2K1JA

Plan homeodomain finger of tumour supressor ing4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
63
structure length
63
Chain Sequence
MDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure and NMR characterization of the binding to methylated histone tails of the plant homeodomain finger of the tumour suppressor ING4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Inhibitor of growth protein 4
total genus 2
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k1jA00
5B79A 1VYXA 2MD7B 1WILA 3I2DA 3HCTA 5TDRA 3ZPV1 1WIMA 2CSYA 1Z60A 4F52B 4BBQA 4LADB 4LJNA 1WEPA 1WEVA 1XWHA 3M99A 5H1VA 2D8SA 4UI9B 2LXHC 3C5KA 2KGIA 3M63A 3U5MA 2JMIA 5LCWB 1WFKA 3T7LA 3O33A 1Z6UA 5G0FA 2L5UA 3NG2A 2VJEB 2FSAA 2MA5A 2K4DA 5TBNA 3RTRB 1G25A 5B75A 1FP0A 2YHOA 3L1XA 5FB0A 2QIZA 2ECNA 3N9MA 4PTBA 2M6MA 4B7YC 4GNGA 2RSDA 3MHSA 4V3LC 1WE9A 2M1RA 2MA6A 2JMJA 5LKXA 1IYMA 2MT5A 3SOUA 4I7DA 2LGLA 5B77A 3N9NA 3SOXA 4FIPA 4I7CA 3ZVZB 4WZ2A 4UP0A 2KWOA 2ECGA 3PHDA 2JMDA 2VJEA 2VPDA 2L43A 2OXQC 1WENA 2KIZA 5I3LA 3N9LA 1RMDA 2YSMA 2ECJA 3KV5A 4PPEA 4CA1A 2G6QA 3N9QA 2VPBA 2KR4A 2MUMA 2MIQA 2H0DB 2FUIA 3HTKC 2VJFA 3LRQA 2LN0A 4L7XA 3KNVA 1F62A 4LKAA 2ZETC 1JM7B 3O35A 2QJ0A 2MNZA 1HYJA 2L80A 3ZVYA 2AN6A 4V3KC 4TKPB 1WGMA 3L1ZB 3O34A 2KWKA 3U5NA 4R8PK 2LQ6A 3EB6A 3IHPA 3KV6A 4C9ZA 3L11A 2KREA 1VFYA 2LRIC 4AYCB 2YHNA 5DKAA 2F6JA 4X3GA 1MM2A 2MD8C 1JOCA 5B8DA 1LDJB 3ZNIA 1U6GB 5KH3A 3LQHA 2VPEA 2YSJA 4WZ3B 1WEEA 5D1MB 1VD4A 1FBVA 1JM7A 5B76A 2YQLA 2CSZA 2E6RA 5D1KB 2DX8A 2L0BA 2YREA 2YU4A 2EODA 4FO9A 1HYIA 1WEWA 2VJFB 2PUYA 2G45A 2CKLA 2LDRA 2H0DA 3KQIA 2M85A 3GV4A 4A4BA 5DINA 3O37A 2VP7A 1V87A 2ECIA 2YW8A 4LK9A 2YT5A 4ZUXU 4AP4A 2Y1NA 2Y43A 4YBSA 3HCUA 4QF3A 3O7AA 2HYED 2ECWA 1E4UA 3ZTGA 5TRBA 3C6WA 4L58A 5FERA 2ECVA 3RPGC 2M3HA 4BHWA 1LDKC 4IC2A 3U5PA 2BAYA 4CCGX 2LV9A 2XB1A 4MSXA 3FL2A 4UP5A 2LGVA 3O36A 3ASLA 4W4UA 4YBMA 1X4IA 2RI7A 5EYAF 5TDWA 4N4FA 1BORA 4A4CA 2KFTA 1Z2QA 3ZPVE 4GNDA 3HCSA 4LLBA 4YC9A 5G04B 1CHCA 3VK6A 2JRJA 5B78A 2MNYA 1WESA 4NN2A 2I50A 5AITA 2KWNA 5H1UA 2E6SA 5H9MA 3DQVR 3PUQA 4IC3A 4YADA 3M62A 2Y1MA 4R2YA 3U5OA 4AYCA 2EA6A 4P5OB 1WEMA 4GNEA 5TABA 5C13A 5FB1A 2C2VS 5JG6A 2KU3A 4S3OB 4XI1A 3N9OA 4GB0A 4MVTA 5LKTA 2F42A 4R7EA 2YYRA 2IDAA 2CT2A 5AIUA 2KYUA 1ZBDB 5J3XA 4AUQB 1X4UA 2CKLB 3PURA 4S3OC 1MM3A 4GNFA 4ZDTA 1X4JA 4N3WA 1N87A 2KE1A 5C11A 2UZGA 3LQIA 3GL6A 3MHHA 2LGGA 3QZVA 4YAXA 2K17A 3ZYQA 4WA6A 2YUCA 4YBTA 1WEOA 1K2FA 2VNFA 4A49A 2K1JA 2PNXA 4B86C 4YABA 3SOWA 4Q6FA 4WZ0A 3O70A 3SHBA 1WEUA 5LKUA 2EGPA 3V43A 2LGKA 2VPGA 3DPLR 4ZQLA 2LXPC 4I7BA 2KWJA 2KGGA 2NAAA 5D1LB 4YATA 2QICA 2FUUA 2XEUA 4O64A 2HDPA 3LQJA 3N9PA 4FK5A 4FJCA 1WEQA 2C2LA 4AVXA 4A0CD 2YQMA 3T6RA 3EB5A 3RPGB 2K16A 2YURA 5FEYA 5LKZA 5KH7A 2G43A 4QF2A 2L75A 1T1HA 5H1TA 1DVPA 2F6NA 5G05B 2ECTA 5KH9A
chains in the Genus database with same CATH superfamily
5B79A 1VYXA 3I2DA 1WILA 3HCTA 2MD7B 5TDRA 3ZPV1 1WIMA 2CSYA 1Z60A 4F52B 4BBQA 3FAOA 4LADB 4LJNA 2JUNA 1WEPA 1WEVA 1XWHA 3M99A 5H1VA 2D8SA 4UI9B 3FJUB 2LAUA 2LXHC 3C5KA 2KGIA 3M63A 3U5MA 2JMIA 2XP0A 1WFKA 5LCWB 3T7LA 3O33A 1Z6UA 5G0FA 2L5UA 3Q1DA 3NG2A 2VJEB 2FSAA 2MA5A 2K4DA 5TBNA 3RTRB 1G25A 5B75A 1FP0A 2YHOA 5SVYA 3L1XA 5FB0A 3LVRE 2QIZA 4F1PA 2ECNA 3N9MA 4PTBA 3LJUX 4H9DA 3LDYA 2M6MA 4B7YC 4GNGA 2RSDA 3MHSA 4V3LC 1WE9A 2JM3A 2M1RA 2MA6A 2JMJA 5LKXA 1IYMA 2MT5A 3SOUA 4I7DA 2LGLA 5B77A 3LVQE 3E2DA 3N9NA 3SOXA 4FIPA 4I7CA 3ZVZB 4WZ2A 4UP0A 2KWOA 2ECGA 3PHDA 2JMDA 2VJEA 2VPDA 2L43A 2OXQC 1WENA 2KIZA 5I3LA 3N9LA 2FD4A 1RMDA 2YSMA 2ECJA 3FANA 3KV5A 4PPEA 3DWDA 4CA1A 2G6QA 3N9QA 2VPBA 2P57A 5SVIA 2KR4A 2MUMA 2MIQA 2H0DB 2L7PA 2FUIA 3HTKC 2VJFA 3LRQA 2LN0A 4L7XA 3KNVA 1F62A 4LKAA 2ZETC 1JM7B 3O35A 2QJ0A 2MNZA 1HYJA 2L80A 3ZVYA 2AN6A 4V3KC 2XOCA 4TKPB 1WGMA 3L1ZB 3O34A 2KWKA 4O62A 3U5NA 4R8PK 2LQ6A 1MBMA 3EB6A 3IHPA 2XOYA 3KV6A 4C9ZA 3L11A 2KREA 1VFYA 2LRIC 4AYCB 2YHNA 5DKAA 2F6JA 4X3GA 1MM2A 1JOCA 2MD8C 5B8DA 1LDJB 3ZNIA 1U6GB 5KH3A 3LQHA 2VPEA 2DSMA 2FFWA 2YSJA 4WZ3B 1WEEA 5D1MB 1VD4A 1FBVA 1JM7A 5B76A 2D8UA 2YQLA 2CONA 2CSZA 2E6RA 5D1KB 2DX8A 2L0BA 2YREA 2YU4A 2EODA 4FO9A 1HYIA 3JUEA 1WEWA 2VJFB 2PUYA 2G45A 2CKLA 2LDRA 2H0DA 3FM8C 2MKEA 3KQIA 2M85A 3GV4A 4A4BA 5DINA 3O37A 2VP7A 5SVXA 1V87A 2ECIA 2YW8A 4LK9A 2YT5A 4ZUXU 4AP4A 2Y1NA 2Y43A 4YBSA 3HCUA 4QF3A 3O7AA 2HYED 2ECWA 1E4UA 3ZTGA 5TRBA 3C6WA 4L58A 5FERA 2RR4A 2DJAA 2ECVA 3RPGC 2M3HA 4BHWA 1LDKC 4OGCA 2CRWA 2IQJA 4IC2A 3U5PA 2BAYA 4CCGX 2LV9A 2XB1A 4MSXA 3FL2A 4UP5A 2LGVA 3O36A 3ASLA 3H7HA 4W4UA 1X4IA 2M13A 2RI7A 5EYAF 4YBMA 3KDEC 2YVRA 5TDWA 4N4FA 1BORA 4A4CA 2KFTA 1Z2QA 3ZPVE 4GNDA 3HCSA 4LLBA 4YC9A 5G04B 1CHCA 3VK6A 2JRJA 5B78A 2MNYA 1WESA 4NN2A 2I50A 5AITA 2KWNA 2KKXA 5H1UA 2CSVA 5K3QA 2E6SA 5H9MA 3DQVR 3PUQA 4IC3A 4YADA 3M62A 3O47A 2Y1MA 4R2YA 3U5OA 4AYCA 2EA6A 4P5OB 1WEMA 3FEHA 4GNEA 3M7KA 5TABA 5C13A 4Z0OA 5FB1A 2C2VS 5JG6A 2KU3A 2KKYA 4S3OB 4XI1A 2B0OE 3N9OA 5SVIB 3DDTA 4Z0RA 4GB0A 4MVTA 5LKTA 2F42A 4R7EA 2YYRA 2IDAA 2CT2A 5AIUA 2KYUA 1ZBDB 5J3XA 4AUQB 1X4UA 2CKLB 3PURA 4S3OC 4QQ4A 2OWAA 1MM3A 4GNFA 4ZDTA 1X4JA 4N3WA 1N87A 2KE1A 2E61A 5C11A 2UZGA 3LQIA 3GL6A 3MHHA 2LGGA 3QZVA 4YAXA 2K17A 3MDBC 3ZYQA 4WA6A 2YUCA 4YBTA 1WEOA 1K2FA 2VNFA 4A49A 2K1JA 2PNXA 4B86C 4YABA 3SOWA 2EGMA 4Q6FA 4WZ0A 3O70A 3SHBA 1WEUA 5LKUA 2EGPA 3V43A 2LGKA 2VPGA 4OGEA 3DPLR 4ZQLA 2EXUA 2LXPC 4I7BA 3T9KA 2KWJA 2KGGA 2NAAA 5D1LB 4YATA 3PLWA 2XOZA 2QICA 2FUUA 2XEUA 4O64A 2HDPA 3LQJA 3N9PA 4FK5A 4FJCA 1WEQA 2C2LA 4AVXA 3SUBA 4A0CD 2YQMA 1DCQA 3T6RA 3EB5A 3RPGB 2K16A 2YURA 5FEYA 5LKZA 2CRRA 5KH7A 2G43A 4QF2A 2L75A 1T1HA 5H1TA 1DVPA 2F6NA 5G05B 2ECTA 5KH9A
chains in the Genus database with same CATH topology
5B79A 1VYXA 2MD7B 1WILA 3I2DA 3HCTA 5TDRA 3ZPV1 1WIMA 2CSYA 1Z60A 4F52B 4BBQA 4LADB 4LJNA 1WEPA 1WEVA 1XWHA 3M99A 5H1VA 2D8SA 4UI9B 2LXHC 3C5KA 2KGIA 3M63A 3U5MA 2JMIA 5LCWB 1WFKA 3T7LA 3O33A 1Z6UA 5G0FA 2L5UA 3NG2A 2VJEB 2FSAA 2MA5A 2K4DA 5TBNA 3RTRB 1G25A 5B75A 1FP0A 2YHOA 3L1XA 5FB0A 2QIZA 2ECNA 3N9MA 4PTBA 2M6MA 4B7YC 4GNGA 2RSDA 3MHSA 4V3LC 1WE9A 2M1RA 2MA6A 2JMJA 5LKXA 1IYMA 2MT5A 3SOUA 4I7DA 2LGLA 5B77A 3N9NA 3SOXA 4FIPA 4I7CA 3ZVZB 4WZ2A 4UP0A 2KWOA 2ECGA 3PHDA 2JMDA 2VJEA 2VPDA 2L43A 2OXQC 1WENA 2KIZA 5I3LA 3N9LA 1RMDA 2YSMA 2ECJA 3KV5A 4PPEA 4CA1A 2G6QA 3N9QA 2VPBA 2KR4A 2MUMA 2MIQA 2H0DB 2FUIA 3HTKC 2VJFA 3LRQA 2LN0A 4L7XA 3KNVA 1F62A 4LKAA 2ZETC 1JM7B 3O35A 2QJ0A 2MNZA 1HYJA 2L80A 3ZVYA 2AN6A 4V3KC 4TKPB 1WGMA 3L1ZB 3O34A 2KWKA 3U5NA 4R8PK 2LQ6A 3EB6A 3IHPA 3KV6A 4C9ZA 3L11A 2KREA 1VFYA 2LRIC 4AYCB 2YHNA 5DKAA 2F6JA 4X3GA 1MM2A 2MD8C 1JOCA 5B8DA 1LDJB 3ZNIA 1U6GB 5KH3A 3LQHA 2VPEA 2YSJA 4WZ3B 1WEEA 5D1MB 1VD4A 1FBVA 1JM7A 5B76A 2YQLA 2CSZA 2E6RA 5D1KB 2DX8A 2L0BA 2YREA 2YU4A 2EODA 4FO9A 1HYIA 1WEWA 2VJFB 2PUYA 2G45A 2CKLA 2LDRA 2H0DA 3KQIA 2M85A 3GV4A 4A4BA 5DINA 3O37A 2VP7A 1V87A 2ECIA 2YW8A 4LK9A 2YT5A 4ZUXU 4AP4A 2Y1NA 2Y43A 4YBSA 3HCUA 4QF3A 3O7AA 2HYED 2ECWA 1E4UA 3ZTGA 5TRBA 3C6WA 4L58A 5FERA 2ECVA 3RPGC 2M3HA 4BHWA 1LDKC 4IC2A 3U5PA 2BAYA 4CCGX 2LV9A 2XB1A 4MSXA 3FL2A 4UP5A 2LGVA 3O36A 3ASLA 4W4UA 4YBMA 1X4IA 2RI7A 5EYAF 5TDWA 4N4FA 1BORA 4A4CA 2KFTA 1Z2QA 3ZPVE 4GNDA 3HCSA 4LLBA 4YC9A 5G04B 1CHCA 3VK6A 2JRJA 5B78A 2MNYA 1WESA 4NN2A 2I50A 5AITA 2KWNA 5H1UA 2E6SA 5H9MA 3DQVR 3PUQA 4IC3A 4YADA 3M62A 2Y1MA 4R2YA 3U5OA 4AYCA 2EA6A 4P5OB 1WEMA 4GNEA 5TABA 5C13A 5FB1A 2C2VS 5JG6A 2KU3A 4S3OB 4XI1A 3N9OA 4GB0A 4MVTA 5LKTA 2F42A 4R7EA 2YYRA 2IDAA 2CT2A 5AIUA 2KYUA 1ZBDB 5J3XA 4AUQB 1X4UA 2CKLB 3PURA 4S3OC 1MM3A 4GNFA 4ZDTA 1X4JA 4N3WA 1N87A 2KE1A 5C11A 2UZGA 3LQIA 3GL6A 3MHHA 2LGGA 3QZVA 4YAXA 2K17A 3ZYQA 4WA6A 2YUCA 4YBTA 1WEOA 1K2FA 2VNFA 4A49A 2K1JA 2PNXA 4B86C 4YABA 3SOWA 4Q6FA 4WZ0A 3O70A 3SHBA 1WEUA 5LKUA 2EGPA 3V43A 2LGKA 2VPGA 3DPLR 4ZQLA 2LXPC 4I7BA 2KWJA 2KGGA 2NAAA 5D1LB 4YATA 2QICA 2FUUA 2XEUA 4O64A 2HDPA 3LQJA 3N9PA 4FK5A 4FJCA 1WEQA 2C2LA 4AVXA 4A0CD 2YQMA 3T6RA 3EB5A 3RPGB 2K16A 2YURA 5FEYA 5LKZA 5KH7A 2G43A 4QF2A 2L75A 1T1HA 5H1TA 1DVPA 2F6NA 5G05B 2ECTA 5KH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B79 A;  1VYX A;  2MD7 B;  1WIL A;  3I2D A;  3HCT A;  5TDR A;  3ZPV 1;  1WIM A;  2CSY A;  1Z60 A;  4F52 B;  4BBQ A;  4LAD B;  4LJN A;  1WEP A;  1WEV A;  1XWH A;  3M99 A;  5H1V A;  2D8S A;  4UI9 B;  2LXH C;  3C5K A;  2KGI A;  3M63 A;  3U5M A;  2JMI A;  5LCW B;  1WFK A;  3T7L A;  3O33 A;  1Z6U A;  5G0F A;  2L5U A;  3NG2 A;  2VJE B;  2FSA A;  2MA5 A;  2K4D A;  5TBN A;  3RTR B;  1G25 A;  5B75 A;  1FP0 A;  2YHO A;  3L1X A;  5FB0 A;  2QIZ A;  2ECN A;  3N9M A;  4PTB A;  2M6M A;  4B7Y C;  4GNG A;  2RSD A;  3MHS A;  4V3L C;  1WE9 A;  2M1R A;  2MA6 A;  2JMJ A;  5LKX A;  1IYM A;  2MT5 A;  3SOU A;  4I7D A;  2LGL A;  5B77 A;  3N9N A;  3SOX A;  4FIP A;  4I7C A;  3ZVZ B;  4WZ2 A;  4UP0 A;  2KWO A;  2ECG A;  3PHD A;  2JMD A;  2VJE A;  2VPD A;  2L43 A;  2OXQ C;  1WEN A;  2KIZ A;  5I3L A;  3N9L A;  1RMD A;  2YSM A;  2ECJ A;  3KV5 A;  4PPE A;  4CA1 A;  2G6Q A;  3N9Q A;  2VPB A;  2KR4 A;  2MUM A;  2MIQ A;  2H0D B;  2FUI A;  3HTK C;  2VJF A;  3LRQ A;  2LN0 A;  4L7X A;  3KNV A;  1F62 A;  4LKA A;  2ZET C;  1JM7 B;  3O35 A;  2QJ0 A;  2MNZ A;  1HYJ A;  2L80 A;  3ZVY A;  2AN6 A;  4V3K C;  4TKP B;  1WGM A;  3L1Z B;  3O34 A;  2KWK A;  3U5N A;  4R8P K;  2LQ6 A;  3EB6 A;  3IHP A;  3KV6 A;  4C9Z A;  3L11 A;  2KRE A;  1VFY A;  2LRI C;  4AYC B;  2YHN A;  5DKA A;  2F6J A;  4X3G A;  1MM2 A;  2MD8 C;  1JOC A;  5B8D A;  1LDJ B;  3ZNI A;  1U6G B;  5KH3 A;  3LQH A;  2VPE A;  2YSJ A;  4WZ3 B;  1WEE A;  5D1M B;  1VD4 A;  1FBV A;  1JM7 A;  5B76 A;  2YQL A;  2CSZ A;  2E6R A;  5D1K B;  2DX8 A;  2L0B A;  2YRE A;  2YU4 A;  2EOD A;  4FO9 A;  1HYI A;  1WEW A;  2VJF B;  2PUY A;  2G45 A;  2CKL A;  2LDR A;  2H0D A;  3KQI A;  2M85 A;  3GV4 A;  4A4B A;  5DIN A;  3O37 A;  2VP7 A;  1V87 A;  2ECI A;  2YW8 A;  4LK9 A;  2YT5 A;  4ZUX U;  4AP4 A;  2Y1N A;  2Y43 A;  4YBS A;  3HCU A;  4QF3 A;  3O7A A;  2HYE D;  2ECW A;  1E4U A;  3ZTG A;  5TRB A;  3C6W A;  4L58 A;  5FER A;  2ECV A;  3RPG C;  2M3H A;  4BHW A;  1LDK C;  4IC2 A;  3U5P A;  2BAY A;  4CCG X;  2LV9 A;  2XB1 A;  4MSX A;  3FL2 A;  4UP5 A;  2LGV A;  3O36 A;  3ASL A;  4W4U A;  4YBM A;  1X4I A;  2RI7 A;  5EYA F;  5TDW A;  4N4F A;  1BOR A;  4A4C A;  2KFT A;  1Z2Q A;  3ZPV E;  4GND A;  3HCS A;  4LLB A;  4YC9 A;  5G04 B;  1CHC A;  3VK6 A;  2JRJ A;  5B78 A;  2MNY A;  1WES A;  4NN2 A;  2I50 A;  5AIT A;  2KWN A;  5H1U A;  2E6S A;  5H9M A;  3DQV R;  3PUQ A;  4IC3 A;  4YAD A;  3M62 A;  2Y1M A;  4R2Y A;  3U5O A;  4AYC A;  2EA6 A;  4P5O B;  1WEM A;  4GNE A;  5TAB A;  5C13 A;  5FB1 A;  2C2V S;  5JG6 A;  2KU3 A;  4S3O B;  4XI1 A;  3N9O A;  4GB0 A;  4MVT A;  5LKT A;  2F42 A;  4R7E A;  2YYR A;  2IDA A;  2CT2 A;  5AIU A;  2KYU A;  1ZBD B;  5J3X A;  4AUQ B;  1X4U A;  2CKL B;  3PUR A;  4S3O C;  1MM3 A;  4GNF A;  4ZDT A;  1X4J A;  4N3W A;  1N87 A;  2KE1 A;  5C11 A;  2UZG A;  3LQI A;  3GL6 A;  3MHH A;  2LGG A;  3QZV A;  4YAX A;  2K17 A;  3ZYQ A;  4WA6 A;  2YUC A;  4YBT A;  1WEO A;  1K2F A;  2VNF A;  4A49 A;  2K1J A;  2PNX A;  4B86 C;  4YAB A;  3SOW A;  4Q6F A;  4WZ0 A;  3O70 A;  3SHB A;  1WEU A;  5LKU A;  2EGP A;  3V43 A;  2LGK A;  2VPG A;  3DPL R;  4ZQL A;  2LXP C;  4I7B A;  2KWJ A;  2KGG A;  2NAA A;  5D1L B;  4YAT A;  2QIC A;  2FUU A;  2XEU A;  4O64 A;  2HDP A;  3LQJ A;  3N9P A;  4FK5 A;  4FJC A;  1WEQ A;  2C2L A;  4AVX A;  4A0C D;  2YQM A;  3T6R A;  3EB5 A;  3RPG B;  2K16 A;  2YUR A;  5FEY A;  5LKZ A;  5KH7 A;  2G43 A;  4QF2 A;  2L75 A;  1T1H A;  5H1T A;  1DVP A;  2F6N A;  5G05 B;  2ECT A;  5KH9 A; 
#chains in the Genus database with same CATH topology
 5B79 A;  1VYX A;  3I2D A;  1WIL A;  3HCT A;  2MD7 B;  5TDR A;  3ZPV 1;  1WIM A;  2CSY A;  1Z60 A;  4F52 B;  4BBQ A;  3FAO A;  4LAD B;  4LJN A;  2JUN A;  1WEP A;  1WEV A;  1XWH A;  3M99 A;  5H1V A;  2D8S A;  4UI9 B;  3FJU B;  2LAU A;  2LXH C;  3C5K A;  2KGI A;  3M63 A;  3U5M A;  2JMI A;  2XP0 A;  1WFK A;  5LCW B;  3T7L A;  3O33 A;  1Z6U A;  5G0F A;  2L5U A;  3Q1D A;  3NG2 A;  2VJE B;  2FSA A;  2MA5 A;  2K4D A;  5TBN A;  3RTR B;  1G25 A;  5B75 A;  1FP0 A;  2YHO A;  5SVY A;  3L1X A;  5FB0 A;  3LVR E;  2QIZ A;  4F1P A;  2ECN A;  3N9M A;  4PTB A;  3LJU X;  4H9D A;  3LDY A;  2M6M A;  4B7Y C;  4GNG A;  2RSD A;  3MHS A;  4V3L C;  1WE9 A;  2JM3 A;  2M1R A;  2MA6 A;  2JMJ A;  5LKX A;  1IYM A;  2MT5 A;  3SOU A;  4I7D A;  2LGL A;  5B77 A;  3LVQ E;  3E2D A;  3N9N A;  3SOX A;  4FIP A;  4I7C A;  3ZVZ B;  4WZ2 A;  4UP0 A;  2KWO A;  2ECG A;  3PHD A;  2JMD A;  2VJE A;  2VPD A;  2L43 A;  2OXQ C;  1WEN A;  2KIZ A;  5I3L A;  3N9L A;  2FD4 A;  1RMD A;  2YSM A;  2ECJ A;  3FAN A;  3KV5 A;  4PPE A;  3DWD A;  4CA1 A;  2G6Q A;  3N9Q A;  2VPB A;  2P57 A;  5SVI A;  2KR4 A;  2MUM A;  2MIQ A;  2H0D B;  2L7P A;  2FUI A;  3HTK C;  2VJF A;  3LRQ A;  2LN0 A;  4L7X A;  3KNV A;  1F62 A;  4LKA A;  2ZET C;  1JM7 B;  3O35 A;  2QJ0 A;  2MNZ A;  1HYJ A;  2L80 A;  3ZVY A;  2AN6 A;  4V3K C;  2XOC A;  4TKP B;  1WGM A;  3L1Z B;  3O34 A;  2KWK A;  4O62 A;  3U5N A;  4R8P K;  2LQ6 A;  1MBM A;  3EB6 A;  3IHP A;  2XOY A;  3KV6 A;  4C9Z A;  3L11 A;  2KRE A;  1VFY A;  2LRI C;  4AYC B;  2YHN A;  5DKA A;  2F6J A;  4X3G A;  1MM2 A;  1JOC A;  2MD8 C;  5B8D A;  1LDJ B;  3ZNI A;  1U6G B;  5KH3 A;  3LQH A;  2VPE A;  2DSM A;  2FFW A;  2YSJ A;  4WZ3 B;  1WEE A;  5D1M B;  1VD4 A;  1FBV A;  1JM7 A;  5B76 A;  2D8U A;  2YQL A;  2CON A;  2CSZ A;  2E6R A;  5D1K B;  2DX8 A;  2L0B A;  2YRE A;  2YU4 A;  2EOD A;  4FO9 A;  1HYI A;  3JUE A;  1WEW A;  2VJF B;  2PUY A;  2G45 A;  2CKL A;  2LDR A;  2H0D A;  3FM8 C;  2MKE A;  3KQI A;  2M85 A;  3GV4 A;  4A4B A;  5DIN A;  3O37 A;  2VP7 A;  5SVX A;  1V87 A;  2ECI A;  2YW8 A;  4LK9 A;  2YT5 A;  4ZUX U;  4AP4 A;  2Y1N A;  2Y43 A;  4YBS A;  3HCU A;  4QF3 A;  3O7A A;  2HYE D;  2ECW A;  1E4U A;  3ZTG A;  5TRB A;  3C6W A;  4L58 A;  5FER A;  2RR4 A;  2DJA A;  2ECV A;  3RPG C;  2M3H A;  4BHW A;  1LDK C;  4OGC A;  2CRW A;  2IQJ A;  4IC2 A;  3U5P A;  2BAY A;  4CCG X;  2LV9 A;  2XB1 A;  4MSX A;  3FL2 A;  4UP5 A;  2LGV A;  3O36 A;  3ASL A;  3H7H A;  4W4U A;  1X4I A;  2M13 A;  2RI7 A;  5EYA F;  4YBM A;  3KDE C;  2YVR A;  5TDW A;  4N4F A;  1BOR A;  4A4C A;  2KFT A;  1Z2Q A;  3ZPV E;  4GND A;  3HCS A;  4LLB A;  4YC9 A;  5G04 B;  1CHC A;  3VK6 A;  2JRJ A;  5B78 A;  2MNY A;  1WES A;  4NN2 A;  2I50 A;  5AIT A;  2KWN A;  2KKX A;  5H1U A;  2CSV A;  5K3Q A;  2E6S A;  5H9M A;  3DQV R;  3PUQ A;  4IC3 A;  4YAD A;  3M62 A;  3O47 A;  2Y1M A;  4R2Y A;  3U5O A;  4AYC A;  2EA6 A;  4P5O B;  1WEM A;  3FEH A;  4GNE A;  3M7K A;  5TAB A;  5C13 A;  4Z0O A;  5FB1 A;  2C2V S;  5JG6 A;  2KU3 A;  2KKY A;  4S3O B;  4XI1 A;  2B0O E;  3N9O A;  5SVI B;  3DDT A;  4Z0R A;  4GB0 A;  4MVT A;  5LKT A;  2F42 A;  4R7E A;  2YYR A;  2IDA A;  2CT2 A;  5AIU A;  2KYU A;  1ZBD B;  5J3X A;  4AUQ B;  1X4U A;  2CKL B;  3PUR A;  4S3O C;  4QQ4 A;  2OWA A;  1MM3 A;  4GNF A;  4ZDT A;  1X4J A;  4N3W A;  1N87 A;  2KE1 A;  2E61 A;  5C11 A;  2UZG A;  3LQI A;  3GL6 A;  3MHH A;  2LGG A;  3QZV A;  4YAX A;  2K17 A;  3MDB C;  3ZYQ A;  4WA6 A;  2YUC A;  4YBT A;  1WEO A;  1K2F A;  2VNF A;  4A49 A;  2K1J A;  2PNX A;  4B86 C;  4YAB A;  3SOW A;  2EGM A;  4Q6F A;  4WZ0 A;  3O70 A;  3SHB A;  1WEU A;  5LKU A;  2EGP A;  3V43 A;  2LGK A;  2VPG A;  4OGE A;  3DPL R;  4ZQL A;  2EXU A;  2LXP C;  4I7B A;  3T9K A;  2KWJ A;  2KGG A;  2NAA A;  5D1L B;  4YAT A;  3PLW A;  2XOZ A;  2QIC A;  2FUU A;  2XEU A;  4O64 A;  2HDP A;  3LQJ A;  3N9P A;  4FK5 A;  4FJC A;  1WEQ A;  2C2L A;  4AVX A;  3SUB A;  4A0C D;  2YQM A;  1DCQ A;  3T6R A;  3EB5 A;  3RPG B;  2K16 A;  2YUR A;  5FEY A;  5LKZ A;  2CRR A;  5KH7 A;  2G43 A;  4QF2 A;  2L75 A;  1T1H A;  5H1T A;  1DVP A;  2F6N A;  5G05 B;  2ECT A;  5KH9 A; 
#chains in the Genus database with same CATH homology
 5B79 A;  1VYX A;  2MD7 B;  1WIL A;  3I2D A;  3HCT A;  5TDR A;  3ZPV 1;  1WIM A;  2CSY A;  1Z60 A;  4F52 B;  4BBQ A;  4LAD B;  4LJN A;  1WEP A;  1WEV A;  1XWH A;  3M99 A;  5H1V A;  2D8S A;  4UI9 B;  2LXH C;  3C5K A;  2KGI A;  3M63 A;  3U5M A;  2JMI A;  5LCW B;  1WFK A;  3T7L A;  3O33 A;  1Z6U A;  5G0F A;  2L5U A;  3NG2 A;  2VJE B;  2FSA A;  2MA5 A;  2K4D A;  5TBN A;  3RTR B;  1G25 A;  5B75 A;  1FP0 A;  2YHO A;  3L1X A;  5FB0 A;  2QIZ A;  2ECN A;  3N9M A;  4PTB A;  2M6M A;  4B7Y C;  4GNG A;  2RSD A;  3MHS A;  4V3L C;  1WE9 A;  2M1R A;  2MA6 A;  2JMJ A;  5LKX A;  1IYM A;  2MT5 A;  3SOU A;  4I7D A;  2LGL A;  5B77 A;  3N9N A;  3SOX A;  4FIP A;  4I7C A;  3ZVZ B;  4WZ2 A;  4UP0 A;  2KWO A;  2ECG A;  3PHD A;  2JMD A;  2VJE A;  2VPD A;  2L43 A;  2OXQ C;  1WEN A;  2KIZ A;  5I3L A;  3N9L A;  1RMD A;  2YSM A;  2ECJ A;  3KV5 A;  4PPE A;  4CA1 A;  2G6Q A;  3N9Q A;  2VPB A;  2KR4 A;  2MUM A;  2MIQ A;  2H0D B;  2FUI A;  3HTK C;  2VJF A;  3LRQ A;  2LN0 A;  4L7X A;  3KNV A;  1F62 A;  4LKA A;  2ZET C;  1JM7 B;  3O35 A;  2QJ0 A;  2MNZ A;  1HYJ A;  2L80 A;  3ZVY A;  2AN6 A;  4V3K C;  4TKP B;  1WGM A;  3L1Z B;  3O34 A;  2KWK A;  3U5N A;  4R8P K;  2LQ6 A;  3EB6 A;  3IHP A;  3KV6 A;  4C9Z A;  3L11 A;  2KRE A;  1VFY A;  2LRI C;  4AYC B;  2YHN A;  5DKA A;  2F6J A;  4X3G A;  1MM2 A;  2MD8 C;  1JOC A;  5B8D A;  1LDJ B;  3ZNI A;  1U6G B;  5KH3 A;  3LQH A;  2VPE A;  2YSJ A;  4WZ3 B;  1WEE A;  5D1M B;  1VD4 A;  1FBV A;  1JM7 A;  5B76 A;  2YQL A;  2CSZ A;  2E6R A;  5D1K B;  2DX8 A;  2L0B A;  2YRE A;  2YU4 A;  2EOD A;  4FO9 A;  1HYI A;  1WEW A;  2VJF B;  2PUY A;  2G45 A;  2CKL A;  2LDR A;  2H0D A;  3KQI A;  2M85 A;  3GV4 A;  4A4B A;  5DIN A;  3O37 A;  2VP7 A;  1V87 A;  2ECI A;  2YW8 A;  4LK9 A;  2YT5 A;  4ZUX U;  4AP4 A;  2Y1N A;  2Y43 A;  4YBS A;  3HCU A;  4QF3 A;  3O7A A;  2HYE D;  2ECW A;  1E4U A;  3ZTG A;  5TRB A;  3C6W A;  4L58 A;  5FER A;  2ECV A;  3RPG C;  2M3H A;  4BHW A;  1LDK C;  4IC2 A;  3U5P A;  2BAY A;  4CCG X;  2LV9 A;  2XB1 A;  4MSX A;  3FL2 A;  4UP5 A;  2LGV A;  3O36 A;  3ASL A;  4W4U A;  4YBM A;  1X4I A;  2RI7 A;  5EYA F;  5TDW A;  4N4F A;  1BOR A;  4A4C A;  2KFT A;  1Z2Q A;  3ZPV E;  4GND A;  3HCS A;  4LLB A;  4YC9 A;  5G04 B;  1CHC A;  3VK6 A;  2JRJ A;  5B78 A;  2MNY A;  1WES A;  4NN2 A;  2I50 A;  5AIT A;  2KWN A;  5H1U A;  2E6S A;  5H9M A;  3DQV R;  3PUQ A;  4IC3 A;  4YAD A;  3M62 A;  2Y1M A;  4R2Y A;  3U5O A;  4AYC A;  2EA6 A;  4P5O B;  1WEM A;  4GNE A;  5TAB A;  5C13 A;  5FB1 A;  2C2V S;  5JG6 A;  2KU3 A;  4S3O B;  4XI1 A;  3N9O A;  4GB0 A;  4MVT A;  5LKT A;  2F42 A;  4R7E A;  2YYR A;  2IDA A;  2CT2 A;  5AIU A;  2KYU A;  1ZBD B;  5J3X A;  4AUQ B;  1X4U A;  2CKL B;  3PUR A;  4S3O C;  1MM3 A;  4GNF A;  4ZDT A;  1X4J A;  4N3W A;  1N87 A;  2KE1 A;  5C11 A;  2UZG A;  3LQI A;  3GL6 A;  3MHH A;  2LGG A;  3QZV A;  4YAX A;  2K17 A;  3ZYQ A;  4WA6 A;  2YUC A;  4YBT A;  1WEO A;  1K2F A;  2VNF A;  4A49 A;  2K1J A;  2PNX A;  4B86 C;  4YAB A;  3SOW A;  4Q6F A;  4WZ0 A;  3O70 A;  3SHB A;  1WEU A;  5LKU A;  2EGP A;  3V43 A;  2LGK A;  2VPG A;  3DPL R;  4ZQL A;  2LXP C;  4I7B A;  2KWJ A;  2KGG A;  2NAA A;  5D1L B;  4YAT A;  2QIC A;  2FUU A;  2XEU A;  4O64 A;  2HDP A;  3LQJ A;  3N9P A;  4FK5 A;  4FJC A;  1WEQ A;  2C2L A;  4AVX A;  4A0C D;  2YQM A;  3T6R A;  3EB5 A;  3RPG B;  2K16 A;  2YUR A;  5FEY A;  5LKZ A;  5KH7 A;  2G43 A;  4QF2 A;  2L75 A;  1T1H A;  5H1T A;  1DVP A;  2F6N A;  5G05 B;  2ECT A;  5KH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...