5C13A

Crystal structure of taf3 phd finger bound to histone h3c4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 3
publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 59
sequence length 59
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c13A00
2LQ6A 3ZYQA 1HYJA 1WEMA 2JMDA 3IHPA 3MHHA 5TABA 3MHSA 2KR4A 2HDPA 5DKAA 1X4JA 4Q6FA 1HYIA 2K17A 2DX8A 2BAYA 4FK5A 4FO9A 3T6RA 2VPBA 2Y43A 4WZ2A 1ZBDB 1JM7A 3KV6A 2PNXA 2H0DA 3RPGC 3N9MA 3HCUA 4UP5A 4AYCB 4I7DA 5H1UA 4BBQA 3QZVA 2KU3A 4WA6A 4MSXA 2LGKA 4A49A 4GB0A 3PUQA 2CKLB 2EA6A 5KH9A 5G0FA 2LN0A 1E4UA 3GL6A 2QIZA 3O35A 3HTKC 4S3OC 2LGLA 3M63A 4FIPA 5DINA 2EGPA 2K4DA 2XEUA 2ECGA 2M1RA 2KWNA 2L80A 3SOWA 3KNVA 1DVPA 4AYCA 3O7AA 2UZGA 4B7YC 3ASLA 2YURA 2K1JA 2L5UA 2KWKA 2LRIC 3DPLR 3EB5A 4YATA 2CKLA 3M99A 2MA5A 1WEEA 2MNZA 1WESA 1X4UA 1RMDA 5LKTA 3ZVYA 5J3XA 4B86C 3U5OA 2L43A 2YHNA 4X3GA 3PURA 4R2YA 5H1TA 4C9ZA 4W4UA 4YC9A 2G45A 3FL2A 2JRJA 1Z60A 4YBSA 4A4CA 4GNFA 1WEVA 2F6NA 3ZNIA 4UP0A 1LDJB 3O36A 2YREA 4I7CA 1WEPA 2ECTA 4ZUXU 1XWHA 2FUIA 5TRBA 3HCSA 1MM3A 1BORA 3SHBA 2LXPC 2EODA 2HYED 2QICA 5B78A 3V43A 5LKZA 3KV5A 2LV9A 1U6GB 1WEUA 2M3HA 5B75A 2YQLA 2YT5A 1WIMA 1V87A 2M85A 3LRQA 3C5KA 5KH7A 3KQIA 2VJEB 3PHDA 2G43A 2JMIA 4CA1A 1WEWA 4CCGX 4FJCA 2CT2A 3O34A 2VNFA 2L75A 2XB1A 2OXQC 5JG6A 1WEOA 1Z6UA 4ZQLA 2KIZA 5TBNA 3O70A 2YUCA 4LADB 3ZTGA 4WZ3B 3LQJA 4QF3A 4LK9A 2VPDA 5FERA 5EYAF 1WENA 2AN6A 3N9NA 5G04B 4AUQB 4GNGA 4QF2A 5TDRA 5FEYA 1MM2A 4N3WA 2YU4A 2LGVA 2E6RA 4TKPB 2VP7A 3LQHA 2F6JA 4LLBA 1CHCA 1LDKC 4L58A 2FSAA 2VJEA 2YSMA 3N9PA 3U5MA 4A0CD 2KWOA 2QJ0A 4N4FA 2ECNA 1K2FA 2JMJA 2VPEA 2ECIA 3ZVZB 4I7BA 4BHWA 2KYUA 5B79A 1WFKA 2E6SA 4P5OB 4IC2A 3NG2A 2YHOA 4YABA 4V3LC 2RI7A 3RTRB 4UI9B 5LKXA 1X4IA 3LQIA 4GNDA 2G6QA 4O64A 2NAAA 3EB6A 2Y1MA 2K16A 2MA6A 2YQMA 3O33A 2MNYA 5C13A 5D1LB 3GV4A 4AP4A 2KE1A 5FB0A 5G05B 2VJFB 4L7XA 3C6WA 2KWJA 2KGIA 5AITA 2M6MA 3U5PA 3VK6A 3N9LA 2D8SA 4YBTA 1F62A 2YYRA 3N9OA 1JOCA 3T7LA 2KFTA 4ZDTA 2LGGA 4F52B 3N9QA 3M62A 5H9MA 1FP0A 3L1ZB 5AIUA 4LJNA 1WEQA 4NN2A 5LKUA 2KGGA 1G25A 2KREA 4YADA 4PTBA 2VJFA 3ZPV1 5B8DA 2C2VS 4V3KC 2YW8A 4GNEA 5D1KB 1WILA 2C2LA 2PUYA 2ECVA 2ZETC 2ECJA 5D1MB 2MUMA 1N87A 3I2DA 1WGMA 2L0BA 3L1XA 4LKAA 4AVXA 4WZ0A 1T1HA 2F42A 1VYXA 2MT5A 4R7EA 4YBMA 3L11A 2I50A 2MIQA 3RPGB 4IC3A 3SOUA 5H1VA 4A4BA 3DQVR 3SOXA 2MD7B 2ECWA 2MD8C 3O37A 1FBVA 5B77A 5I3LA 2VPGA 2Y1NA 1VFYA 2LDRA 1IYMA 2LXHC 4XI1A 2FUUA 4S3OB 3HCTA 4MVTA 5TDWA 2RSDA 5LCWB 1JM7B 4YAXA 5FB1A 3ZPVE 1VD4A 5C11A 2H0DB 5KH3A 5B76A 2YSJA 2IDAA 3U5NA 2CSZA 1WE9A 1Z2QA 4PPEA 2CSYA 4R8PK
chains in the Genus database with same CATH superfamily
2LQ6A 3ZYQA 2JM3A 1HYJA 1WEMA 2JMDA 3IHPA 3MHHA 5TABA 3MHSA 2KR4A 2HDPA 5DKAA 1X4JA 4Q6FA 1HYIA 2K17A 2DX8A 2BAYA 4FK5A 4FO9A 3T6RA 2VPBA 2Y43A 4WZ2A 1ZBDB 1JM7A 2KKXA 3KV6A 2PNXA 2H0DA 2IQJA 3RPGC 3N9MA 3HCUA 4UP5A 4AYCB 4I7DA 5H1UA 4BBQA 2YVRA 3QZVA 2DSMA 2KU3A 4WA6A 4MSXA 2LGKA 4A49A 4GB0A 3PUQA 2CKLB 2EA6A 5KH9A 5G0FA 2XOZA 2LN0A 1E4UA 3GL6A 3LDYA 2QIZA 3O35A 3HTKC 4S3OC 2LGLA 3M63A 2MKEA 4FIPA 5DINA 2EGPA 2K4DA 2XEUA 2ECGA 2M1RA 2KWNA 2L80A 4OGEA 2OWAA 3SOWA 3KNVA 5SVYA 1DVPA 4AYCA 3O7AA 2UZGA 4B7YC 3ASLA 3KDEC 2YURA 2K1JA 2L5UA 2KWKA 2LRIC 3DPLR 3EB5A 4YATA 2CKLA 3M99A 2MA5A 1WEEA 2MNZA 1WESA 1X4UA 1RMDA 5LKTA 3ZVYA 5J3XA 4B86C 2P57A 3U5OA 2L43A 2XP0A 2YHNA 4X3GA 3PURA 4R2YA 5H1TA 4C9ZA 4W4UA 4YC9A 2G45A 3FL2A 2JRJA 1Z60A 4YBSA 4A4CA 4F1PA 3FJUB 2JUNA 4GNFA 1WEVA 2F6NA 3ZNIA 3O47A 4UP0A 1LDJB 3O36A 2YREA 4I7CA 4H9DA 1WEPA 2ECTA 4ZUXU 1XWHA 2FUIA 5TRBA 3MDBC 3HCSA 1MM3A 1BORA 3SHBA 2LXPC 2EODA 3SUBA 4O62A 2CRRA 2HYED 2CSVA 2QICA 5B78A 3V43A 5LKZA 2CRWA 3KV5A 2LV9A 1U6GB 1WEUA 2M3HA 3PLWA 5B75A 2YQLA 2YT5A 3H7HA 1WIMA 1V87A 2M85A 3LRQA 3C5KA 5KH7A 3KQIA 4Z0OA 2VJEB 3PHDA 2G43A 4OGCA 2JMIA 4CA1A 1WEWA 4CCGX 4FJCA 2CT2A 3O34A 2VNFA 2L75A 1MBMA 2XB1A 2OXQC 5JG6A 2FD4A 1WEOA 1Z6UA 4ZQLA 2KIZA 5TBNA 3O70A 2YUCA 4LADB 3ZTGA 4WZ3B 3LQJA 4QF3A 4LK9A 2VPDA 5FERA 5EYAF 1WENA 2B0OE 2AN6A 3N9NA 5G04B 4AUQB 4GNGA 4QF2A 5TDRA 3M7KA 5FEYA 1MM2A 4N3WA 2YU4A 2LGVA 2E6RA 4TKPB 2VP7A 3LQHA 2F6JA 4LLBA 1CHCA 1LDKC 4L58A 2FSAA 2VJEA 2YSMA 3N9PA 3U5MA 4A0CD 2KWOA 2QJ0A 4N4FA 3FEHA 2ECNA 1K2FA 2JMJA 2VPEA 2ECIA 3ZVZB 4I7BA 4BHWA 2KYUA 5B79A 1WFKA 2E6SA 4P5OB 2FFWA 4IC2A 2XOYA 3NG2A 2YHOA 4YABA 4V3LC 2RI7A 3RTRB 4UI9B 5LKXA 1X4IA 3LQIA 4GNDA 2G6QA 4O64A 2NAAA 3EB6A 3T9KA 2Y1MA 2K16A 2MA6A 2YQMA 3O33A 3LVRE 2MNYA 2LAUA 5C13A 5D1LB 3FM8C 3Q1DA 3GV4A 4AP4A 3LJUX 2RR4A 2KE1A 5FB0A 5G05B 2VJFB 4L7XA 3C6WA 2KWJA 2KGIA 3LVQE 5AITA 2M6MA 3U5PA 3VK6A 3N9LA 2D8SA 4YBTA 1F62A 2YYRA 3N9OA 1JOCA 3T7LA 2KFTA 4ZDTA 2LGGA 4F52B 3N9QA 3M62A 5H9MA 4QQ4A 1FP0A 2L7PA 3L1ZB 5AIUA 4LJNA 4Z0RA 1WEQA 4NN2A 5LKUA 2KGGA 5SVXA 1G25A 2KREA 4YADA 3DWDA 4PTBA 2VJFA 3ZPV1 5B8DA 2C2VS 4V3KC 2YW8A 4GNEA 3FANA 2CONA 2KKYA 5SVIA 3E2DA 5D1KB 2DJAA 1WILA 2M13A 2C2LA 2PUYA 2ECVA 2ZETC 2ECJA 5D1MB 2MUMA 1N87A 3I2DA 1WGMA 2L0BA 4LKAA 3L1XA 4AVXA 3FAOA 4WZ0A 1T1HA 2F42A 1VYXA 2MT5A 4R7EA 4YBMA 3L11A 2I50A 2MIQA 3RPGB 4IC3A 3SOUA 5H1VA 4A4BA 3DQVR 3SOXA 2MD7B 2ECWA 2MD8C 3O37A 1FBVA 5B77A 5I3LA 2VPGA 2Y1NA 1VFYA 2EGMA 2D8UA 2LDRA 1IYMA 2LXHC 3JUEA 4XI1A 2FUUA 4S3OB 3HCTA 4MVTA 5TDWA 2RSDA 5LCWB 1DCQA 1JM7B 4YAXA 5FB1A 3ZPVE 1VD4A 2EXUA 5C11A 2H0DB 5KH3A 5B76A 2YSJA 2IDAA 3U5NA 5SVIB 2CSZA 3DDTA 2E61A 2XOCA 1WE9A 1Z2QA 4PPEA 5K3QA 2CSYA 4R8PK
chains in the Genus database with same CATH topology
2LQ6A 3ZYQA 1HYJA 1WEMA 2JMDA 3IHPA 3MHHA 5TABA 3MHSA 2KR4A 2HDPA 5DKAA 1X4JA 4Q6FA 1HYIA 2K17A 2DX8A 2BAYA 4FK5A 4FO9A 3T6RA 2VPBA 2Y43A 4WZ2A 1ZBDB 1JM7A 3KV6A 2PNXA 2H0DA 3RPGC 3N9MA 3HCUA 4UP5A 4AYCB 4I7DA 5H1UA 4BBQA 3QZVA 2KU3A 4WA6A 4MSXA 2LGKA 4A49A 4GB0A 3PUQA 2CKLB 2EA6A 5KH9A 5G0FA 2LN0A 1E4UA 3GL6A 2QIZA 3O35A 3HTKC 4S3OC 2LGLA 3M63A 4FIPA 5DINA 2EGPA 2K4DA 2XEUA 2ECGA 2M1RA 2KWNA 2L80A 3SOWA 3KNVA 1DVPA 4AYCA 3O7AA 2UZGA 4B7YC 3ASLA 2YURA 2K1JA 2L5UA 2KWKA 2LRIC 3DPLR 3EB5A 4YATA 2CKLA 3M99A 2MA5A 1WEEA 2MNZA 1WESA 1X4UA 1RMDA 5LKTA 3ZVYA 5J3XA 4B86C 3U5OA 2L43A 2YHNA 4X3GA 3PURA 4R2YA 5H1TA 4C9ZA 4W4UA 4YC9A 2G45A 3FL2A 2JRJA 1Z60A 4YBSA 4A4CA 4GNFA 1WEVA 2F6NA 3ZNIA 4UP0A 1LDJB 3O36A 2YREA 4I7CA 1WEPA 2ECTA 4ZUXU 1XWHA 2FUIA 5TRBA 3HCSA 1MM3A 1BORA 3SHBA 2LXPC 2EODA 2HYED 2QICA 5B78A 3V43A 5LKZA 3KV5A 2LV9A 1U6GB 1WEUA 2M3HA 5B75A 2YQLA 2YT5A 1WIMA 1V87A 2M85A 3LRQA 3C5KA 5KH7A 3KQIA 2VJEB 3PHDA 2G43A 2JMIA 4CA1A 1WEWA 4CCGX 4FJCA 2CT2A 3O34A 2VNFA 2L75A 2XB1A 2OXQC 5JG6A 1WEOA 1Z6UA 4ZQLA 2KIZA 5TBNA 3O70A 2YUCA 4LADB 3ZTGA 4WZ3B 3LQJA 4QF3A 4LK9A 2VPDA 5FERA 5EYAF 1WENA 2AN6A 3N9NA 5G04B 4AUQB 4GNGA 4QF2A 5TDRA 5FEYA 1MM2A 4N3WA 2YU4A 2LGVA 2E6RA 4TKPB 2VP7A 3LQHA 2F6JA 4LLBA 1CHCA 1LDKC 4L58A 2FSAA 2VJEA 2YSMA 3N9PA 3U5MA 4A0CD 2KWOA 2QJ0A 4N4FA 2ECNA 1K2FA 2JMJA 2VPEA 2ECIA 3ZVZB 4I7BA 4BHWA 2KYUA 5B79A 1WFKA 2E6SA 4P5OB 4IC2A 3NG2A 2YHOA 4YABA 4V3LC 2RI7A 3RTRB 4UI9B 5LKXA 1X4IA 3LQIA 4GNDA 2G6QA 4O64A 2NAAA 3EB6A 2Y1MA 2K16A 2MA6A 2YQMA 3O33A 2MNYA 5C13A 5D1LB 3GV4A 4AP4A 2KE1A 5FB0A 5G05B 2VJFB 4L7XA 3C6WA 2KWJA 2KGIA 5AITA 2M6MA 3U5PA 3VK6A 3N9LA 2D8SA 4YBTA 1F62A 2YYRA 3N9OA 1JOCA 3T7LA 2KFTA 4ZDTA 2LGGA 4F52B 3N9QA 3M62A 5H9MA 1FP0A 3L1ZB 5AIUA 4LJNA 1WEQA 4NN2A 5LKUA 2KGGA 1G25A 2KREA 4YADA 4PTBA 2VJFA 3ZPV1 5B8DA 2C2VS 4V3KC 2YW8A 4GNEA 5D1KB 1WILA 2C2LA 2PUYA 2ECVA 2ZETC 2ECJA 5D1MB 2MUMA 1N87A 3I2DA 1WGMA 2L0BA 3L1XA 4LKAA 4AVXA 4WZ0A 1T1HA 2F42A 1VYXA 2MT5A 4R7EA 4YBMA 3L11A 2I50A 2MIQA 3RPGB 4IC3A 3SOUA 5H1VA 4A4BA 3DQVR 3SOXA 2MD7B 2ECWA 2MD8C 3O37A 1FBVA 5B77A 5I3LA 2VPGA 2Y1NA 1VFYA 2LDRA 1IYMA 2LXHC 4XI1A 2FUUA 4S3OB 3HCTA 4MVTA 5TDWA 2RSDA 5LCWB 1JM7B 4YAXA 5FB1A 3ZPVE 1VD4A 5C11A 2H0DB 5KH3A 5B76A 2YSJA 2IDAA 3U5NA 2CSZA 1WE9A 1Z2QA 4PPEA 2CSYA 4R8PK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQ6 A;  3ZYQ A;  1HYJ A;  1WEM A;  2JMD A;  3IHP A;  3MHH A;  5TAB A;  3MHS A;  2KR4 A;  2HDP A;  5DKA A;  1X4J A;  4Q6F A;  1HYI A;  2K17 A;  2DX8 A;  2BAY A;  4FK5 A;  4FO9 A;  3T6R A;  2VPB A;  2Y43 A;  4WZ2 A;  1ZBD B;  1JM7 A;  3KV6 A;  2PNX A;  2H0D A;  3RPG C;  3N9M A;  3HCU A;  4UP5 A;  4AYC B;  4I7D A;  5H1U A;  4BBQ A;  3QZV A;  2KU3 A;  4WA6 A;  4MSX A;  2LGK A;  4A49 A;  4GB0 A;  3PUQ A;  2CKL B;  2EA6 A;  5KH9 A;  5G0F A;  2LN0 A;  1E4U A;  3GL6 A;  2QIZ A;  3O35 A;  3HTK C;  4S3O C;  2LGL A;  3M63 A;  4FIP A;  5DIN A;  2EGP A;  2K4D A;  2XEU A;  2ECG A;  2M1R A;  2KWN A;  2L80 A;  3SOW A;  3KNV A;  1DVP A;  4AYC A;  3O7A A;  2UZG A;  4B7Y C;  3ASL A;  2YUR A;  2K1J A;  2L5U A;  2KWK A;  2LRI C;  3DPL R;  3EB5 A;  4YAT A;  2CKL A;  3M99 A;  2MA5 A;  1WEE A;  2MNZ A;  1WES A;  1X4U A;  1RMD A;  5LKT A;  3ZVY A;  5J3X A;  4B86 C;  3U5O A;  2L43 A;  2YHN A;  4X3G A;  3PUR A;  4R2Y A;  5H1T A;  4C9Z A;  4W4U A;  4YC9 A;  2G45 A;  3FL2 A;  2JRJ A;  1Z60 A;  4YBS A;  4A4C A;  4GNF A;  1WEV A;  2F6N A;  3ZNI A;  4UP0 A;  1LDJ B;  3O36 A;  2YRE A;  4I7C A;  1WEP A;  2ECT A;  4ZUX U;  1XWH A;  2FUI A;  5TRB A;  3HCS A;  1MM3 A;  1BOR A;  3SHB A;  2LXP C;  2EOD A;  2HYE D;  2QIC A;  5B78 A;  3V43 A;  5LKZ A;  3KV5 A;  2LV9 A;  1U6G B;  1WEU A;  2M3H A;  5B75 A;  2YQL A;  2YT5 A;  1WIM A;  1V87 A;  2M85 A;  3LRQ A;  3C5K A;  5KH7 A;  3KQI A;  2VJE B;  3PHD A;  2G43 A;  2JMI A;  4CA1 A;  1WEW A;  4CCG X;  4FJC A;  2CT2 A;  3O34 A;  2VNF A;  2L75 A;  2XB1 A;  2OXQ C;  5JG6 A;  1WEO A;  1Z6U A;  4ZQL A;  2KIZ A;  5TBN A;  3O70 A;  2YUC A;  4LAD B;  3ZTG A;  4WZ3 B;  3LQJ A;  4QF3 A;  4LK9 A;  2VPD A;  5FER A;  5EYA F;  1WEN A;  2AN6 A;  3N9N A;  5G04 B;  4AUQ B;  4GNG A;  4QF2 A;  5TDR A;  5FEY A;  1MM2 A;  4N3W A;  2YU4 A;  2LGV A;  2E6R A;  4TKP B;  2VP7 A;  3LQH A;  2F6J A;  4LLB A;  1CHC A;  1LDK C;  4L58 A;  2FSA A;  2VJE A;  2YSM A;  3N9P A;  3U5M A;  4A0C D;  2KWO A;  2QJ0 A;  4N4F A;  2ECN A;  1K2F A;  2JMJ A;  2VPE A;  2ECI A;  3ZVZ B;  4I7B A;  4BHW A;  2KYU A;  5B79 A;  1WFK A;  2E6S A;  4P5O B;  4IC2 A;  3NG2 A;  2YHO A;  4YAB A;  4V3L C;  2RI7 A;  3RTR B;  4UI9 B;  5LKX A;  1X4I A;  3LQI A;  4GND A;  2G6Q A;  4O64 A;  2NAA A;  3EB6 A;  2Y1M A;  2K16 A;  2MA6 A;  2YQM A;  3O33 A;  2MNY A;  5C13 A;  5D1L B;  3GV4 A;  4AP4 A;  2KE1 A;  5FB0 A;  5G05 B;  2VJF B;  4L7X A;  3C6W A;  2KWJ A;  2KGI A;  5AIT A;  2M6M A;  3U5P A;  3VK6 A;  3N9L A;  2D8S A;  4YBT A;  1F62 A;  2YYR A;  3N9O A;  1JOC A;  3T7L A;  2KFT A;  4ZDT A;  2LGG A;  4F52 B;  3N9Q A;  3M62 A;  5H9M A;  1FP0 A;  3L1Z B;  5AIU A;  4LJN A;  1WEQ A;  4NN2 A;  5LKU A;  2KGG A;  1G25 A;  2KRE A;  4YAD A;  4PTB A;  2VJF A;  3ZPV 1;  5B8D A;  2C2V S;  4V3K C;  2YW8 A;  4GNE A;  5D1K B;  1WIL A;  2C2L A;  2PUY A;  2ECV A;  2ZET C;  2ECJ A;  5D1M B;  2MUM A;  1N87 A;  3I2D A;  1WGM A;  2L0B A;  3L1X A;  4LKA A;  4AVX A;  4WZ0 A;  1T1H A;  2F42 A;  1VYX A;  2MT5 A;  4R7E A;  4YBM A;  3L11 A;  2I50 A;  2MIQ A;  3RPG B;  4IC3 A;  3SOU A;  5H1V A;  4A4B A;  3DQV R;  3SOX A;  2MD7 B;  2ECW A;  2MD8 C;  3O37 A;  1FBV A;  5B77 A;  5I3L A;  2VPG A;  2Y1N A;  1VFY A;  2LDR A;  1IYM A;  2LXH C;  4XI1 A;  2FUU A;  4S3O B;  3HCT A;  4MVT A;  5TDW A;  2RSD A;  5LCW B;  1JM7 B;  4YAX A;  5FB1 A;  3ZPV E;  1VD4 A;  5C11 A;  2H0D B;  5KH3 A;  5B76 A;  2YSJ A;  2IDA A;  3U5N A;  2CSZ A;  1WE9 A;  1Z2Q A;  4PPE A;  2CSY A;  4R8P K; 
#chains in the Genus database with same CATH topology
 2LQ6 A;  3ZYQ A;  2JM3 A;  1HYJ A;  1WEM A;  2JMD A;  3IHP A;  3MHH A;  5TAB A;  3MHS A;  2KR4 A;  2HDP A;  5DKA A;  1X4J A;  4Q6F A;  1HYI A;  2K17 A;  2DX8 A;  2BAY A;  4FK5 A;  4FO9 A;  3T6R A;  2VPB A;  2Y43 A;  4WZ2 A;  1ZBD B;  1JM7 A;  2KKX A;  3KV6 A;  2PNX A;  2H0D A;  2IQJ A;  3RPG C;  3N9M A;  3HCU A;  4UP5 A;  4AYC B;  4I7D A;  5H1U A;  4BBQ A;  2YVR A;  3QZV A;  2DSM A;  2KU3 A;  4WA6 A;  4MSX A;  2LGK A;  4A49 A;  4GB0 A;  3PUQ A;  2CKL B;  2EA6 A;  5KH9 A;  5G0F A;  2XOZ A;  2LN0 A;  1E4U A;  3GL6 A;  3LDY A;  2QIZ A;  3O35 A;  3HTK C;  4S3O C;  2LGL A;  3M63 A;  2MKE A;  4FIP A;  5DIN A;  2EGP A;  2K4D A;  2XEU A;  2ECG A;  2M1R A;  2KWN A;  2L80 A;  4OGE A;  2OWA A;  3SOW A;  3KNV A;  5SVY A;  1DVP A;  4AYC A;  3O7A A;  2UZG A;  4B7Y C;  3ASL A;  3KDE C;  2YUR A;  2K1J A;  2L5U A;  2KWK A;  2LRI C;  3DPL R;  3EB5 A;  4YAT A;  2CKL A;  3M99 A;  2MA5 A;  1WEE A;  2MNZ A;  1WES A;  1X4U A;  1RMD A;  5LKT A;  3ZVY A;  5J3X A;  4B86 C;  2P57 A;  3U5O A;  2L43 A;  2XP0 A;  2YHN A;  4X3G A;  3PUR A;  4R2Y A;  5H1T A;  4C9Z A;  4W4U A;  4YC9 A;  2G45 A;  3FL2 A;  2JRJ A;  1Z60 A;  4YBS A;  4A4C A;  4F1P A;  3FJU B;  2JUN A;  4GNF A;  1WEV A;  2F6N A;  3ZNI A;  3O47 A;  4UP0 A;  1LDJ B;  3O36 A;  2YRE A;  4I7C A;  4H9D A;  1WEP A;  2ECT A;  4ZUX U;  1XWH A;  2FUI A;  5TRB A;  3MDB C;  3HCS A;  1MM3 A;  1BOR A;  3SHB A;  2LXP C;  2EOD A;  3SUB A;  4O62 A;  2CRR A;  2HYE D;  2CSV A;  2QIC A;  5B78 A;  3V43 A;  5LKZ A;  2CRW A;  3KV5 A;  2LV9 A;  1U6G B;  1WEU A;  2M3H A;  3PLW A;  5B75 A;  2YQL A;  2YT5 A;  3H7H A;  1WIM A;  1V87 A;  2M85 A;  3LRQ A;  3C5K A;  5KH7 A;  3KQI A;  4Z0O A;  2VJE B;  3PHD A;  2G43 A;  4OGC A;  2JMI A;  4CA1 A;  1WEW A;  4CCG X;  4FJC A;  2CT2 A;  3O34 A;  2VNF A;  2L75 A;  1MBM A;  2XB1 A;  2OXQ C;  5JG6 A;  2FD4 A;  1WEO A;  1Z6U A;  4ZQL A;  2KIZ A;  5TBN A;  3O70 A;  2YUC A;  4LAD B;  3ZTG A;  4WZ3 B;  3LQJ A;  4QF3 A;  4LK9 A;  2VPD A;  5FER A;  5EYA F;  1WEN A;  2B0O E;  2AN6 A;  3N9N A;  5G04 B;  4AUQ B;  4GNG A;  4QF2 A;  5TDR A;  3M7K A;  5FEY A;  1MM2 A;  4N3W A;  2YU4 A;  2LGV A;  2E6R A;  4TKP B;  2VP7 A;  3LQH A;  2F6J A;  4LLB A;  1CHC A;  1LDK C;  4L58 A;  2FSA A;  2VJE A;  2YSM A;  3N9P A;  3U5M A;  4A0C D;  2KWO A;  2QJ0 A;  4N4F A;  3FEH A;  2ECN A;  1K2F A;  2JMJ A;  2VPE A;  2ECI A;  3ZVZ B;  4I7B A;  4BHW A;  2KYU A;  5B79 A;  1WFK A;  2E6S A;  4P5O B;  2FFW A;  4IC2 A;  2XOY A;  3NG2 A;  2YHO A;  4YAB A;  4V3L C;  2RI7 A;  3RTR B;  4UI9 B;  5LKX A;  1X4I A;  3LQI A;  4GND A;  2G6Q A;  4O64 A;  2NAA A;  3EB6 A;  3T9K A;  2Y1M A;  2K16 A;  2MA6 A;  2YQM A;  3O33 A;  3LVR E;  2MNY A;  2LAU A;  5C13 A;  5D1L B;  3FM8 C;  3Q1D A;  3GV4 A;  4AP4 A;  3LJU X;  2RR4 A;  2KE1 A;  5FB0 A;  5G05 B;  2VJF B;  4L7X A;  3C6W A;  2KWJ A;  2KGI A;  3LVQ E;  5AIT A;  2M6M A;  3U5P A;  3VK6 A;  3N9L A;  2D8S A;  4YBT A;  1F62 A;  2YYR A;  3N9O A;  1JOC A;  3T7L A;  2KFT A;  4ZDT A;  2LGG A;  4F52 B;  3N9Q A;  3M62 A;  5H9M A;  4QQ4 A;  1FP0 A;  2L7P A;  3L1Z B;  5AIU A;  4LJN A;  4Z0R A;  1WEQ A;  4NN2 A;  5LKU A;  2KGG A;  5SVX A;  1G25 A;  2KRE A;  4YAD A;  3DWD A;  4PTB A;  2VJF A;  3ZPV 1;  5B8D A;  2C2V S;  4V3K C;  2YW8 A;  4GNE A;  3FAN A;  2CON A;  2KKY A;  5SVI A;  3E2D A;  5D1K B;  2DJA A;  1WIL A;  2M13 A;  2C2L A;  2PUY A;  2ECV A;  2ZET C;  2ECJ A;  5D1M B;  2MUM A;  1N87 A;  3I2D A;  1WGM A;  2L0B A;  4LKA A;  3L1X A;  4AVX A;  3FAO A;  4WZ0 A;  1T1H A;  2F42 A;  1VYX A;  2MT5 A;  4R7E A;  4YBM A;  3L11 A;  2I50 A;  2MIQ A;  3RPG B;  4IC3 A;  3SOU A;  5H1V A;  4A4B A;  3DQV R;  3SOX A;  2MD7 B;  2ECW A;  2MD8 C;  3O37 A;  1FBV A;  5B77 A;  5I3L A;  2VPG A;  2Y1N A;  1VFY A;  2EGM A;  2D8U A;  2LDR A;  1IYM A;  2LXH C;  3JUE A;  4XI1 A;  2FUU A;  4S3O B;  3HCT A;  4MVT A;  5TDW A;  2RSD A;  5LCW B;  1DCQ A;  1JM7 B;  4YAX A;  5FB1 A;  3ZPV E;  1VD4 A;  2EXU A;  5C11 A;  2H0D B;  5KH3 A;  5B76 A;  2YSJ A;  2IDA A;  3U5N A;  5SVI B;  2CSZ A;  3DDT A;  2E61 A;  2XOC A;  1WE9 A;  1Z2Q A;  4PPE A;  5K3Q A;  2CSY A;  4R8P K; 
#chains in the Genus database with same CATH homology
 2LQ6 A;  3ZYQ A;  1HYJ A;  1WEM A;  2JMD A;  3IHP A;  3MHH A;  5TAB A;  3MHS A;  2KR4 A;  2HDP A;  5DKA A;  1X4J A;  4Q6F A;  1HYI A;  2K17 A;  2DX8 A;  2BAY A;  4FK5 A;  4FO9 A;  3T6R A;  2VPB A;  2Y43 A;  4WZ2 A;  1ZBD B;  1JM7 A;  3KV6 A;  2PNX A;  2H0D A;  3RPG C;  3N9M A;  3HCU A;  4UP5 A;  4AYC B;  4I7D A;  5H1U A;  4BBQ A;  3QZV A;  2KU3 A;  4WA6 A;  4MSX A;  2LGK A;  4A49 A;  4GB0 A;  3PUQ A;  2CKL B;  2EA6 A;  5KH9 A;  5G0F A;  2LN0 A;  1E4U A;  3GL6 A;  2QIZ A;  3O35 A;  3HTK C;  4S3O C;  2LGL A;  3M63 A;  4FIP A;  5DIN A;  2EGP A;  2K4D A;  2XEU A;  2ECG A;  2M1R A;  2KWN A;  2L80 A;  3SOW A;  3KNV A;  1DVP A;  4AYC A;  3O7A A;  2UZG A;  4B7Y C;  3ASL A;  2YUR A;  2K1J A;  2L5U A;  2KWK A;  2LRI C;  3DPL R;  3EB5 A;  4YAT A;  2CKL A;  3M99 A;  2MA5 A;  1WEE A;  2MNZ A;  1WES A;  1X4U A;  1RMD A;  5LKT A;  3ZVY A;  5J3X A;  4B86 C;  3U5O A;  2L43 A;  2YHN A;  4X3G A;  3PUR A;  4R2Y A;  5H1T A;  4C9Z A;  4W4U A;  4YC9 A;  2G45 A;  3FL2 A;  2JRJ A;  1Z60 A;  4YBS A;  4A4C A;  4GNF A;  1WEV A;  2F6N A;  3ZNI A;  4UP0 A;  1LDJ B;  3O36 A;  2YRE A;  4I7C A;  1WEP A;  2ECT A;  4ZUX U;  1XWH A;  2FUI A;  5TRB A;  3HCS A;  1MM3 A;  1BOR A;  3SHB A;  2LXP C;  2EOD A;  2HYE D;  2QIC A;  5B78 A;  3V43 A;  5LKZ A;  3KV5 A;  2LV9 A;  1U6G B;  1WEU A;  2M3H A;  5B75 A;  2YQL A;  2YT5 A;  1WIM A;  1V87 A;  2M85 A;  3LRQ A;  3C5K A;  5KH7 A;  3KQI A;  2VJE B;  3PHD A;  2G43 A;  2JMI A;  4CA1 A;  1WEW A;  4CCG X;  4FJC A;  2CT2 A;  3O34 A;  2VNF A;  2L75 A;  2XB1 A;  2OXQ C;  5JG6 A;  1WEO A;  1Z6U A;  4ZQL A;  2KIZ A;  5TBN A;  3O70 A;  2YUC A;  4LAD B;  3ZTG A;  4WZ3 B;  3LQJ A;  4QF3 A;  4LK9 A;  2VPD A;  5FER A;  5EYA F;  1WEN A;  2AN6 A;  3N9N A;  5G04 B;  4AUQ B;  4GNG A;  4QF2 A;  5TDR A;  5FEY A;  1MM2 A;  4N3W A;  2YU4 A;  2LGV A;  2E6R A;  4TKP B;  2VP7 A;  3LQH A;  2F6J A;  4LLB A;  1CHC A;  1LDK C;  4L58 A;  2FSA A;  2VJE A;  2YSM A;  3N9P A;  3U5M A;  4A0C D;  2KWO A;  2QJ0 A;  4N4F A;  2ECN A;  1K2F A;  2JMJ A;  2VPE A;  2ECI A;  3ZVZ B;  4I7B A;  4BHW A;  2KYU A;  5B79 A;  1WFK A;  2E6S A;  4P5O B;  4IC2 A;  3NG2 A;  2YHO A;  4YAB A;  4V3L C;  2RI7 A;  3RTR B;  4UI9 B;  5LKX A;  1X4I A;  3LQI A;  4GND A;  2G6Q A;  4O64 A;  2NAA A;  3EB6 A;  2Y1M A;  2K16 A;  2MA6 A;  2YQM A;  3O33 A;  2MNY A;  5C13 A;  5D1L B;  3GV4 A;  4AP4 A;  2KE1 A;  5FB0 A;  5G05 B;  2VJF B;  4L7X A;  3C6W A;  2KWJ A;  2KGI A;  5AIT A;  2M6M A;  3U5P A;  3VK6 A;  3N9L A;  2D8S A;  4YBT A;  1F62 A;  2YYR A;  3N9O A;  1JOC A;  3T7L A;  2KFT A;  4ZDT A;  2LGG A;  4F52 B;  3N9Q A;  3M62 A;  5H9M A;  1FP0 A;  3L1Z B;  5AIU A;  4LJN A;  1WEQ A;  4NN2 A;  5LKU A;  2KGG A;  1G25 A;  2KRE A;  4YAD A;  4PTB A;  2VJF A;  3ZPV 1;  5B8D A;  2C2V S;  4V3K C;  2YW8 A;  4GNE A;  5D1K B;  1WIL A;  2C2L A;  2PUY A;  2ECV A;  2ZET C;  2ECJ A;  5D1M B;  2MUM A;  1N87 A;  3I2D A;  1WGM A;  2L0B A;  3L1X A;  4LKA A;  4AVX A;  4WZ0 A;  1T1H A;  2F42 A;  1VYX A;  2MT5 A;  4R7E A;  4YBM A;  3L11 A;  2I50 A;  2MIQ A;  3RPG B;  4IC3 A;  3SOU A;  5H1V A;  4A4B A;  3DQV R;  3SOX A;  2MD7 B;  2ECW A;  2MD8 C;  3O37 A;  1FBV A;  5B77 A;  5I3L A;  2VPG A;  2Y1N A;  1VFY A;  2LDR A;  1IYM A;  2LXH C;  4XI1 A;  2FUU A;  4S3O B;  3HCT A;  4MVT A;  5TDW A;  2RSD A;  5LCW B;  1JM7 B;  4YAX A;  5FB1 A;  3ZPV E;  1VD4 A;  5C11 A;  2H0D B;  5KH3 A;  5B76 A;  2YSJ A;  2IDA A;  3U5N A;  2CSZ A;  1WE9 A;  1Z2Q A;  4PPE A;  2CSY A;  4R8P K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...