5C13A

Crystal structure of taf3 phd finger bound to histone h3c4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 3
publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 59
sequence length 59
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c13A00
5TRBA 2F42A 2ECGA 4LKAA 4I7CA 4UI9B 3L1ZB 2I50A 2E6SA 4S3OC 2HYED 1XWHA 1N87A 2KFTA 2KR4A 2VPGA 3ZYQA 4ZDTA 4MVTA 2C2LA 4A49A 1DVPA 4L58A 5H1UA 2DX8A 3ZVYA 2YYRA 3GV4A 2MUMA 4FK5A 2EODA 2UZGA 1WILA 2VPBA 3O7AA 4LADB 4WA6A 4AYCA 3M63A 4FJCA 2M1RA 3I2DA 4BBQA 2PUYA 5AIUA 3RTRB 4S3OB 2ECNA 3QZVA 4LK9A 2VPDA 1Z2QA 5D1MB 3V43A 3SOUA 4IC2A 2F6NA 2KYUA 2M3HA 1LDKC 5TDWA 3N9MA 4N4FA 3LRQA 4LJNA 3L1XA 1HYJA 4P5OB 5B77A 2Y1MA 3DPLR 2Y1NA 3LQIA 3O37A 2HDPA 2G6QA 1K2FA 2FUUA 2EA6A 2MD8C 3PHDA 3M62A 2YSJA 2D8SA 3LQJA 3SOWA 1VD4A 2VP7A 2YREA 2QICA 2XEUA 4A4BA 5FB0A 4N3WA 2K16A 4Q6FA 2H0DB 2LDRA 2MA5A 5H1TA 4R2YA 2KWOA 5LKTA 4FO9A 3PURA 3HCSA 5LKXA 3VK6A 2YQLA 2CKLB 2KIZA 4TKPB 5AITA 1WEPA 1IYMA 4GNFA 1WEOA 3EB5A 4X3GA 2YQMA 2K17A 5DINA 3N9QA 2EGPA 2YT5A 2YHOA 4V3LC 1Z6UA 2ECTA 1WEMA 1ZBDB 3O34A 2RI7A 2VNFA 5TABA 4YAXA 3HTKC 1V87A 2LV9A 2VJFA 5LKZA 3C5KA 2FSAA 2LXPC 5G05B 4AVXA 1HYIA 3LQHA 1FBVA 4PPEA 3KNVA 3U5NA 4ZQLA 3ZVZB 1G25A 2LQ6A 2QJ0A 4L7XA 5D1KB 3ZPV1 5LCWB 4V3KC 5H1VA 1VFYA 3O35A 3N9OA 2L5UA 4LLBA 2LGLA 5FB1A 2AN6A 1JM7B 1WESA 3IHPA 2MT5A 4WZ3B 2KGIA 2VPEA 2KWNA 2KU3A 2MIQA 1FP0A 3C6WA 1MM2A 5TBNA 4PTBA 2MNZA 4CCGX 2KGGA 5KH9A 1T1HA 2LGKA 3HCUA 2VJEB 1WEVA 4YATA 5FERA 4QF3A 1X4JA 3O70A 4B7YC 2PNXA 3N9PA 3N9LA 2LN0A 4WZ2A 1CHCA 4AUQB 3RPGC 1WEQA 1X4IA 4A0CD 5B79A 1WENA 2YURA 5KH3A 3NG2A 4B86C 1Z60A 5I3LA 2XB1A 4XI1A 5D1LB 5G0FA 4QF2A 1VYXA 5FEYA 5KH7A 4CA1A 2H0DA 2MD7B 2LRIC 5B8DA 1WFKA 2JMIA 3ZNIA 2YSMA 4AYCB 2L75A 5TDRA 3RPGB 3HCTA 1WIMA 2KWJA 4GNGA 2MNYA 3FL2A 3KV5A 4C9ZA 2CKLA 3MHHA 1LDJB 2L80A 1WEUA 4I7DA 4YBSA 2K4DA 3ZTGA 4R7EA 3ZPVE 3M99A 4BHWA 4YBTA 3ASLA 1WEEA 3N9NA 4WZ0A 1BORA 5B75A 3SOXA 4O64A 3U5MA 5EYAF 3PUQA 2BAYA 2FUIA 2NAAA 5DKAA 4ZUXU 4GNEA 2YU4A 2F6JA 1MM3A 3MHSA 4UP5A 1JOCA 4FIPA 4AP4A 4W4UA 2K1JA 5B78A 2LGVA 2JMJA 3L11A 3SHBA 1WE9A 5C13A 1RMDA 5C11A 2YW8A 4GNDA 2LXHC 4NN2A 5H9MA 2ECJA 2JRJA 3EB6A 1U6GB 2RSDA 4A4CA 2CSYA 2IDAA 1WGMA 3KV6A 2G43A 4YC9A 2YUCA 3U5PA 2ECIA 3DQVR 2CT2A 2L43A 2JMDA 5B76A 2YHNA 1F62A 5J3XA 3O33A 2Y43A 3T6RA 1JM7A 1X4UA 3O36A 3GL6A 2ECVA 3KQIA 2C2VS 2KREA 4R8PK 4F52B 2CSZA 4MSXA 4IC3A 4YABA 2L0BA 4GB0A 2M6MA 2ZETC 2ECWA 4UP0A 4I7BA 2E6RA 2KWKA 4YADA 2G45A 2QIZA 1WEWA 3T7LA 2M85A 2VJEA 5LKUA 5JG6A 2VJFB 2KE1A 2OXQC 5G04B 3U5OA 1E4UA 2LGGA 2MA6A 4YBMA
chains in the Genus database with same CATH superfamily
5TRBA 2F42A 2ECGA 4LKAA 4I7CA 4Z0RA 4UI9B 3PLWA 5SVXA 3L1ZB 2I50A 2E6SA 4S3OC 2HYED 1XWHA 1N87A 3T9KA 2KFTA 2KR4A 1MBMA 2VPGA 3ZYQA 4ZDTA 4MVTA 2C2LA 4A49A 1DVPA 4L58A 5H1UA 2DX8A 3ZVYA 2YYRA 3GV4A 2MUMA 4FK5A 2XOYA 2EODA 2UZGA 1WILA 3O7AA 4LADB 2EGMA 2VPBA 3LVRE 3JUEA 4WA6A 4AYCA 3M63A 4FJCA 2M1RA 3I2DA 4BBQA 2PUYA 5AIUA 3RTRB 4S3OB 2ECNA 2KKXA 3QZVA 4LK9A 2VPDA 3O47A 1Z2QA 2CRWA 5D1MB 3V43A 2DSMA 2RR4A 3SOUA 4IC2A 2F6NA 2KYUA 2M3HA 1LDKC 5TDWA 3N9MA 4N4FA 1DCQA 3LRQA 4LJNA 2YVRA 2B0OE 3L1XA 1HYJA 4P5OB 5B77A 2Y1MA 2IQJA 2Y1NA 3DPLR 3LQIA 3KDEC 3O37A 2HDPA 2G6QA 1K2FA 2FUUA 2CONA 2EA6A 2MD8C 3PHDA 3M62A 2YSJA 2D8SA 3LQJA 3SOWA 1VD4A 2VP7A 2YREA 2QICA 2XEUA 4A4BA 5FB0A 4N3WA 2K16A 4Q6FA 2H0DB 2LDRA 2MA5A 5H1TA 4R2YA 2KWOA 5LKTA 4FO9A 3PURA 3HCSA 5LKXA 3VK6A 2YQLA 2CKLB 2KIZA 4TKPB 5AITA 1WEPA 1IYMA 4GNFA 3M7KA 3FANA 3LVQE 1WEOA 3EB5A 4X3GA 5SVYA 2YQMA 2K17A 2XOZA 5DINA 3N9QA 2EGPA 2YT5A 2YHOA 5K3QA 4V3LC 1Z6UA 2ECTA 1WEMA 1ZBDB 3O34A 2RI7A 2VNFA 5TABA 4YAXA 3HTKC 1V87A 2LV9A 2VJFA 5LKZA 3C5KA 2FSAA 2LXPC 5G05B 4AVXA 1HYIA 3LQHA 1FBVA 4PPEA 2P57A 3KNVA 3U5NA 2XOCA 4ZQLA 3ZVZB 1G25A 2FFWA 2LQ6A 2EXUA 2QJ0A 4L7XA 5D1KB 3ZPV1 5LCWB 4V3KC 3E2DA 5H1VA 1VFYA 3O35A 3N9OA 2L5UA 4LLBA 4Z0OA 2CRRA 2LGLA 5FB1A 2AN6A 1JM7B 1WESA 3IHPA 3MDBC 2MKEA 2MT5A 2XP0A 3Q1DA 5SVIB 4WZ3B 3FM8C 2KGIA 2VPEA 2KWNA 2KU3A 4OGEA 2MIQA 1FP0A 3C6WA 1MM2A 5TBNA 4PTBA 2MNZA 2CSVA 4CCGX 2KGGA 2M13A 5KH9A 1T1HA 2LGKA 3HCUA 2VJEB 3FJUB 1WEVA 2LAUA 2JM3A 4YATA 3FAOA 5FERA 4QF3A 3DWDA 1X4JA 3O70A 4B7YC 2PNXA 3N9PA 3SUBA 3N9LA 2LN0A 4WZ2A 1CHCA 4H9DA 4AUQB 3RPGC 3LJUX 1WEQA 1X4IA 4A0CD 2DJAA 5B79A 1WENA 2YURA 5KH3A 3NG2A 4B86C 1Z60A 5I3LA 2XB1A 4XI1A 5D1LB 5G0FA 4QF2A 1VYXA 5FEYA 5KH7A 4CA1A 2H0DA 2MD7B 2LRIC 5B8DA 1WFKA 2JMIA 3ZNIA 2YSMA 2JUNA 4AYCB 2FD4A 2L75A 5TDRA 3RPGB 3HCTA 1WIMA 2KWJA 4GNGA 2MNYA 3FL2A 3KV5A 4C9ZA 2CKLA 3MHHA 1LDJB 2L80A 1WEUA 4I7DA 4YBSA 2K4DA 3ZTGA 4R7EA 3ZPVE 3M99A 2OWAA 4BHWA 4YBTA 3ASLA 1WEEA 3N9NA 4WZ0A 1BORA 5B75A 3SOXA 4O64A 3U5MA 5EYAF 3PUQA 2BAYA 2FUIA 2NAAA 5DKAA 4ZUXU 2L7PA 4GNEA 2YU4A 2F6JA 1MM3A 3MHSA 4UP5A 1JOCA 4FIPA 4AP4A 4O62A 4W4UA 2K1JA 5B78A 2LGVA 2JMJA 3L11A 3SHBA 1WE9A 5C13A 2KKYA 1RMDA 5C11A 2YW8A 4GNDA 2LXHC 4NN2A 5H9MA 2ECJA 2JRJA 3EB6A 1U6GB 2RSDA 4A4CA 2CSYA 2IDAA 1WGMA 3KV6A 2G43A 4YC9A 2YUCA 3U5PA 2ECIA 3DQVR 2CT2A 4QQ4A 2L43A 2JMDA 5B76A 2YHNA 1F62A 5J3XA 3O33A 2Y43A 3H7HA 3T6RA 1JM7A 2D8UA 1X4UA 3O36A 3GL6A 4OGCA 2ECVA 3KQIA 2C2VS 2KREA 4R8PK 4F52B 2CSZA 4MSXA 4IC3A 5SVIA 4YABA 2E61A 2L0BA 4GB0A 2M6MA 2ZETC 2ECWA 3DDTA 4I7BA 4UP0A 3FEHA 2E6RA 2KWKA 4YADA 2G45A 2QIZA 3LDYA 1WEWA 3T7LA 2M85A 2VJEA 5LKUA 5JG6A 2VJFB 2KE1A 4F1PA 2OXQC 5G04B 3U5OA 1E4UA 2LGGA 2MA6A 4YBMA
chains in the Genus database with same CATH topology
5TRBA 2F42A 2ECGA 4LKAA 4I7CA 4UI9B 3L1ZB 2I50A 2E6SA 4S3OC 2HYED 1XWHA 1N87A 2KFTA 2KR4A 2VPGA 3ZYQA 4ZDTA 4MVTA 2C2LA 4A49A 1DVPA 4L58A 5H1UA 2DX8A 3ZVYA 2YYRA 3GV4A 2MUMA 4FK5A 2EODA 2UZGA 1WILA 2VPBA 3O7AA 4LADB 4WA6A 4AYCA 3M63A 4FJCA 2M1RA 3I2DA 4BBQA 2PUYA 5AIUA 3RTRB 4S3OB 2ECNA 3QZVA 4LK9A 2VPDA 1Z2QA 5D1MB 3V43A 3SOUA 4IC2A 2F6NA 2KYUA 2M3HA 1LDKC 5TDWA 3N9MA 4N4FA 3LRQA 4LJNA 3L1XA 1HYJA 4P5OB 5B77A 2Y1MA 3DPLR 2Y1NA 3LQIA 3O37A 2HDPA 2G6QA 1K2FA 2FUUA 2EA6A 2MD8C 3PHDA 3M62A 2YSJA 2D8SA 3LQJA 3SOWA 1VD4A 2VP7A 2YREA 2QICA 2XEUA 4A4BA 5FB0A 4N3WA 2K16A 4Q6FA 2H0DB 2LDRA 2MA5A 5H1TA 4R2YA 2KWOA 5LKTA 4FO9A 3PURA 3HCSA 5LKXA 3VK6A 2YQLA 2CKLB 2KIZA 4TKPB 5AITA 1WEPA 1IYMA 4GNFA 1WEOA 3EB5A 4X3GA 2YQMA 2K17A 5DINA 3N9QA 2EGPA 2YT5A 2YHOA 4V3LC 1Z6UA 2ECTA 1WEMA 1ZBDB 3O34A 2RI7A 2VNFA 5TABA 4YAXA 3HTKC 1V87A 2LV9A 2VJFA 5LKZA 3C5KA 2FSAA 2LXPC 5G05B 4AVXA 1HYIA 3LQHA 1FBVA 4PPEA 3KNVA 3U5NA 4ZQLA 3ZVZB 1G25A 2LQ6A 2QJ0A 4L7XA 5D1KB 3ZPV1 5LCWB 4V3KC 5H1VA 1VFYA 3O35A 3N9OA 2L5UA 4LLBA 2LGLA 5FB1A 2AN6A 1JM7B 1WESA 3IHPA 2MT5A 4WZ3B 2KGIA 2VPEA 2KWNA 2KU3A 2MIQA 1FP0A 3C6WA 1MM2A 5TBNA 4PTBA 2MNZA 4CCGX 2KGGA 5KH9A 1T1HA 2LGKA 3HCUA 2VJEB 1WEVA 4YATA 5FERA 4QF3A 1X4JA 3O70A 4B7YC 2PNXA 3N9PA 3N9LA 2LN0A 4WZ2A 1CHCA 4AUQB 3RPGC 1WEQA 1X4IA 4A0CD 5B79A 1WENA 2YURA 5KH3A 3NG2A 4B86C 1Z60A 5I3LA 2XB1A 4XI1A 5D1LB 5G0FA 4QF2A 1VYXA 5FEYA 5KH7A 4CA1A 2H0DA 2MD7B 2LRIC 5B8DA 1WFKA 2JMIA 3ZNIA 2YSMA 4AYCB 2L75A 5TDRA 3RPGB 3HCTA 1WIMA 2KWJA 4GNGA 2MNYA 3FL2A 3KV5A 4C9ZA 2CKLA 3MHHA 1LDJB 2L80A 1WEUA 4I7DA 4YBSA 2K4DA 3ZTGA 4R7EA 3ZPVE 3M99A 4BHWA 4YBTA 3ASLA 1WEEA 3N9NA 4WZ0A 1BORA 5B75A 3SOXA 4O64A 3U5MA 5EYAF 3PUQA 2BAYA 2FUIA 2NAAA 5DKAA 4ZUXU 4GNEA 2YU4A 2F6JA 1MM3A 3MHSA 4UP5A 1JOCA 4FIPA 4AP4A 4W4UA 2K1JA 5B78A 2LGVA 2JMJA 3L11A 3SHBA 1WE9A 5C13A 1RMDA 5C11A 2YW8A 4GNDA 2LXHC 4NN2A 5H9MA 2ECJA 2JRJA 3EB6A 1U6GB 2RSDA 4A4CA 2CSYA 2IDAA 1WGMA 3KV6A 2G43A 4YC9A 2YUCA 3U5PA 2ECIA 3DQVR 2CT2A 2L43A 2JMDA 5B76A 2YHNA 1F62A 5J3XA 3O33A 2Y43A 3T6RA 1JM7A 1X4UA 3O36A 3GL6A 2ECVA 3KQIA 2C2VS 2KREA 4R8PK 4F52B 2CSZA 4MSXA 4IC3A 4YABA 2L0BA 4GB0A 2M6MA 2ZETC 2ECWA 4UP0A 4I7BA 2E6RA 2KWKA 4YADA 2G45A 2QIZA 1WEWA 3T7LA 2M85A 2VJEA 5LKUA 5JG6A 2VJFB 2KE1A 2OXQC 5G04B 3U5OA 1E4UA 2LGGA 2MA6A 4YBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRB A;  2F42 A;  2ECG A;  4LKA A;  4I7C A;  4UI9 B;  3L1Z B;  2I50 A;  2E6S A;  4S3O C;  2HYE D;  1XWH A;  1N87 A;  2KFT A;  2KR4 A;  2VPG A;  3ZYQ A;  4ZDT A;  4MVT A;  2C2L A;  4A49 A;  1DVP A;  4L58 A;  5H1U A;  2DX8 A;  3ZVY A;  2YYR A;  3GV4 A;  2MUM A;  4FK5 A;  2EOD A;  2UZG A;  1WIL A;  2VPB A;  3O7A A;  4LAD B;  4WA6 A;  4AYC A;  3M63 A;  4FJC A;  2M1R A;  3I2D A;  4BBQ A;  2PUY A;  5AIU A;  3RTR B;  4S3O B;  2ECN A;  3QZV A;  4LK9 A;  2VPD A;  1Z2Q A;  5D1M B;  3V43 A;  3SOU A;  4IC2 A;  2F6N A;  2KYU A;  2M3H A;  1LDK C;  5TDW A;  3N9M A;  4N4F A;  3LRQ A;  4LJN A;  3L1X A;  1HYJ A;  4P5O B;  5B77 A;  2Y1M A;  3DPL R;  2Y1N A;  3LQI A;  3O37 A;  2HDP A;  2G6Q A;  1K2F A;  2FUU A;  2EA6 A;  2MD8 C;  3PHD A;  3M62 A;  2YSJ A;  2D8S A;  3LQJ A;  3SOW A;  1VD4 A;  2VP7 A;  2YRE A;  2QIC A;  2XEU A;  4A4B A;  5FB0 A;  4N3W A;  2K16 A;  4Q6F A;  2H0D B;  2LDR A;  2MA5 A;  5H1T A;  4R2Y A;  2KWO A;  5LKT A;  4FO9 A;  3PUR A;  3HCS A;  5LKX A;  3VK6 A;  2YQL A;  2CKL B;  2KIZ A;  4TKP B;  5AIT A;  1WEP A;  1IYM A;  4GNF A;  1WEO A;  3EB5 A;  4X3G A;  2YQM A;  2K17 A;  5DIN A;  3N9Q A;  2EGP A;  2YT5 A;  2YHO A;  4V3L C;  1Z6U A;  2ECT A;  1WEM A;  1ZBD B;  3O34 A;  2RI7 A;  2VNF A;  5TAB A;  4YAX A;  3HTK C;  1V87 A;  2LV9 A;  2VJF A;  5LKZ A;  3C5K A;  2FSA A;  2LXP C;  5G05 B;  4AVX A;  1HYI A;  3LQH A;  1FBV A;  4PPE A;  3KNV A;  3U5N A;  4ZQL A;  3ZVZ B;  1G25 A;  2LQ6 A;  2QJ0 A;  4L7X A;  5D1K B;  3ZPV 1;  5LCW B;  4V3K C;  5H1V A;  1VFY A;  3O35 A;  3N9O A;  2L5U A;  4LLB A;  2LGL A;  5FB1 A;  2AN6 A;  1JM7 B;  1WES A;  3IHP A;  2MT5 A;  4WZ3 B;  2KGI A;  2VPE A;  2KWN A;  2KU3 A;  2MIQ A;  1FP0 A;  3C6W A;  1MM2 A;  5TBN A;  4PTB A;  2MNZ A;  4CCG X;  2KGG A;  5KH9 A;  1T1H A;  2LGK A;  3HCU A;  2VJE B;  1WEV A;  4YAT A;  5FER A;  4QF3 A;  1X4J A;  3O70 A;  4B7Y C;  2PNX A;  3N9P A;  3N9L A;  2LN0 A;  4WZ2 A;  1CHC A;  4AUQ B;  3RPG C;  1WEQ A;  1X4I A;  4A0C D;  5B79 A;  1WEN A;  2YUR A;  5KH3 A;  3NG2 A;  4B86 C;  1Z60 A;  5I3L A;  2XB1 A;  4XI1 A;  5D1L B;  5G0F A;  4QF2 A;  1VYX A;  5FEY A;  5KH7 A;  4CA1 A;  2H0D A;  2MD7 B;  2LRI C;  5B8D A;  1WFK A;  2JMI A;  3ZNI A;  2YSM A;  4AYC B;  2L75 A;  5TDR A;  3RPG B;  3HCT A;  1WIM A;  2KWJ A;  4GNG A;  2MNY A;  3FL2 A;  3KV5 A;  4C9Z A;  2CKL A;  3MHH A;  1LDJ B;  2L80 A;  1WEU A;  4I7D A;  4YBS A;  2K4D A;  3ZTG A;  4R7E A;  3ZPV E;  3M99 A;  4BHW A;  4YBT A;  3ASL A;  1WEE A;  3N9N A;  4WZ0 A;  1BOR A;  5B75 A;  3SOX A;  4O64 A;  3U5M A;  5EYA F;  3PUQ A;  2BAY A;  2FUI A;  2NAA A;  5DKA A;  4ZUX U;  4GNE A;  2YU4 A;  2F6J A;  1MM3 A;  3MHS A;  4UP5 A;  1JOC A;  4FIP A;  4AP4 A;  4W4U A;  2K1J A;  5B78 A;  2LGV A;  2JMJ A;  3L11 A;  3SHB A;  1WE9 A;  5C13 A;  1RMD A;  5C11 A;  2YW8 A;  4GND A;  2LXH C;  4NN2 A;  5H9M A;  2ECJ A;  2JRJ A;  3EB6 A;  1U6G B;  2RSD A;  4A4C A;  2CSY A;  2IDA A;  1WGM A;  3KV6 A;  2G43 A;  4YC9 A;  2YUC A;  3U5P A;  2ECI A;  3DQV R;  2CT2 A;  2L43 A;  2JMD A;  5B76 A;  2YHN A;  1F62 A;  5J3X A;  3O33 A;  2Y43 A;  3T6R A;  1JM7 A;  1X4U A;  3O36 A;  3GL6 A;  2ECV A;  3KQI A;  2C2V S;  2KRE A;  4R8P K;  4F52 B;  2CSZ A;  4MSX A;  4IC3 A;  4YAB A;  2L0B A;  4GB0 A;  2M6M A;  2ZET C;  2ECW A;  4UP0 A;  4I7B A;  2E6R A;  2KWK A;  4YAD A;  2G45 A;  2QIZ A;  1WEW A;  3T7L A;  2M85 A;  2VJE A;  5LKU A;  5JG6 A;  2VJF B;  2KE1 A;  2OXQ C;  5G04 B;  3U5O A;  1E4U A;  2LGG A;  2MA6 A;  4YBM A; 
#chains in the Genus database with same CATH topology
 5TRB A;  2F42 A;  2ECG A;  4LKA A;  4I7C A;  4Z0R A;  4UI9 B;  3PLW A;  5SVX A;  3L1Z B;  2I50 A;  2E6S A;  4S3O C;  2HYE D;  1XWH A;  1N87 A;  3T9K A;  2KFT A;  2KR4 A;  1MBM A;  2VPG A;  3ZYQ A;  4ZDT A;  4MVT A;  2C2L A;  4A49 A;  1DVP A;  4L58 A;  5H1U A;  2DX8 A;  3ZVY A;  2YYR A;  3GV4 A;  2MUM A;  4FK5 A;  2XOY A;  2EOD A;  2UZG A;  1WIL A;  3O7A A;  4LAD B;  2EGM A;  2VPB A;  3LVR E;  3JUE A;  4WA6 A;  4AYC A;  3M63 A;  4FJC A;  2M1R A;  3I2D A;  4BBQ A;  2PUY A;  5AIU A;  3RTR B;  4S3O B;  2ECN A;  2KKX A;  3QZV A;  4LK9 A;  2VPD A;  3O47 A;  1Z2Q A;  2CRW A;  5D1M B;  3V43 A;  2DSM A;  2RR4 A;  3SOU A;  4IC2 A;  2F6N A;  2KYU A;  2M3H A;  1LDK C;  5TDW A;  3N9M A;  4N4F A;  1DCQ A;  3LRQ A;  4LJN A;  2YVR A;  2B0O E;  3L1X A;  1HYJ A;  4P5O B;  5B77 A;  2Y1M A;  2IQJ A;  2Y1N A;  3DPL R;  3LQI A;  3KDE C;  3O37 A;  2HDP A;  2G6Q A;  1K2F A;  2FUU A;  2CON A;  2EA6 A;  2MD8 C;  3PHD A;  3M62 A;  2YSJ A;  2D8S A;  3LQJ A;  3SOW A;  1VD4 A;  2VP7 A;  2YRE A;  2QIC A;  2XEU A;  4A4B A;  5FB0 A;  4N3W A;  2K16 A;  4Q6F A;  2H0D B;  2LDR A;  2MA5 A;  5H1T A;  4R2Y A;  2KWO A;  5LKT A;  4FO9 A;  3PUR A;  3HCS A;  5LKX A;  3VK6 A;  2YQL A;  2CKL B;  2KIZ A;  4TKP B;  5AIT A;  1WEP A;  1IYM A;  4GNF A;  3M7K A;  3FAN A;  3LVQ E;  1WEO A;  3EB5 A;  4X3G A;  5SVY A;  2YQM A;  2K17 A;  2XOZ A;  5DIN A;  3N9Q A;  2EGP A;  2YT5 A;  2YHO A;  5K3Q A;  4V3L C;  1Z6U A;  2ECT A;  1WEM A;  1ZBD B;  3O34 A;  2RI7 A;  2VNF A;  5TAB A;  4YAX A;  3HTK C;  1V87 A;  2LV9 A;  2VJF A;  5LKZ A;  3C5K A;  2FSA A;  2LXP C;  5G05 B;  4AVX A;  1HYI A;  3LQH A;  1FBV A;  4PPE A;  2P57 A;  3KNV A;  3U5N A;  2XOC A;  4ZQL A;  3ZVZ B;  1G25 A;  2FFW A;  2LQ6 A;  2EXU A;  2QJ0 A;  4L7X A;  5D1K B;  3ZPV 1;  5LCW B;  4V3K C;  3E2D A;  5H1V A;  1VFY A;  3O35 A;  3N9O A;  2L5U A;  4LLB A;  4Z0O A;  2CRR A;  2LGL A;  5FB1 A;  2AN6 A;  1JM7 B;  1WES A;  3IHP A;  3MDB C;  2MKE A;  2MT5 A;  2XP0 A;  3Q1D A;  5SVI B;  4WZ3 B;  3FM8 C;  2KGI A;  2VPE A;  2KWN A;  2KU3 A;  4OGE A;  2MIQ A;  1FP0 A;  3C6W A;  1MM2 A;  5TBN A;  4PTB A;  2MNZ A;  2CSV A;  4CCG X;  2KGG A;  2M13 A;  5KH9 A;  1T1H A;  2LGK A;  3HCU A;  2VJE B;  3FJU B;  1WEV A;  2LAU A;  2JM3 A;  4YAT A;  3FAO A;  5FER A;  4QF3 A;  3DWD A;  1X4J A;  3O70 A;  4B7Y C;  2PNX A;  3N9P A;  3SUB A;  3N9L A;  2LN0 A;  4WZ2 A;  1CHC A;  4H9D A;  4AUQ B;  3RPG C;  3LJU X;  1WEQ A;  1X4I A;  4A0C D;  2DJA A;  5B79 A;  1WEN A;  2YUR A;  5KH3 A;  3NG2 A;  4B86 C;  1Z60 A;  5I3L A;  2XB1 A;  4XI1 A;  5D1L B;  5G0F A;  4QF2 A;  1VYX A;  5FEY A;  5KH7 A;  4CA1 A;  2H0D A;  2MD7 B;  2LRI C;  5B8D A;  1WFK A;  2JMI A;  3ZNI A;  2YSM A;  2JUN A;  4AYC B;  2FD4 A;  2L75 A;  5TDR A;  3RPG B;  3HCT A;  1WIM A;  2KWJ A;  4GNG A;  2MNY A;  3FL2 A;  3KV5 A;  4C9Z A;  2CKL A;  3MHH A;  1LDJ B;  2L80 A;  1WEU A;  4I7D A;  4YBS A;  2K4D A;  3ZTG A;  4R7E A;  3ZPV E;  3M99 A;  2OWA A;  4BHW A;  4YBT A;  3ASL A;  1WEE A;  3N9N A;  4WZ0 A;  1BOR A;  5B75 A;  3SOX A;  4O64 A;  3U5M A;  5EYA F;  3PUQ A;  2BAY A;  2FUI A;  2NAA A;  5DKA A;  4ZUX U;  2L7P A;  4GNE A;  2YU4 A;  2F6J A;  1MM3 A;  3MHS A;  4UP5 A;  1JOC A;  4FIP A;  4AP4 A;  4O62 A;  4W4U A;  2K1J A;  5B78 A;  2LGV A;  2JMJ A;  3L11 A;  3SHB A;  1WE9 A;  5C13 A;  2KKY A;  1RMD A;  5C11 A;  2YW8 A;  4GND A;  2LXH C;  4NN2 A;  5H9M A;  2ECJ A;  2JRJ A;  3EB6 A;  1U6G B;  2RSD A;  4A4C A;  2CSY A;  2IDA A;  1WGM A;  3KV6 A;  2G43 A;  4YC9 A;  2YUC A;  3U5P A;  2ECI A;  3DQV R;  2CT2 A;  4QQ4 A;  2L43 A;  2JMD A;  5B76 A;  2YHN A;  1F62 A;  5J3X A;  3O33 A;  2Y43 A;  3H7H A;  3T6R A;  1JM7 A;  2D8U A;  1X4U A;  3O36 A;  3GL6 A;  4OGC A;  2ECV A;  3KQI A;  2C2V S;  2KRE A;  4R8P K;  4F52 B;  2CSZ A;  4MSX A;  4IC3 A;  5SVI A;  4YAB A;  2E61 A;  2L0B A;  4GB0 A;  2M6M A;  2ZET C;  2ECW A;  3DDT A;  4I7B A;  4UP0 A;  3FEH A;  2E6R A;  2KWK A;  4YAD A;  2G45 A;  2QIZ A;  3LDY A;  1WEW A;  3T7L A;  2M85 A;  2VJE A;  5LKU A;  5JG6 A;  2VJF B;  2KE1 A;  4F1P A;  2OXQ C;  5G04 B;  3U5O A;  1E4U A;  2LGG A;  2MA6 A;  4YBM A; 
#chains in the Genus database with same CATH homology
 5TRB A;  2F42 A;  2ECG A;  4LKA A;  4I7C A;  4UI9 B;  3L1Z B;  2I50 A;  2E6S A;  4S3O C;  2HYE D;  1XWH A;  1N87 A;  2KFT A;  2KR4 A;  2VPG A;  3ZYQ A;  4ZDT A;  4MVT A;  2C2L A;  4A49 A;  1DVP A;  4L58 A;  5H1U A;  2DX8 A;  3ZVY A;  2YYR A;  3GV4 A;  2MUM A;  4FK5 A;  2EOD A;  2UZG A;  1WIL A;  2VPB A;  3O7A A;  4LAD B;  4WA6 A;  4AYC A;  3M63 A;  4FJC A;  2M1R A;  3I2D A;  4BBQ A;  2PUY A;  5AIU A;  3RTR B;  4S3O B;  2ECN A;  3QZV A;  4LK9 A;  2VPD A;  1Z2Q A;  5D1M B;  3V43 A;  3SOU A;  4IC2 A;  2F6N A;  2KYU A;  2M3H A;  1LDK C;  5TDW A;  3N9M A;  4N4F A;  3LRQ A;  4LJN A;  3L1X A;  1HYJ A;  4P5O B;  5B77 A;  2Y1M A;  3DPL R;  2Y1N A;  3LQI A;  3O37 A;  2HDP A;  2G6Q A;  1K2F A;  2FUU A;  2EA6 A;  2MD8 C;  3PHD A;  3M62 A;  2YSJ A;  2D8S A;  3LQJ A;  3SOW A;  1VD4 A;  2VP7 A;  2YRE A;  2QIC A;  2XEU A;  4A4B A;  5FB0 A;  4N3W A;  2K16 A;  4Q6F A;  2H0D B;  2LDR A;  2MA5 A;  5H1T A;  4R2Y A;  2KWO A;  5LKT A;  4FO9 A;  3PUR A;  3HCS A;  5LKX A;  3VK6 A;  2YQL A;  2CKL B;  2KIZ A;  4TKP B;  5AIT A;  1WEP A;  1IYM A;  4GNF A;  1WEO A;  3EB5 A;  4X3G A;  2YQM A;  2K17 A;  5DIN A;  3N9Q A;  2EGP A;  2YT5 A;  2YHO A;  4V3L C;  1Z6U A;  2ECT A;  1WEM A;  1ZBD B;  3O34 A;  2RI7 A;  2VNF A;  5TAB A;  4YAX A;  3HTK C;  1V87 A;  2LV9 A;  2VJF A;  5LKZ A;  3C5K A;  2FSA A;  2LXP C;  5G05 B;  4AVX A;  1HYI A;  3LQH A;  1FBV A;  4PPE A;  3KNV A;  3U5N A;  4ZQL A;  3ZVZ B;  1G25 A;  2LQ6 A;  2QJ0 A;  4L7X A;  5D1K B;  3ZPV 1;  5LCW B;  4V3K C;  5H1V A;  1VFY A;  3O35 A;  3N9O A;  2L5U A;  4LLB A;  2LGL A;  5FB1 A;  2AN6 A;  1JM7 B;  1WES A;  3IHP A;  2MT5 A;  4WZ3 B;  2KGI A;  2VPE A;  2KWN A;  2KU3 A;  2MIQ A;  1FP0 A;  3C6W A;  1MM2 A;  5TBN A;  4PTB A;  2MNZ A;  4CCG X;  2KGG A;  5KH9 A;  1T1H A;  2LGK A;  3HCU A;  2VJE B;  1WEV A;  4YAT A;  5FER A;  4QF3 A;  1X4J A;  3O70 A;  4B7Y C;  2PNX A;  3N9P A;  3N9L A;  2LN0 A;  4WZ2 A;  1CHC A;  4AUQ B;  3RPG C;  1WEQ A;  1X4I A;  4A0C D;  5B79 A;  1WEN A;  2YUR A;  5KH3 A;  3NG2 A;  4B86 C;  1Z60 A;  5I3L A;  2XB1 A;  4XI1 A;  5D1L B;  5G0F A;  4QF2 A;  1VYX A;  5FEY A;  5KH7 A;  4CA1 A;  2H0D A;  2MD7 B;  2LRI C;  5B8D A;  1WFK A;  2JMI A;  3ZNI A;  2YSM A;  4AYC B;  2L75 A;  5TDR A;  3RPG B;  3HCT A;  1WIM A;  2KWJ A;  4GNG A;  2MNY A;  3FL2 A;  3KV5 A;  4C9Z A;  2CKL A;  3MHH A;  1LDJ B;  2L80 A;  1WEU A;  4I7D A;  4YBS A;  2K4D A;  3ZTG A;  4R7E A;  3ZPV E;  3M99 A;  4BHW A;  4YBT A;  3ASL A;  1WEE A;  3N9N A;  4WZ0 A;  1BOR A;  5B75 A;  3SOX A;  4O64 A;  3U5M A;  5EYA F;  3PUQ A;  2BAY A;  2FUI A;  2NAA A;  5DKA A;  4ZUX U;  4GNE A;  2YU4 A;  2F6J A;  1MM3 A;  3MHS A;  4UP5 A;  1JOC A;  4FIP A;  4AP4 A;  4W4U A;  2K1J A;  5B78 A;  2LGV A;  2JMJ A;  3L11 A;  3SHB A;  1WE9 A;  5C13 A;  1RMD A;  5C11 A;  2YW8 A;  4GND A;  2LXH C;  4NN2 A;  5H9M A;  2ECJ A;  2JRJ A;  3EB6 A;  1U6G B;  2RSD A;  4A4C A;  2CSY A;  2IDA A;  1WGM A;  3KV6 A;  2G43 A;  4YC9 A;  2YUC A;  3U5P A;  2ECI A;  3DQV R;  2CT2 A;  2L43 A;  2JMD A;  5B76 A;  2YHN A;  1F62 A;  5J3X A;  3O33 A;  2Y43 A;  3T6R A;  1JM7 A;  1X4U A;  3O36 A;  3GL6 A;  2ECV A;  3KQI A;  2C2V S;  2KRE A;  4R8P K;  4F52 B;  2CSZ A;  4MSX A;  4IC3 A;  4YAB A;  2L0B A;  4GB0 A;  2M6M A;  2ZET C;  2ECW A;  4UP0 A;  4I7B A;  2E6R A;  2KWK A;  4YAD A;  2G45 A;  2QIZ A;  1WEW A;  3T7L A;  2M85 A;  2VJE A;  5LKU A;  5JG6 A;  2VJF B;  2KE1 A;  2OXQ C;  5G04 B;  3U5O A;  1E4U A;  2LGG A;  2MA6 A;  4YBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...