA 1LJ7A 1S0FA 1WBLA 1KJLA 1MZ5A 2ZOEB 2CNAA 1VBE3 1AYN3 2KGGA 4Y20A 1F8VA 1S55A 1ZBA3 2PAKA 2C0ZA 2JECA 4YG0A 4CP2A 2ECJA 4GH4A 5BNPB 1DVPA 2DWRA 4HMZA 2DVFA 2WNVC 1XU2A 3LA3A 2WZPP 3SLIA 1Q3EA 2FZ1A 4AHYA 4YZ2A 2XJVA 4R52A 2CGPA 3JQWA 2DCKA 2BNMA 2Q5TA 3FZ3A 3NKTA 3V43A 3JB4C 4UP0A 2OZJA 4HVQA 4N7IA 1R1A3 4Q4V1 4AXOA 2YUEA 4WVWA 4YARA 1CAXB 1OA3A 2G4IA 2LGKA 2AZ5A 1FPN2 4OFGA 5JIAA 1BORA 1LDJB 5TRBA 2JD4A 2LXPC 2RS13 1VBE2 1AYN2 4CEYB 4IV1A 2FBEA 3AKPA 4FXKB 4LHNA 1R1ZA 5CNAA 2CTVA 2ZJCA 2QJVA 2IXHA 3GYDA 2PHLA 5ABJC 3MPPG 2DU1A 3MI8A 4P9JA 2LGLA 1V6MA 5IK8A 3O0VA 1YRZA 4YVSB 1UCXA 4Q8LA 4I7DA 1S0DA 1W6NA 2WFF2 3VBRB 1U12A 1WEPA 3UKVA 3IWZA 3WD5A 3LA7A 1A3KA 1COV3 3AMNA 3TWIA 1ONAA 2WINB 3W9AA 1HV1A 3AZVA 4RQPC 5C4WA 5JOZA 4Q4W3 4XJAA 2KWOA 1MZEA 1QJX3 5CBLA 1QH7A 4M00A 3RSJA 1ENXA 2A6YA 3ZFFA 2K17A 4XW3A 3U0ZA 5BPXA 4BH9A 2ZETC 1OA4A 5BY5A 1ZBE3 3B3QE 1ND3B 5I91A 2BW8A 1S2KA 1JYCA 1IKPA 1FMD3 1R093 4CP0A 3JCIA 4Y20B 3ELNA 1H0BA 3DF0A 3PHMA 4K21A 5CFCA 4AVXA 2CT2A 2UYBA 2B5HA 3CJXA 1HIXA 4NWWA 4YW5A 3I2DA 4E27A 4R8PK 4IEZA 4Q4W2 2KR4A 1QJX2 4XJZA 1EV11 4AVVA 3T7LA 1OKQA 1GLHA 1FV2A 2VXRA 1AR61 2RR13 4XFIA 1NY71 5J3UA 4YAXA 1XRUA 1PNGA 4YRDA 2QNKA 3B9CA 1DYKA 5C9AC 4O64A 1RUI3 4IV1B 2KXLA 3VBSC 4FPEA 1MQTC 2XJUA 2ZACA 3VBOC 1C3HA 2X5IB 4M3CF 3E6CC 3OF1A 4L8QA 4YM2A 2VMHA 2GSYA 1W6NB 2HYED 4KU8A 1ASJ3 3ECQA 3UK9A 3VBFA 5FREA 5AITA 1PO13 1O4TA 4LK9A 5C4WB 2XLGA 4GB33 2HKXA 4JRLA 2RM23 3CJIC 5KHJA 3MZHA 4FK5A 2R0FA 4Y22A 2Q0AA 5JZGA 1JOCA 4G9SB 1YFUA 3JBG2 4Q0SA 3AMMA 3ZYJB 2XGXA 4L9BA 3NG2A 3ZFGA 3OGGA 3ZYIB 5FERA 1AX1A 2DTYA 4MV2A 4XEZA 1QQP3 5CFCB 3KQIA 1AR83 1GQHA 3SHBA 1JUIA 1Z7S2 1NCQA 3M3IA 2C5DA 1KFXL 5AC91 3SHRA 1G7YA 2MIQA 2RE9A 4J1WA 4DMIA 2VW1A 1NQJA 1GBGA 4BYYA 4AVBA 1WD3A 4OI2A 1HLCA 2K2SA 3L11A 4XTMA 2ZGMA 4JGZC 2MT5A 3L1ZB 1DZTA 2IXIA 5FDBA 2PA7A 1LOCA 1RJ7A 4FPFA 2GN3A 4JDNA 1KITA 4Y1YA 4P9IA 1VB4A 1BXHA 1WEVA 4YADA 3O35A 2HDPA 2I2SA 3O34A 1ENRA 2FZ2A 2ZGTA 3HR9A 3OD4A 4JTNA 2WT1A 1EPWA 2DUQA 1EAH3 1H1IA 3VBFB 1GR3A 5JOYA 2X29A 4H14A 2VQAA 1GNZA 4HN1A 5EYXA 3ZXFA 5FPXA 2ZGOA 1H9PA 4WV8A 1J3PA 3ASIA 2I50A 3I59A 4LBNA 1VD4A 5HCAA 4COVA 4OHWA 5GALA 5K0UA 2UURA 2QZ3A 4L58A 5JZGB 1HKDA 1D4M1 2Q4SA 1W39A 3KCYA 2A70A 4BOWA 4DRVA 4ASLA 5JPMB 3ZFGB 4OZXA 3M4FA 4H7LA 2HJIA 4R8HA 5IK4A 2HWC1 1MZFA 2PHFA 3CNAA 1GZWA 2ECIA 2VH9A 4LHKA 3AZYA 3VKOA 2OZ6A 1C5IA 2YV8A 4QT6A 3D8CA 3WHUA 2R073 4AFMA 3FJSA 5DDJ2 2KU3A 1VFYA 1ZZCA 1LHVA 1VBB2 2R32A 2YYOA 4O9GA 4QPGC 3RJRA 4PJYA 4HSLA 5B8DA 3PHDA 2OUJA 2LDRA 1DLLA 1RUH2 1G8WA 4EN7B 1A8DA 4CP1A 2YGLA 1FOD2 1G9CA 3WHTA 3N9NA 1O4ZA 1REDA 4X6QB 4LO7A 1WCKA 2MHFA 3MLKA 2MEV1 3ZSKA 2WIIB 1PGW2 1F5FA 3SMHA 1CN1A 1SDWA 2PLV3 3ROUA 3AZZA 1J58A 3ZIWA 4YFZA 4HLTA 1RUD1 3ZYGA 2R072 3QZVA 1CONA 1WESA 1LOFC 2LXHC 4XTPA 4AWDA 3M99A 5D1IA 3PJYA 5KHGA 2DTWA 2XVLA 2HWF2 5BNPC 1AF9A 3I59B 4GA9A 1POV1 1W6MB 3OBTA 2BBVA 4H7MA 1VAMA 2IXLA 4RR3A 5KC6A 1QJZA 1BMV1 1GSLA 1EV13 3EO6A 4CA1A 4Q26A 5A3LA 5D1LB 5C11A 1BQPA 2PLV2 4FPOB 4P5OB 4CEYC 2BNNA 2WNUA 2B8MA 2UY9A 1GZWB 2G43A 1V9U2 1VB2A 1WW4A 3KS7A 4HL0A 4PLOA 3OTFA 3H9AA 5AVAA 4R2YA 5DXDA 4YVSC 3VBRC 1QKQA 3POWA 3AKRA 4TZDA 1WA4A 2GALA 5GKAC 3GZAA 1PGSA 2NAAA 3C5KA 3AZXA 2FQPA 2UWBA 5G0FA 1S0GA 2Y0IA 4CYDA 1Y9QA 5IK7A 2CYFA 1FBVA 5DINA 4OVEA 2E6VA 2V73A 2M1RA 4YG6A 4CDXC 3O37A 3DPLR 4LE3A 1CQ9A 1CAVB 4YW2A 4QQ2A 3FC0A 1LOAA 1ND3C 3D0JA 1N87A 4YM0A 3CEWA 3VZJA 2OVUA 2VY0A 1KFUL 2RJLA 5EXOA 4GULA 4OI1A 2D6OX 5ABJA 5DUXA 4N53A 1UMZA 2GC3A 3W58A 3HWJA 3KMHA 1X82A 4L92A 5K9YA 3N36A 3LB9A 2V5YA 1U0AA 3PJQA 1N47A 3QACA 3AJZA 2FUUA 4RSUA 3ZYQA 1POV0 1UW8A 5L36A 1ULDA 1SMVA 4XJ8A 1G86A 4LBQB 4PDWA 1AR91 1NCRB 1PZ8A 3M3OA 2BFUL 3OY8A 4MGIE 1WENA 4GALA 3A0KA 2KWKA 5J7MA 1QJY2 1I9RA 2QQPA 1LTEA 4XFCA 3FFZA 4IV1C 1UPSA 2WNUB 3V0AB 3M63A 1KS5A 4XQ4A 5EFUA 5GJ6A 1WEEA 2YXSA 3GBWA 4KH9A 1UN1A 2X5IC 3QCWA 4F52B 2VW0A 4GIQA 4WBBA 1TQ5A 1PO22 1X33A 3KGZA 2VVFA 5TDRA 4AVTA 1V6IA 1YO8A 5D8AA 5F6LB 3VBHA 5C4WC 3C6WA 2Q8OA 5LKUA 5L73A 3J8F1 4C1WA 2MUMA 2ZGQA 5KHHA 4LHLA 1AL23 2WLQA 5C9AA 4FQ4A 2ATFA 4G3YC 5HI0A 4V1PA 3NSTA 2D93A 1DZRA 2YHNA 4B86C 4FOVA 4YABA 1AR72 2I74A 2V09A 3MW3A 1ZRFA 2VPGA 4FVVA 2CKLA 3D0SA 4S2FA 1D4M3 1HRV3 1QXRA 1Y7BA 3KQRA 4N53B 4AEKA 2E6RA 3N9PA 1HYIA 1CAUA 3P3NA 2QICA 3EQEA 5FB0A 1KXGA 1MACA 5CFCC 1E4UA 2WLPA 2QJ0A 4CZSA 1S0EA 3X29B 4FO9A 1C8NA 2L80A 2D6LX 2HWC3 4UXAA 4XYXA 3LSEA 3ZYRA 4AFCA 4INDA 5KXCA 4PDWB 1AL22 1H8VA 2ZMNA 3OY8B 1FPN1 1NXMA 1VBE1 1AYN1 1QDOA 2WT0A 1REFA 3LZZA 1IS6A 2XL9A 3PLQA 4KQ7A 4Q27A 1IKQA 1HRV2 4LT5A 3N35A 5LCWB 2IXJA 3FHIB 4QF3A 5BYNA 4QGMA 5T54A 4YM3A 1ZZBA 3DN7A 2BEOA 3N9QA 4YGCA 3NWKA 2WFF1 4F7ZA 3H7YA 3APBA 4CDUB 2XEUA 4GNFA 4I7BA 4MSXA 1XNKA 4AK3A 4BCUA 3M1HA 4E2QA 2D8SA 3VBFC 2QDNA 1PM7A 3B69A 5D8AB 1V6KA 3VBHB 3S0MA 5KH3A 1XNBA 5GLZA 4WZ2A 4Q1RA 4JGZA 1BCXA 3LAGA 4K3UA 1N3OA 5I8SA 5JZGC 3O0WA 2WA4A 1LHWA 4CDQB 1PK6A 1OFSA 1VALA 4ZKTB 1TEIA 1W6QA 4JQRA 4LNVA 2CKLB 1LEMA 3FE5A 3ZFGC 4EV0A 4YGDA 4IEOA 4MH0E 1XNCA 3RRDA 4DS0A 5FOBB 5KH9A 5KH7A 4F3JA 4Q4W1 4X8NA 5FPZA 5J09A 4COZA 1QJX1 3H3UA 3B9IA 4LLFA 1F5JA 2FMYA 3OD0A 4IXLA 2UY8A 1OQEA 3WCSA 1AXZA 1I6XA 2XLAA 4IESA 2VPVA 3ZN6B 5J37A 2R043 4C0HA 2YSJA 1OMIA 3A0NA 5FRAA 1VAVA 4YGBA 5T3NA 2GU9A 3LOIA 1GV9A 1U5XA 2TNFA 1S1AA 2EXKA 4DPNA 3G7DA 5DUUA 2MNYA 1OLQA 4AI2A 3IMNA 2ZHNA 3AP6A 4D69A 2R49A 1SLBA 5AFBA 4AHXA 3IN9A 4QGLA 2VMGA 3L9JT 5FLIA 4EJRA 4XBLA 2AH2A 1RUJ2 2H0VA 5A33A 1OLRA 4LO5B 1PGL2 4WZ3B 4GB0A 1QJU2 5GLTA 3O36A 4PQ9A 2R042 4M0HA 2A3XA 2A71A 4E4SA 1G6NA 2GC2A 2F4PA 3LA2A 4AI1A 4AQTA 4QPGA 1HDKA 5BV6A 3M3CA 1X8MA 4M3CB 3R4SA 2ZA9A 2QKDA 5HBAA 5I0UA 3U10A 3JBG1 1G9BA 2ZZQA 3BALA 2ECGA 1PK6B 4NOTA 2QIZA 1E57A 2Z69A 1W6QB 1NE6A 1VRH2 1M06G 4DINB 4FAHA 4DOUA 1YXWA 4AQ6A 2Q1MA 1PNFA 2OA2A 2WJSA 2JRJA 1M4WA 1CX4A 1MS8A 5BNOA 1Z7S1 3GHMA 2JE7A 1BKZA 1Z78A 1LOFA 2R30A 5H9SA 2MNGA 2WFPA 3HTKC 1TMF3 3S30A 3HQXA 5GZDA 4B4RA 4CEWB 3WCRA 5BNPA 3ZXLA 1WEQA 4META 3ST7A 2QVSB 2JEMA 3VL9A 3B7MA 5LKZA 1N1VA 4YZ3A 2UWAA 3N4MA 2XJRA 1SLAA 3PMSA 4AFAA 2GN7A 2EVXA 5H1UA 1CAXA 4I3GA 4RHV3 3URFA 2E7AA 4FJCA 3SH5A 3NVCA 3ES4A 3KB5A 4Q0QA 5A33B 3J8F3 4LO6B 4FPKA 4YG3A 4YBTA 1SBDA 1ZZ9A 1TMF2 3ENRA 1Z6UA 1Q43A 2VUJA 2DFBA 3SITA 3ZVZB 2QDRA 3AJYA 5LRSA 4FP3A 3VBRA 2BVVA 3RYKA 4K9SA 4LEJA 2PYTA 5KBFA 1AX2A 5A32A 1DYPA 1CVNA 4RHV2 4UW6A 3NL1A 1NCRC 3I54A 2ETEA 4TYSA 1J3QA 1NLSA 4JGYB 2XJSA 1RGSA 1MS0A 4LJNA 3GF6A 2L5UA 4B7YC 1MZ6A 1QF3A 1WBFA 1YNAA 1AJOA 1OA2A 4KU7A 2VECA 2WNUC 1FPN3 3UKNA 1DIWA 4FXGB 4BA6A 4LUMA 3MF6A 3IPVB 3VHPA 1WMEA 5HXVA 4PIXA 5C8CB 5K7PA 1RUOA 5DDJ1 3KNVA 1VBB1 1O3RA 3HT1A 5HCBA 3R4UA 1ZNPA 1RUH1 3MLJA 4AI3A 2WFF3 1FOD1 4K8FA 2BVBA 2W68A 3LGRA 2OIIA 1KS4A 1XYPA 2ZX0A 4AI8A 2BUKA 3MHHA 1XWHA 3ZDSA 1BVVA 1X7NA 1LB2A 3VGIA 2Y43A 1PGW1 4MXWA 4AVCA 1CGPA 2NQYA 2F6JA 1O3SA 4PCRA 2R071 5JVVA 1J59A 2PHWA 4YBSA 5T5OA 1H8TA 5FO8B 4RGGA 1LGCA 4N53C 1V6OA 2X5IA 2DURA 1EYBA 4YFWA 3B01A 4HFSA 4CDWA 2HWF1 4I0BA 1WEOA 2G6QA 2WKKA 4RGAA 1Z0HA 5LK7B 4FPCA 4OHZA 1Y3TA 2WS93 4Q0VA 1IGOA 2ZMKA 1WW7A 5A32B 3O5SA 4LA2A 4PDWC 2LGVA 5LEKA 1DQ1A 4LO4B 1T6GC 4BIOA 4EWEA 2PLV1 3E6BA 4IQPA 2TBVA 3ASLA 1REEA 5C8WA 2ZS6B 3AX4A 2XKPA 3ILNA 1V9U1 2YYRA 3VBUB 3CO2A 3B5LB 4P9GA 2ZHMA 4B4PA 3VHOA 2WS92 4CDUC 1UU5A 1BVP1 2VPDA 4EN8B 3WW3A 3D5OA 3EXUA 5E8AA 1DQ5A 4FOQA 4I01A 4IV3B 4QGNA 2K4DA 4FTSA 3DPRA 2D97A 3ZXKA 1KJRA 5D8AC 3VBHC 3MPBA 2D3SA 4QHBA 1FAYA 2GC1A 3GL6A 4ISRA 4MXVA 4W65A 4BHWA 3HN1A 5BXXA 4MXWB 5CA6A 1UPIA 3CLPA 4PPEA 4CDQC 3OYWB 4E4DX 1NA1B 1HX6A 3TRSB 1H8TB 3JBG3 2GH8A 3LWCA 3PNAA 3FUOA 1H2NA 1HQNA 4CDWB 5I3LA 2L43A 3RG0A 1LHOA 4BMEA 2A3WA 1DGWA 3EBRA 1XNDA 5FAXA 3ZSMA 4UBHA 2VMIA 4Q4Y3 4C1XA 1ZRCA 4AVAA 1Z7S3 3WDYA 3ZXGA 4IEYA 3H50A 4DNYA 3IKWA 2OW4A 5EYAF 3KV5A 2PQQA 1QJY1 1VLNA 2AYHA 4LBJA 3IDCB 4U36A 3UL2A 3AYCA 3WDUA 5H9QA 4UW3A 1S0JA 2JJ6A