3SOXA

Structure of uhrf1 phd finger in the free form
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3soxA00
2HDPA 4LKAA 1BORA 5H1TA 2MUMA 5TABA 1Z60A 2ZETC 3KV6A 2QIZA 1K2FA 3ZNIA 1JOCA 1T1HA 3KQIA 1FBVA 2UZGA 1HYJA 4P5OB 2EGPA 1FP0A 3O36A 4V3KC 2LN0A 1WFKA 2MNZA 3ZYQA 2CKLB 1X4UA 1JM7A 3FL2A 4CA1A 3L1XA 5LCWB 1U6GB 4PTBA 2LXHC 2CSZA 2CT2A 3MHSA 3LQIA 4TKPB 2L0BA 2VJEA 2YHOA 2ECWA 4ZUXU 3T7LA 3L1ZB 4R2YA 4ZQLA 3LRQA 5FB0A 5C11A 4YBMA 5B78A 5B77A 4FIPA 1CHCA 4IC3A 3SOUA 2CSYA 3ZVZB 3O7AA 1V87A 3DPLR 1F62A 2L43A 2MD7B 5EYAF 5KH7A 4B86C 2JMIA 4R7EA 2MA5A 2K4DA 2M6MA 3KNVA 3C6WA 3KV5A 4UI9B 2YHNA 1JM7B 2YW8A 2FSAA 2KU3A 1WENA 2VPGA 3ZPV1 2HYED 1WGMA 3U5PA 2LGKA 2VJEB 3PHDA 2KWJA 2LXPC 2YREA 3HCSA 4L58A 2L75A 5DINA 4I7DA 3M62A 5TBNA 5D1LB 5C13A 2L80A 4UP5A 4S3OC 2PUYA 2JMJA 3N9OA 2ECJA 4YBTA 2VNFA 2KR4A 2QICA 5B75A 1WEPA 3C5KA 1LDJB 3HCTA 5AIUA 4I7CA 2I50A 4AP4A 1VYXA 2K16A 3HTKC 3I2DA 4IC2A 4YAXA 3LQJA 4LK9A 4N3WA 2XB1A 3U5NA 1X4JA 2K17A 2MT5A 4FJCA 1E4UA 2C2VS 2M1RA 1WE9A 2Y1NA 3N9QA 1N87A 2Y1MA 2YQMA 3N9NA 5LKUA 2G6QA 3VK6A 2BAYA 3SOWA 2YUCA 4C9ZA 2YSMA 3L11A 2H0DA 2YU4A 2ECTA 2MA6A 3O70A 3NG2A 5B76A 4N4FA 2DX8A 4LJNA 1IYMA 2LRIC 2LDRA 3EB5A 5KH9A 4A49A 5G05B 1WILA 2KWOA 2LGLA 2JMDA 1G25A 5I3LA 4S3OB 4W4UA 1MM3A 5LKZA 4L7XA 3DQVR 2F6JA 4LADB 1ZBDB 2G43A 2KFTA 2YQLA 2MNYA 4V3LC 3GL6A 1VFYA 2NAAA 5H9MA 4YBSA 2L5UA 2FUIA 5DKAA 5D1KB 2XEUA 5D1MB 3O33A 4BHWA 5J3XA 1WEEA 4MSXA 2LV9A 4GNGA 5TDWA 4ZDTA 5AITA 3N9PA 3N9LA 2KWNA 3LQHA 1WEMA 3SHBA 2KIZA 2LGVA 4YATA 2IDAA 4XI1A 4F52B 5B8DA 2H0DB 2ECIA 4I7BA 4YABA 4X3GA 4GNFA 2VPBA 4WZ2A 2E6RA 3ASLA 2C2LA 1HYIA 4AUQB 3SOXA 4YC9A 1VD4A 4O64A 3O34A 4MVTA 2D8SA 2M85A 1WEVA 4CCGX 4R8PK 2LQ6A 4WA6A 3RPGB 1WEOA 4AVXA 2EODA 4BBQA 2VJFA 5JG6A 2QJ0A 5TDRA 4A0CD 2PNXA 2YYRA 4YADA 1RMDA 1DVPA 2RSDA 3O35A 4FK5A 3M63A 2F6NA 3PUQA 2VPDA 4B7YC 5H1UA 2LGGA 1X4IA 4AYCA 5FERA 5G0FA 3ZTGA 2RI7A 4Q6FA 5KH3A 2KE1A 3M99A 4GB0A 3RTRB 2KGGA 2YURA 5FB1A 2KYUA 3IHPA 4GNDA 2KREA 5LKTA 1LDKC 2FUUA 2JRJA 1WIMA 1Z6UA 4A4CA 4LLBA 3V43A 5FEYA 3RPGC 3ZPVE 1Z2QA 5G04B 2KWKA 3GV4A 2G45A 4WZ0A 2E6SA 4PPEA 3U5MA 3PURA 4NN2A 2VJFB 1WEWA 4QF3A 2AN6A 2KGIA 4UP0A 3EB6A 4QF2A 2ECNA 1WESA 2CKLA 5B79A 2MIQA 2VPEA 3MHHA 3U5OA 2ECGA 3N9MA 4A4BA 2F42A 1WEUA 4AYCB 2YSJA 2Y43A 5H1VA 3HCUA 5TRBA 5LKXA 1WEQA 2ECVA 2YT5A 3O37A 2EA6A 2OXQC 2VP7A 2M3HA 1MM2A 1XWHA 3ZVYA 3QZVA 3T6RA 4WZ3B 4GNEA 2MD8C 2K1JA 4FO9A
chains in the Genus database with same CATH superfamily
2HDPA 4LKAA 1BORA 5K3QA 2MUMA 5H1TA 5TABA 1Z60A 2ZETC 3KV6A 2QIZA 1K2FA 3ZNIA 2L7PA 2JUNA 1JOCA 1T1HA 3KQIA 1FBVA 2UZGA 1HYJA 4P5OB 2EGPA 1FP0A 3O36A 4V3KC 2LN0A 1WFKA 4Z0RA 2MNZA 3ZYQA 2CKLB 1X4UA 5SVYA 1JM7A 3FL2A 2D8UA 3LDYA 4CA1A 3L1XA 5LCWB 1U6GB 2M13A 3PLWA 4PTBA 2LXHC 2CSZA 2XOZA 2CT2A 3MHSA 3LQIA 4TKPB 2L0BA 2VJEA 2MKEA 2YHOA 2ECWA 4ZUXU 3T7LA 3L1ZB 2KKXA 4R2YA 4ZQLA 3LRQA 5FB0A 3MDBC 5C11A 4YBMA 5B78A 5B77A 4FIPA 1CHCA 4IC3A 3SOUA 2CSYA 3ZVZB 3O7AA 4H9DA 1V87A 3DPLR 1F62A 2L43A 2MD7B 5EYAF 5KH7A 4B86C 2JMIA 4R7EA 2CRRA 2MA5A 2K4DA 2M6MA 3FJUB 3KNVA 3C6WA 3KV5A 4UI9B 2YHNA 1JM7B 2YW8A 2KKYA 1MBMA 2FSAA 2KU3A 1WENA 2VPGA 3ZPV1 2HYED 1WGMA 3U5PA 2LGKA 2CRWA 2VJEB 3PHDA 2KWJA 2LXPC 2YREA 3HCSA 3DDTA 4L58A 2EGMA 2L75A 2XOCA 5DINA 4I7DA 3M62A 5TBNA 5D1LB 5C13A 2L80A 4UP5A 4S3OC 2PUYA 2CONA 2JMJA 3N9OA 2ECJA 4YBTA 2VNFA 2KR4A 2QICA 5B75A 1WEPA 3C5KA 1LDJB 3HCTA 5AIUA 4I7CA 2I50A 4AP4A 1VYXA 4OGCA 2K16A 3HTKC 4QQ4A 3I2DA 4F1PA 4IC2A 4YAXA 3LQJA 4LK9A 4N3WA 2XB1A 3U5NA 1X4JA 2K17A 2MT5A 4FJCA 1E4UA 2C2VS 2IQJA 2M1RA 4OGEA 1WE9A 2Y1NA 3M7KA 3N9QA 1N87A 2Y1MA 3T9KA 3LVRE 2YQMA 3N9NA 5LKUA 2G6QA 3VK6A 5SVIA 2BAYA 3O47A 3SOWA 2YUCA 4C9ZA 3DWDA 2YSMA 3L11A 2H0DA 2YU4A 3E2DA 2ECTA 2MA6A 3O70A 3NG2A 5B76A 2DJAA 4N4FA 2DX8A 4LJNA 1IYMA 2LRIC 2LDRA 3EB5A 5KH9A 4A49A 5G05B 1WILA 2KWOA 2LGLA 2JMDA 1G25A 5I3LA 2RR4A 4S3OB 4W4UA 1MM3A 5LKZA 4L7XA 3DQVR 2F6JA 4LADB 1ZBDB 2G43A 2KFTA 2YQLA 2DSMA 2MNYA 4V3LC 2B0OE 3GL6A 1VFYA 2NAAA 5H9MA 4YBSA 2JM3A 2L5UA 2FUIA 5DKAA 5D1KB 2XEUA 5D1MB 3FANA 3O33A 4BHWA 3LJUX 5J3XA 1WEEA 4MSXA 2LV9A 4GNGA 5TDWA 4ZDTA 5AITA 3N9PA 3N9LA 2KWNA 3LQHA 1WEMA 5SVIB 3SHBA 2KIZA 2LGVA 4YATA 2IDAA 4XI1A 4F52B 5B8DA 2H0DB 2ECIA 4I7BA 4YABA 4X3GA 4GNFA 2VPBA 4WZ2A 2E6RA 3ASLA 2C2LA 5SVXA 4AUQB 3SOXA 1HYIA 4YC9A 1VD4A 4O64A 3O34A 3H7HA 2D8SA 4MVTA 2M85A 1WEVA 4CCGX 4R8PK 2LQ6A 4WA6A 3FEHA 3RPGB 1WEOA 4AVXA 2EODA 4BBQA 2VJFA 3JUEA 5JG6A 2QJ0A 5TDRA 4A0CD 2PNXA 2YYRA 4YADA 3FM8C 1RMDA 1DVPA 2RSDA 2XOYA 3O35A 4FK5A 3M63A 2F6NA 3PUQA 2VPDA 4B7YC 5H1UA 2YVRA 2LGGA 1X4IA 4AYCA 5FERA 5G0FA 3FAOA 3ZTGA 3KDEC 2RI7A 4Q6FA 5KH3A 2KE1A 3M99A 4GB0A 3RTRB 2KGGA 2YURA 2P57A 5FB1A 2OWAA 2KYUA 3IHPA 3Q1DA 2FFWA 4GNDA 1DCQA 2KREA 5LKTA 1LDKC 2FUUA 2JRJA 1WIMA 1Z6UA 4A4CA 4LLBA 3V43A 5FEYA 3RPGC 3ZPVE 2XP0A 1Z2QA 5G04B 4O62A 2KWKA 3GV4A 2G45A 4WZ0A 2E6SA 4PPEA 3U5MA 3PURA 4NN2A 2VJFB 1WEWA 4QF3A 2LAUA 2AN6A 3LVQE 2KGIA 4UP0A 3EB6A 4QF2A 2ECNA 1WESA 2CKLA 5B79A 2FD4A 2MIQA 2VPEA 3MHHA 3U5OA 2ECGA 3N9MA 4A4BA 2F42A 1WEUA 4AYCB 2YSJA 2Y43A 3SUBA 5H1VA 2EXUA 3HCUA 5TRBA 5LKXA 2E61A 2CSVA 1WEQA 2ECVA 2YT5A 3O37A 2EA6A 2OXQC 2VP7A 2M3HA 4Z0OA 1MM2A 1XWHA 3ZVYA 3QZVA 3T6RA 4WZ3B 4GNEA 2MD8C 2K1JA 4FO9A
chains in the Genus database with same CATH topology
2HDPA 4LKAA 1BORA 5H1TA 2MUMA 5TABA 1Z60A 2ZETC 3KV6A 2QIZA 1K2FA 3ZNIA 1JOCA 1T1HA 3KQIA 1FBVA 2UZGA 1HYJA 4P5OB 2EGPA 1FP0A 3O36A 4V3KC 2LN0A 1WFKA 2MNZA 3ZYQA 2CKLB 1X4UA 1JM7A 3FL2A 4CA1A 3L1XA 5LCWB 1U6GB 4PTBA 2LXHC 2CSZA 2CT2A 3MHSA 3LQIA 4TKPB 2L0BA 2VJEA 2YHOA 2ECWA 4ZUXU 3T7LA 3L1ZB 4R2YA 4ZQLA 3LRQA 5FB0A 5C11A 4YBMA 5B78A 5B77A 4FIPA 1CHCA 4IC3A 3SOUA 2CSYA 3ZVZB 3O7AA 1V87A 3DPLR 1F62A 2L43A 2MD7B 5EYAF 5KH7A 4B86C 2JMIA 4R7EA 2MA5A 2K4DA 2M6MA 3KNVA 3C6WA 3KV5A 4UI9B 2YHNA 1JM7B 2YW8A 2FSAA 2KU3A 1WENA 2VPGA 3ZPV1 2HYED 1WGMA 3U5PA 2LGKA 2VJEB 3PHDA 2KWJA 2LXPC 2YREA 3HCSA 4L58A 2L75A 5DINA 4I7DA 3M62A 5TBNA 5D1LB 5C13A 2L80A 4UP5A 4S3OC 2PUYA 2JMJA 3N9OA 2ECJA 4YBTA 2VNFA 2KR4A 2QICA 5B75A 1WEPA 3C5KA 1LDJB 3HCTA 5AIUA 4I7CA 2I50A 4AP4A 1VYXA 2K16A 3HTKC 3I2DA 4IC2A 4YAXA 3LQJA 4LK9A 4N3WA 2XB1A 3U5NA 1X4JA 2K17A 2MT5A 4FJCA 1E4UA 2C2VS 2M1RA 1WE9A 2Y1NA 3N9QA 1N87A 2Y1MA 2YQMA 3N9NA 5LKUA 2G6QA 3VK6A 2BAYA 3SOWA 2YUCA 4C9ZA 2YSMA 3L11A 2H0DA 2YU4A 2ECTA 2MA6A 3O70A 3NG2A 5B76A 4N4FA 2DX8A 4LJNA 1IYMA 2LRIC 2LDRA 3EB5A 5KH9A 4A49A 5G05B 1WILA 2KWOA 2LGLA 2JMDA 1G25A 5I3LA 4S3OB 4W4UA 1MM3A 5LKZA 4L7XA 3DQVR 2F6JA 4LADB 1ZBDB 2G43A 2KFTA 2YQLA 2MNYA 4V3LC 3GL6A 1VFYA 2NAAA 5H9MA 4YBSA 2L5UA 2FUIA 5DKAA 5D1KB 2XEUA 5D1MB 3O33A 4BHWA 5J3XA 1WEEA 4MSXA 2LV9A 4GNGA 5TDWA 4ZDTA 5AITA 3N9PA 3N9LA 2KWNA 3LQHA 1WEMA 3SHBA 2KIZA 2LGVA 4YATA 2IDAA 4XI1A 4F52B 5B8DA 2H0DB 2ECIA 4I7BA 4YABA 4X3GA 4GNFA 2VPBA 4WZ2A 2E6RA 3ASLA 2C2LA 1HYIA 4AUQB 3SOXA 4YC9A 1VD4A 4O64A 3O34A 4MVTA 2D8SA 2M85A 1WEVA 4CCGX 4R8PK 2LQ6A 4WA6A 3RPGB 1WEOA 4AVXA 2EODA 4BBQA 2VJFA 5JG6A 2QJ0A 5TDRA 4A0CD 2PNXA 2YYRA 4YADA 1RMDA 1DVPA 2RSDA 3O35A 4FK5A 3M63A 2F6NA 3PUQA 2VPDA 4B7YC 5H1UA 2LGGA 1X4IA 4AYCA 5FERA 5G0FA 3ZTGA 2RI7A 4Q6FA 5KH3A 2KE1A 3M99A 4GB0A 3RTRB 2KGGA 2YURA 5FB1A 2KYUA 3IHPA 4GNDA 2KREA 5LKTA 1LDKC 2FUUA 2JRJA 1WIMA 1Z6UA 4A4CA 4LLBA 3V43A 5FEYA 3RPGC 3ZPVE 1Z2QA 5G04B 2KWKA 3GV4A 2G45A 4WZ0A 2E6SA 4PPEA 3U5MA 3PURA 4NN2A 2VJFB 1WEWA 4QF3A 2AN6A 2KGIA 4UP0A 3EB6A 4QF2A 2ECNA 1WESA 2CKLA 5B79A 2MIQA 2VPEA 3MHHA 3U5OA 2ECGA 3N9MA 4A4BA 2F42A 1WEUA 4AYCB 2YSJA 2Y43A 5H1VA 3HCUA 5TRBA 5LKXA 1WEQA 2ECVA 2YT5A 3O37A 2EA6A 2OXQC 2VP7A 2M3HA 1MM2A 1XWHA 3ZVYA 3QZVA 3T6RA 4WZ3B 4GNEA 2MD8C 2K1JA 4FO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDP A;  4LKA A;  1BOR A;  5H1T A;  2MUM A;  5TAB A;  1Z60 A;  2ZET C;  3KV6 A;  2QIZ A;  1K2F A;  3ZNI A;  1JOC A;  1T1H A;  3KQI A;  1FBV A;  2UZG A;  1HYJ A;  4P5O B;  2EGP A;  1FP0 A;  3O36 A;  4V3K C;  2LN0 A;  1WFK A;  2MNZ A;  3ZYQ A;  2CKL B;  1X4U A;  1JM7 A;  3FL2 A;  4CA1 A;  3L1X A;  5LCW B;  1U6G B;  4PTB A;  2LXH C;  2CSZ A;  2CT2 A;  3MHS A;  3LQI A;  4TKP B;  2L0B A;  2VJE A;  2YHO A;  2ECW A;  4ZUX U;  3T7L A;  3L1Z B;  4R2Y A;  4ZQL A;  3LRQ A;  5FB0 A;  5C11 A;  4YBM A;  5B78 A;  5B77 A;  4FIP A;  1CHC A;  4IC3 A;  3SOU A;  2CSY A;  3ZVZ B;  3O7A A;  1V87 A;  3DPL R;  1F62 A;  2L43 A;  2MD7 B;  5EYA F;  5KH7 A;  4B86 C;  2JMI A;  4R7E A;  2MA5 A;  2K4D A;  2M6M A;  3KNV A;  3C6W A;  3KV5 A;  4UI9 B;  2YHN A;  1JM7 B;  2YW8 A;  2FSA A;  2KU3 A;  1WEN A;  2VPG A;  3ZPV 1;  2HYE D;  1WGM A;  3U5P A;  2LGK A;  2VJE B;  3PHD A;  2KWJ A;  2LXP C;  2YRE A;  3HCS A;  4L58 A;  2L75 A;  5DIN A;  4I7D A;  3M62 A;  5TBN A;  5D1L B;  5C13 A;  2L80 A;  4UP5 A;  4S3O C;  2PUY A;  2JMJ A;  3N9O A;  2ECJ A;  4YBT A;  2VNF A;  2KR4 A;  2QIC A;  5B75 A;  1WEP A;  3C5K A;  1LDJ B;  3HCT A;  5AIU A;  4I7C A;  2I50 A;  4AP4 A;  1VYX A;  2K16 A;  3HTK C;  3I2D A;  4IC2 A;  4YAX A;  3LQJ A;  4LK9 A;  4N3W A;  2XB1 A;  3U5N A;  1X4J A;  2K17 A;  2MT5 A;  4FJC A;  1E4U A;  2C2V S;  2M1R A;  1WE9 A;  2Y1N A;  3N9Q A;  1N87 A;  2Y1M A;  2YQM A;  3N9N A;  5LKU A;  2G6Q A;  3VK6 A;  2BAY A;  3SOW A;  2YUC A;  4C9Z A;  2YSM A;  3L11 A;  2H0D A;  2YU4 A;  2ECT A;  2MA6 A;  3O70 A;  3NG2 A;  5B76 A;  4N4F A;  2DX8 A;  4LJN A;  1IYM A;  2LRI C;  2LDR A;  3EB5 A;  5KH9 A;  4A49 A;  5G05 B;  1WIL A;  2KWO A;  2LGL A;  2JMD A;  1G25 A;  5I3L A;  4S3O B;  4W4U A;  1MM3 A;  5LKZ A;  4L7X A;  3DQV R;  2F6J A;  4LAD B;  1ZBD B;  2G43 A;  2KFT A;  2YQL A;  2MNY A;  4V3L C;  3GL6 A;  1VFY A;  2NAA A;  5H9M A;  4YBS A;  2L5U A;  2FUI A;  5DKA A;  5D1K B;  2XEU A;  5D1M B;  3O33 A;  4BHW A;  5J3X A;  1WEE A;  4MSX A;  2LV9 A;  4GNG A;  5TDW A;  4ZDT A;  5AIT A;  3N9P A;  3N9L A;  2KWN A;  3LQH A;  1WEM A;  3SHB A;  2KIZ A;  2LGV A;  4YAT A;  2IDA A;  4XI1 A;  4F52 B;  5B8D A;  2H0D B;  2ECI A;  4I7B A;  4YAB A;  4X3G A;  4GNF A;  2VPB A;  4WZ2 A;  2E6R A;  3ASL A;  2C2L A;  1HYI A;  4AUQ B;  3SOX A;  4YC9 A;  1VD4 A;  4O64 A;  3O34 A;  4MVT A;  2D8S A;  2M85 A;  1WEV A;  4CCG X;  4R8P K;  2LQ6 A;  4WA6 A;  3RPG B;  1WEO A;  4AVX A;  2EOD A;  4BBQ A;  2VJF A;  5JG6 A;  2QJ0 A;  5TDR A;  4A0C D;  2PNX A;  2YYR A;  4YAD A;  1RMD A;  1DVP A;  2RSD A;  3O35 A;  4FK5 A;  3M63 A;  2F6N A;  3PUQ A;  2VPD A;  4B7Y C;  5H1U A;  2LGG A;  1X4I A;  4AYC A;  5FER A;  5G0F A;  3ZTG A;  2RI7 A;  4Q6F A;  5KH3 A;  2KE1 A;  3M99 A;  4GB0 A;  3RTR B;  2KGG A;  2YUR A;  5FB1 A;  2KYU A;  3IHP A;  4GND A;  2KRE A;  5LKT A;  1LDK C;  2FUU A;  2JRJ A;  1WIM A;  1Z6U A;  4A4C A;  4LLB A;  3V43 A;  5FEY A;  3RPG C;  3ZPV E;  1Z2Q A;  5G04 B;  2KWK A;  3GV4 A;  2G45 A;  4WZ0 A;  2E6S A;  4PPE A;  3U5M A;  3PUR A;  4NN2 A;  2VJF B;  1WEW A;  4QF3 A;  2AN6 A;  2KGI A;  4UP0 A;  3EB6 A;  4QF2 A;  2ECN A;  1WES A;  2CKL A;  5B79 A;  2MIQ A;  2VPE A;  3MHH A;  3U5O A;  2ECG A;  3N9M A;  4A4B A;  2F42 A;  1WEU A;  4AYC B;  2YSJ A;  2Y43 A;  5H1V A;  3HCU A;  5TRB A;  5LKX A;  1WEQ A;  2ECV A;  2YT5 A;  3O37 A;  2EA6 A;  2OXQ C;  2VP7 A;  2M3H A;  1MM2 A;  1XWH A;  3ZVY A;  3QZV A;  3T6R A;  4WZ3 B;  4GNE A;  2MD8 C;  2K1J A;  4FO9 A; 
#chains in the Genus database with same CATH topology
 2HDP A;  4LKA A;  1BOR A;  5K3Q A;  2MUM A;  5H1T A;  5TAB A;  1Z60 A;  2ZET C;  3KV6 A;  2QIZ A;  1K2F A;  3ZNI A;  2L7P A;  2JUN A;  1JOC A;  1T1H A;  3KQI A;  1FBV A;  2UZG A;  1HYJ A;  4P5O B;  2EGP A;  1FP0 A;  3O36 A;  4V3K C;  2LN0 A;  1WFK A;  4Z0R A;  2MNZ A;  3ZYQ A;  2CKL B;  1X4U A;  5SVY A;  1JM7 A;  3FL2 A;  2D8U A;  3LDY A;  4CA1 A;  3L1X A;  5LCW B;  1U6G B;  2M13 A;  3PLW A;  4PTB A;  2LXH C;  2CSZ A;  2XOZ A;  2CT2 A;  3MHS A;  3LQI A;  4TKP B;  2L0B A;  2VJE A;  2MKE A;  2YHO A;  2ECW A;  4ZUX U;  3T7L A;  3L1Z B;  2KKX A;  4R2Y A;  4ZQL A;  3LRQ A;  5FB0 A;  3MDB C;  5C11 A;  4YBM A;  5B78 A;  5B77 A;  4FIP A;  1CHC A;  4IC3 A;  3SOU A;  2CSY A;  3ZVZ B;  3O7A A;  4H9D A;  1V87 A;  3DPL R;  1F62 A;  2L43 A;  2MD7 B;  5EYA F;  5KH7 A;  4B86 C;  2JMI A;  4R7E A;  2CRR A;  2MA5 A;  2K4D A;  2M6M A;  3FJU B;  3KNV A;  3C6W A;  3KV5 A;  4UI9 B;  2YHN A;  1JM7 B;  2YW8 A;  2KKY A;  1MBM A;  2FSA A;  2KU3 A;  1WEN A;  2VPG A;  3ZPV 1;  2HYE D;  1WGM A;  3U5P A;  2LGK A;  2CRW A;  2VJE B;  3PHD A;  2KWJ A;  2LXP C;  2YRE A;  3HCS A;  3DDT A;  4L58 A;  2EGM A;  2L75 A;  2XOC A;  5DIN A;  4I7D A;  3M62 A;  5TBN A;  5D1L B;  5C13 A;  2L80 A;  4UP5 A;  4S3O C;  2PUY A;  2CON A;  2JMJ A;  3N9O A;  2ECJ A;  4YBT A;  2VNF A;  2KR4 A;  2QIC A;  5B75 A;  1WEP A;  3C5K A;  1LDJ B;  3HCT A;  5AIU A;  4I7C A;  2I50 A;  4AP4 A;  1VYX A;  4OGC A;  2K16 A;  3HTK C;  4QQ4 A;  3I2D A;  4F1P A;  4IC2 A;  4YAX A;  3LQJ A;  4LK9 A;  4N3W A;  2XB1 A;  3U5N A;  1X4J A;  2K17 A;  2MT5 A;  4FJC A;  1E4U A;  2C2V S;  2IQJ A;  2M1R A;  4OGE A;  1WE9 A;  2Y1N A;  3M7K A;  3N9Q A;  1N87 A;  2Y1M A;  3T9K A;  3LVR E;  2YQM A;  3N9N A;  5LKU A;  2G6Q A;  3VK6 A;  5SVI A;  2BAY A;  3O47 A;  3SOW A;  2YUC A;  4C9Z A;  3DWD A;  2YSM A;  3L11 A;  2H0D A;  2YU4 A;  3E2D A;  2ECT A;  2MA6 A;  3O70 A;  3NG2 A;  5B76 A;  2DJA A;  4N4F A;  2DX8 A;  4LJN A;  1IYM A;  2LRI C;  2LDR A;  3EB5 A;  5KH9 A;  4A49 A;  5G05 B;  1WIL A;  2KWO A;  2LGL A;  2JMD A;  1G25 A;  5I3L A;  2RR4 A;  4S3O B;  4W4U A;  1MM3 A;  5LKZ A;  4L7X A;  3DQV R;  2F6J A;  4LAD B;  1ZBD B;  2G43 A;  2KFT A;  2YQL A;  2DSM A;  2MNY A;  4V3L C;  2B0O E;  3GL6 A;  1VFY A;  2NAA A;  5H9M A;  4YBS A;  2JM3 A;  2L5U A;  2FUI A;  5DKA A;  5D1K B;  2XEU A;  5D1M B;  3FAN A;  3O33 A;  4BHW A;  3LJU X;  5J3X A;  1WEE A;  4MSX A;  2LV9 A;  4GNG A;  5TDW A;  4ZDT A;  5AIT A;  3N9P A;  3N9L A;  2KWN A;  3LQH A;  1WEM A;  5SVI B;  3SHB A;  2KIZ A;  2LGV A;  4YAT A;  2IDA A;  4XI1 A;  4F52 B;  5B8D A;  2H0D B;  2ECI A;  4I7B A;  4YAB A;  4X3G A;  4GNF A;  2VPB A;  4WZ2 A;  2E6R A;  3ASL A;  2C2L A;  5SVX A;  4AUQ B;  3SOX A;  1HYI A;  4YC9 A;  1VD4 A;  4O64 A;  3O34 A;  3H7H A;  2D8S A;  4MVT A;  2M85 A;  1WEV A;  4CCG X;  4R8P K;  2LQ6 A;  4WA6 A;  3FEH A;  3RPG B;  1WEO A;  4AVX A;  2EOD A;  4BBQ A;  2VJF A;  3JUE A;  5JG6 A;  2QJ0 A;  5TDR A;  4A0C D;  2PNX A;  2YYR A;  4YAD A;  3FM8 C;  1RMD A;  1DVP A;  2RSD A;  2XOY A;  3O35 A;  4FK5 A;  3M63 A;  2F6N A;  3PUQ A;  2VPD A;  4B7Y C;  5H1U A;  2YVR A;  2LGG A;  1X4I A;  4AYC A;  5FER A;  5G0F A;  3FAO A;  3ZTG A;  3KDE C;  2RI7 A;  4Q6F A;  5KH3 A;  2KE1 A;  3M99 A;  4GB0 A;  3RTR B;  2KGG A;  2YUR A;  2P57 A;  5FB1 A;  2OWA A;  2KYU A;  3IHP A;  3Q1D A;  2FFW A;  4GND A;  1DCQ A;  2KRE A;  5LKT A;  1LDK C;  2FUU A;  2JRJ A;  1WIM A;  1Z6U A;  4A4C A;  4LLB A;  3V43 A;  5FEY A;  3RPG C;  3ZPV E;  2XP0 A;  1Z2Q A;  5G04 B;  4O62 A;  2KWK A;  3GV4 A;  2G45 A;  4WZ0 A;  2E6S A;  4PPE A;  3U5M A;  3PUR A;  4NN2 A;  2VJF B;  1WEW A;  4QF3 A;  2LAU A;  2AN6 A;  3LVQ E;  2KGI A;  4UP0 A;  3EB6 A;  4QF2 A;  2ECN A;  1WES A;  2CKL A;  5B79 A;  2FD4 A;  2MIQ A;  2VPE A;  3MHH A;  3U5O A;  2ECG A;  3N9M A;  4A4B A;  2F42 A;  1WEU A;  4AYC B;  2YSJ A;  2Y43 A;  3SUB A;  5H1V A;  2EXU A;  3HCU A;  5TRB A;  5LKX A;  2E61 A;  2CSV A;  1WEQ A;  2ECV A;  2YT5 A;  3O37 A;  2EA6 A;  2OXQ C;  2VP7 A;  2M3H A;  4Z0O A;  1MM2 A;  1XWH A;  3ZVY A;  3QZV A;  3T6R A;  4WZ3 B;  4GNE A;  2MD8 C;  2K1J A;  4FO9 A; 
#chains in the Genus database with same CATH homology
 2HDP A;  4LKA A;  1BOR A;  5H1T A;  2MUM A;  5TAB A;  1Z60 A;  2ZET C;  3KV6 A;  2QIZ A;  1K2F A;  3ZNI A;  1JOC A;  1T1H A;  3KQI A;  1FBV A;  2UZG A;  1HYJ A;  4P5O B;  2EGP A;  1FP0 A;  3O36 A;  4V3K C;  2LN0 A;  1WFK A;  2MNZ A;  3ZYQ A;  2CKL B;  1X4U A;  1JM7 A;  3FL2 A;  4CA1 A;  3L1X A;  5LCW B;  1U6G B;  4PTB A;  2LXH C;  2CSZ A;  2CT2 A;  3MHS A;  3LQI A;  4TKP B;  2L0B A;  2VJE A;  2YHO A;  2ECW A;  4ZUX U;  3T7L A;  3L1Z B;  4R2Y A;  4ZQL A;  3LRQ A;  5FB0 A;  5C11 A;  4YBM A;  5B78 A;  5B77 A;  4FIP A;  1CHC A;  4IC3 A;  3SOU A;  2CSY A;  3ZVZ B;  3O7A A;  1V87 A;  3DPL R;  1F62 A;  2L43 A;  2MD7 B;  5EYA F;  5KH7 A;  4B86 C;  2JMI A;  4R7E A;  2MA5 A;  2K4D A;  2M6M A;  3KNV A;  3C6W A;  3KV5 A;  4UI9 B;  2YHN A;  1JM7 B;  2YW8 A;  2FSA A;  2KU3 A;  1WEN A;  2VPG A;  3ZPV 1;  2HYE D;  1WGM A;  3U5P A;  2LGK A;  2VJE B;  3PHD A;  2KWJ A;  2LXP C;  2YRE A;  3HCS A;  4L58 A;  2L75 A;  5DIN A;  4I7D A;  3M62 A;  5TBN A;  5D1L B;  5C13 A;  2L80 A;  4UP5 A;  4S3O C;  2PUY A;  2JMJ A;  3N9O A;  2ECJ A;  4YBT A;  2VNF A;  2KR4 A;  2QIC A;  5B75 A;  1WEP A;  3C5K A;  1LDJ B;  3HCT A;  5AIU A;  4I7C A;  2I50 A;  4AP4 A;  1VYX A;  2K16 A;  3HTK C;  3I2D A;  4IC2 A;  4YAX A;  3LQJ A;  4LK9 A;  4N3W A;  2XB1 A;  3U5N A;  1X4J A;  2K17 A;  2MT5 A;  4FJC A;  1E4U A;  2C2V S;  2M1R A;  1WE9 A;  2Y1N A;  3N9Q A;  1N87 A;  2Y1M A;  2YQM A;  3N9N A;  5LKU A;  2G6Q A;  3VK6 A;  2BAY A;  3SOW A;  2YUC A;  4C9Z A;  2YSM A;  3L11 A;  2H0D A;  2YU4 A;  2ECT A;  2MA6 A;  3O70 A;  3NG2 A;  5B76 A;  4N4F A;  2DX8 A;  4LJN A;  1IYM A;  2LRI C;  2LDR A;  3EB5 A;  5KH9 A;  4A49 A;  5G05 B;  1WIL A;  2KWO A;  2LGL A;  2JMD A;  1G25 A;  5I3L A;  4S3O B;  4W4U A;  1MM3 A;  5LKZ A;  4L7X A;  3DQV R;  2F6J A;  4LAD B;  1ZBD B;  2G43 A;  2KFT A;  2YQL A;  2MNY A;  4V3L C;  3GL6 A;  1VFY A;  2NAA A;  5H9M A;  4YBS A;  2L5U A;  2FUI A;  5DKA A;  5D1K B;  2XEU A;  5D1M B;  3O33 A;  4BHW A;  5J3X A;  1WEE A;  4MSX A;  2LV9 A;  4GNG A;  5TDW A;  4ZDT A;  5AIT A;  3N9P A;  3N9L A;  2KWN A;  3LQH A;  1WEM A;  3SHB A;  2KIZ A;  2LGV A;  4YAT A;  2IDA A;  4XI1 A;  4F52 B;  5B8D A;  2H0D B;  2ECI A;  4I7B A;  4YAB A;  4X3G A;  4GNF A;  2VPB A;  4WZ2 A;  2E6R A;  3ASL A;  2C2L A;  1HYI A;  4AUQ B;  3SOX A;  4YC9 A;  1VD4 A;  4O64 A;  3O34 A;  4MVT A;  2D8S A;  2M85 A;  1WEV A;  4CCG X;  4R8P K;  2LQ6 A;  4WA6 A;  3RPG B;  1WEO A;  4AVX A;  2EOD A;  4BBQ A;  2VJF A;  5JG6 A;  2QJ0 A;  5TDR A;  4A0C D;  2PNX A;  2YYR A;  4YAD A;  1RMD A;  1DVP A;  2RSD A;  3O35 A;  4FK5 A;  3M63 A;  2F6N A;  3PUQ A;  2VPD A;  4B7Y C;  5H1U A;  2LGG A;  1X4I A;  4AYC A;  5FER A;  5G0F A;  3ZTG A;  2RI7 A;  4Q6F A;  5KH3 A;  2KE1 A;  3M99 A;  4GB0 A;  3RTR B;  2KGG A;  2YUR A;  5FB1 A;  2KYU A;  3IHP A;  4GND A;  2KRE A;  5LKT A;  1LDK C;  2FUU A;  2JRJ A;  1WIM A;  1Z6U A;  4A4C A;  4LLB A;  3V43 A;  5FEY A;  3RPG C;  3ZPV E;  1Z2Q A;  5G04 B;  2KWK A;  3GV4 A;  2G45 A;  4WZ0 A;  2E6S A;  4PPE A;  3U5M A;  3PUR A;  4NN2 A;  2VJF B;  1WEW A;  4QF3 A;  2AN6 A;  2KGI A;  4UP0 A;  3EB6 A;  4QF2 A;  2ECN A;  1WES A;  2CKL A;  5B79 A;  2MIQ A;  2VPE A;  3MHH A;  3U5O A;  2ECG A;  3N9M A;  4A4B A;  2F42 A;  1WEU A;  4AYC B;  2YSJ A;  2Y43 A;  5H1V A;  3HCU A;  5TRB A;  5LKX A;  1WEQ A;  2ECV A;  2YT5 A;  3O37 A;  2EA6 A;  2OXQ C;  2VP7 A;  2M3H A;  1MM2 A;  1XWH A;  3ZVY A;  3QZV A;  3T6R A;  4WZ3 B;  4GNE A;  2MD8 C;  2K1J A;  4FO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...