2K1JA

Plan homeodomain finger of tumour supressor ing4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
63
structure length
63
Chain Sequence
MDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Inhibitor of growth protein 4
publication title Solution structure and NMR characterization of the binding to methylated histone tails of the plant homeodomain finger of the tumour suppressor ING4.
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k1jA00
2YHOA 2KWNA 3O37A 2EA6A 5LKTA 5B76A 1WGMA 3M62A 5TABA 3SOUA 4GNEA 2VJFB 4V3KC 2MNYA 3T6RA 3KNVA 2CKLA 4A49A 3GL6A 2ECGA 1HYJA 4V3LC 2YQMA 3O7AA 5TDWA 2YURA 5H9MA 3N9QA 2RI7A 1IYMA 4ZDTA 1XWHA 3V43A 3KV5A 5KH7A 3T7LA 2D8SA 1RMDA 1JM7B 2LN0A 5DINA 3HCTA 2L75A 4R7EA 3I2DA 2YREA 2OXQC 3SHBA 5D1MB 2FUUA 5B79A 1Z60A 5AITA 3IHPA 4A4BA 2L80A 2E6SA 3C5KA 5TDRA 5JG6A 3ZVYA 4FK5A 2ECJA 5LKXA 2JRJA 3N9LA 2YYRA 1N87A 5B78A 4MSXA 2MA6A 3PURA 5B8DA 5TBNA 3RPGC 2MIQA 2VJFA 4FO9A 3NG2A 4PPEA 2BAYA 4WZ2A 2G45A 2NAAA 4YBTA 5H1VA 1WEQA 2ECTA 2C2LA 1MM2A 2LXHC 2HYED 2KGIA 4LJNA 3N9PA 4BBQA 4BHWA 3L1XA 2MNZA 2JMJA 1CHCA 4B7YC 3LQJA 2H0DB 1FBVA 2YT5A 2QJ0A 2F42A 3FL2A 3M63A 1JM7A 4CA1A 2YSJA 4WA6A 5FB1A 2M85A 1WEEA 2KFTA 3U5OA 3PUQA 2JMDA 3PHDA 5J3XA 4TKPB 3HTKC 3C6WA 3ZNIA 2ECNA 2YHNA 2XEUA 4R8PK 2HDPA 1LDJB 2ECIA 4WZ0A 5D1KB 2VJEA 2VPEA 3EB5A 4GB0A 1HYIA 2VPBA 4GNFA 4O64A 5G0FA 2KIZA 4I7BA 3N9NA 3MHSA 1WILA 3GV4A 4ZUXU 2MD8C 2FUIA 1WEPA 2QICA 2KE1A 1MM3A 2FSAA 1WFKA 3QZVA 2C2VS 3RPGB 1V87A 2G43A 1G25A 2EGPA 4L7XA 4I7DA 5LKZA 4R2YA 3MHHA 4GNGA 2H0DA 4PTBA 4XI1A 5FB0A 3ZPVE 2L5UA 2G6QA 3LQIA 5FEYA 3HCUA 4A0CD 1ZBDB 2VPGA 4B86C 1U6GB 2QIZA 2DX8A 4Q6FA 4MVTA 2MT5A 1WEUA 2CSYA 2K16A 1F62A 4AYCB 2CKLB 4LKAA 4UI9B 2YQLA 2KWKA 5AIUA 1VD4A 4YBMA 1WENA 3L11A 2MUMA 2LGVA 4NN2A 3N9MA 5KH3A 2YSMA 1WIMA 3RTRB 5C13A 3ZTGA 4LK9A 4YADA 3HCSA 4I7CA 2LXPC 2YW8A 2K1JA 4ZQLA 5H1UA 3U5MA 3KQIA 4LADB 4LLBA 2XB1A 3M99A 3O33A 5EYAF 4N4FA 2L0BA 3O34A 4IC3A 2CT2A 2K17A 5G04B 2MA5A 4YATA 4AVXA 3ASLA 3ZVZB 2JMIA 4AUQB 5G05B 1VFYA 2Y1NA 3VK6A 4YAXA 3O70A 4FIPA 4YC9A 2K4DA 3U5PA 2E6RA 2KWOA 4UP5A 2LRIC 2CSZA 2M6MA 3SOWA 5DKAA 1JOCA 4AYCA 5H1TA 3DQVR 2ECVA 2KYUA 5B77A 1T1HA 4YABA 5C11A 1WEWA 1DVPA 2VP7A 3ZPV1 4L58A 2I50A 2ZETC 4YBSA 2EODA 2M1RA 2LGLA 3N9OA 2KREA 2Y1MA 5KH9A 4C9ZA 4S3OB 3LQHA 5TRBA 1X4UA 2LQ6A 2KU3A 4P5OB 4W4UA 1BORA 2RSDA 1WEOA 4QF2A 4GNDA 2PUYA 5I3LA 3DPLR 2L43A 2ECWA 1X4IA 2VPDA 3EB6A 1Z2QA 2IDAA 2Y43A 2M3HA 4QF3A 4FJCA 2LDRA 2KGGA 3U5NA 2LGKA 3O36A 4AP4A 1X4JA 4S3OC 2PNXA 3ZYQA 2UZGA 4N3WA 2VJEB 3LRQA 2LV9A 4WZ3B 4A4CA 3L1ZB 1K2FA 1VYXA 5D1LB 1WEMA 2AN6A 5LCWB 1WE9A 5B75A 3SOXA 1WESA 2KWJA 2KR4A 2MD7B 2VNFA 5FERA 1Z6UA 4UP0A 1LDKC 4F52B 1E4UA 2YU4A 4IC2A 1WEVA 5LKUA 2F6JA 2LGGA 3O35A 2F6NA 4CCGX 3KV6A 4X3GA 2YUCA 1FP0A
chains in the Genus database with same CATH superfamily
2YHOA 2KWNA 3O37A 2EA6A 2EGMA 2M13A 5LKTA 5B76A 2DSMA 1WGMA 3M62A 5TABA 3SOUA 2IQJA 4GNEA 2VJFB 2XOYA 4V3KC 2MNYA 3T6RA 3KNVA 2CKLA 4A49A 3GL6A 2FD4A 2ECGA 1HYJA 4V3LC 2YQMA 3O7AA 5TDWA 2YURA 3N9QA 5H9MA 2RI7A 1IYMA 4ZDTA 1XWHA 3V43A 3KV5A 5KH7A 3T7LA 2D8SA 4F1PA 1RMDA 1JM7B 2LN0A 5DINA 3HCTA 2L75A 4R7EA 3I2DA 2YREA 2OXQC 3SHBA 5D1MB 2FUUA 5B79A 1Z60A 5AITA 2RR4A 3IHPA 4A4BA 2JUNA 2L80A 2E6SA 3C5KA 4Z0RA 2E61A 5TDRA 5JG6A 3ZVYA 4FK5A 2ECJA 5LKXA 2JRJA 3N9LA 2YYRA 3DDTA 1N87A 4QQ4A 5B78A 4MSXA 2MA6A 3PURA 5B8DA 5TBNA 3RPGC 2MIQA 4H9DA 2VJFA 4FO9A 3NG2A 2YVRA 4PPEA 2BAYA 4WZ2A 2G45A 2NAAA 2CRRA 4YBTA 5H1VA 1WEQA 2ECTA 2C2LA 1MM2A 2CONA 2LXHC 2HYED 2KGIA 4LJNA 3N9PA 4BBQA 4BHWA 3L1XA 5SVIB 2MNZA 2JMJA 1CHCA 4B7YC 3LQJA 4Z0OA 2H0DB 1FBVA 2YT5A 2QJ0A 2F42A 3LVRE 3FL2A 3M63A 1JM7A 4CA1A 2YSJA 4WA6A 5FB1A 2M85A 1WEEA 2KFTA 3U5OA 3PUQA 2JMDA 3PHDA 5J3XA 4TKPB 3HTKC 3C6WA 3ZNIA 2ECNA 2YHNA 2XEUA 4R8PK 2HDPA 1LDJB 2ECIA 4WZ0A 3MDBC 2P57A 5D1KB 1MBMA 2VJEA 2VPEA 3EB5A 4GB0A 1HYIA 3LVQE 2VPBA 4GNFA 2OWAA 4O64A 5G0FA 2KIZA 4OGEA 4I7BA 3E2DA 3N9NA 3MHSA 1WILA 3GV4A 4ZUXU 2MD8C 2FUIA 1WEPA 2KKXA 2QICA 2KE1A 1MM3A 2FSAA 1WFKA 3QZVA 3LDYA 2C2VS 3RPGB 1V87A 2G43A 1G25A 5K3QA 2EGPA 4L7XA 5SVYA 4I7DA 5LKZA 3PLWA 4R2YA 5SVIA 3MHHA 4GNGA 2H0DA 4PTBA 4XI1A 5FB0A 3ZPVE 2L5UA 2G6QA 3LQIA 5FEYA 2CSVA 3HCUA 4A0CD 1ZBDB 2VPGA 4B86C 1U6GB 3FM8C 2QIZA 2DX8A 4Q6FA 4MVTA 2FFWA 2MT5A 1WEUA 2CSYA 2K16A 3SUBA 1F62A 4AYCB 2CKLB 4LKAA 4UI9B 2YQLA 2KWKA 5AIUA 1VD4A 4YBMA 1WENA 3L11A 2D8UA 2CRWA 2MUMA 2LGVA 4NN2A 3N9MA 5KH3A 2YSMA 1WIMA 2B0OE 3RTRB 5C13A 3ZTGA 4LK9A 4YADA 3HCSA 4I7CA 2LXPC 2YW8A 2K1JA 4ZQLA 5H1UA 3U5MA 2LAUA 3KQIA 4LADB 2XOCA 3KDEC 4LLBA 2XB1A 3M99A 3O33A 5EYAF 4N4FA 2L0BA 3O34A 4IC3A 2CT2A 2K17A 5G04B 2MA5A 4YATA 4AVXA 3ASLA 3LJUX 3FANA 2JMIA 3ZVZB 4AUQB 5G05B 1VFYA 2Y1NA 3VK6A 4YAXA 3T9KA 2L7PA 3O70A 4FIPA 4YC9A 2K4DA 3U5PA 2E6RA 2KWOA 4UP5A 2LRIC 2EXUA 2CSZA 2M6MA 3SOWA 2JM3A 5DKAA 1JOCA 4AYCA 3FAOA 5H1TA 3DQVR 2ECVA 2KYUA 5B77A 5SVXA 1T1HA 4YABA 5C11A 1WEWA 1DVPA 2VP7A 3ZPV1 4L58A 2I50A 2ZETC 4YBSA 2EODA 2M1RA 3H7HA 2LGLA 3N9OA 2KREA 2Y1MA 1DCQA 5KH9A 4C9ZA 4S3OB 3LQHA 5TRBA 1X4UA 2LQ6A 4OGCA 2KU3A 4P5OB 4W4UA 1BORA 2RSDA 1WEOA 4QF2A 4GNDA 2PUYA 3FJUB 5I3LA 3O47A 3DPLR 2L43A 2ECWA 1X4IA 2MKEA 2VPDA 2XOZA 3EB6A 1Z2QA 2IDAA 2Y43A 2M3HA 3DWDA 4QF3A 4FJCA 2LDRA 2KGGA 3U5NA 2LGKA 3O36A 4AP4A 2KKYA 1X4JA 4S3OC 3FEHA 2PNXA 3JUEA 3ZYQA 2UZGA 4N3WA 2VJEB 3LRQA 3M7KA 2LV9A 4WZ3B 4A4CA 3L1ZB 1K2FA 1VYXA 5D1LB 1WEMA 2AN6A 2DJAA 5LCWB 1WE9A 5B75A 3SOXA 1WESA 2KWJA 2KR4A 2MD7B 2VNFA 5FERA 1Z6UA 4UP0A 1LDKC 4F52B 1E4UA 2YU4A 4IC2A 1WEVA 5LKUA 2F6JA 2LGGA 3O35A 2F6NA 4CCGX 3KV6A 4X3GA 3Q1DA 2XP0A 4O62A 2YUCA 1FP0A
chains in the Genus database with same CATH topology
2YHOA 2KWNA 3O37A 2EA6A 5LKTA 5B76A 1WGMA 3M62A 5TABA 3SOUA 4GNEA 2VJFB 4V3KC 2MNYA 3T6RA 3KNVA 2CKLA 4A49A 3GL6A 2ECGA 1HYJA 4V3LC 2YQMA 3O7AA 5TDWA 2YURA 5H9MA 3N9QA 2RI7A 1IYMA 4ZDTA 1XWHA 3V43A 3KV5A 5KH7A 3T7LA 2D8SA 1RMDA 1JM7B 2LN0A 5DINA 3HCTA 2L75A 4R7EA 3I2DA 2YREA 2OXQC 3SHBA 5D1MB 2FUUA 5B79A 1Z60A 5AITA 3IHPA 4A4BA 2L80A 2E6SA 3C5KA 5TDRA 5JG6A 3ZVYA 4FK5A 2ECJA 5LKXA 2JRJA 3N9LA 2YYRA 1N87A 5B78A 4MSXA 2MA6A 3PURA 5B8DA 5TBNA 3RPGC 2MIQA 2VJFA 4FO9A 3NG2A 4PPEA 2BAYA 4WZ2A 2G45A 2NAAA 4YBTA 5H1VA 1WEQA 2ECTA 2C2LA 1MM2A 2LXHC 2HYED 2KGIA 4LJNA 3N9PA 4BBQA 4BHWA 3L1XA 2MNZA 2JMJA 1CHCA 4B7YC 3LQJA 2H0DB 1FBVA 2YT5A 2QJ0A 2F42A 3FL2A 3M63A 1JM7A 4CA1A 2YSJA 4WA6A 5FB1A 2M85A 1WEEA 2KFTA 3U5OA 3PUQA 2JMDA 3PHDA 5J3XA 4TKPB 3HTKC 3C6WA 3ZNIA 2ECNA 2YHNA 2XEUA 4R8PK 2HDPA 1LDJB 2ECIA 4WZ0A 5D1KB 2VJEA 2VPEA 3EB5A 4GB0A 1HYIA 2VPBA 4GNFA 4O64A 5G0FA 2KIZA 4I7BA 3N9NA 3MHSA 1WILA 3GV4A 4ZUXU 2MD8C 2FUIA 1WEPA 2QICA 2KE1A 1MM3A 2FSAA 1WFKA 3QZVA 2C2VS 3RPGB 1V87A 2G43A 1G25A 2EGPA 4L7XA 4I7DA 5LKZA 4R2YA 3MHHA 4GNGA 2H0DA 4PTBA 4XI1A 5FB0A 3ZPVE 2L5UA 2G6QA 3LQIA 5FEYA 3HCUA 4A0CD 1ZBDB 2VPGA 4B86C 1U6GB 2QIZA 2DX8A 4Q6FA 4MVTA 2MT5A 1WEUA 2CSYA 2K16A 1F62A 4AYCB 2CKLB 4LKAA 4UI9B 2YQLA 2KWKA 5AIUA 1VD4A 4YBMA 1WENA 3L11A 2MUMA 2LGVA 4NN2A 3N9MA 5KH3A 2YSMA 1WIMA 3RTRB 5C13A 3ZTGA 4LK9A 4YADA 3HCSA 4I7CA 2LXPC 2YW8A 2K1JA 4ZQLA 5H1UA 3U5MA 3KQIA 4LADB 4LLBA 2XB1A 3M99A 3O33A 5EYAF 4N4FA 2L0BA 3O34A 4IC3A 2CT2A 2K17A 5G04B 2MA5A 4YATA 4AVXA 3ASLA 3ZVZB 2JMIA 4AUQB 5G05B 1VFYA 2Y1NA 3VK6A 4YAXA 3O70A 4FIPA 4YC9A 2K4DA 3U5PA 2E6RA 2KWOA 4UP5A 2LRIC 2CSZA 2M6MA 3SOWA 5DKAA 1JOCA 4AYCA 5H1TA 3DQVR 2ECVA 2KYUA 5B77A 1T1HA 4YABA 5C11A 1WEWA 1DVPA 2VP7A 3ZPV1 4L58A 2I50A 2ZETC 4YBSA 2EODA 2M1RA 2LGLA 3N9OA 2KREA 2Y1MA 5KH9A 4C9ZA 4S3OB 3LQHA 5TRBA 1X4UA 2LQ6A 2KU3A 4P5OB 4W4UA 1BORA 2RSDA 1WEOA 4QF2A 4GNDA 2PUYA 5I3LA 3DPLR 2L43A 2ECWA 1X4IA 2VPDA 3EB6A 1Z2QA 2IDAA 2Y43A 2M3HA 4QF3A 4FJCA 2LDRA 2KGGA 3U5NA 2LGKA 3O36A 4AP4A 1X4JA 4S3OC 2PNXA 3ZYQA 2UZGA 4N3WA 2VJEB 3LRQA 2LV9A 4WZ3B 4A4CA 3L1ZB 1K2FA 1VYXA 5D1LB 1WEMA 2AN6A 5LCWB 1WE9A 5B75A 3SOXA 1WESA 2KWJA 2KR4A 2MD7B 2VNFA 5FERA 1Z6UA 4UP0A 1LDKC 4F52B 1E4UA 2YU4A 4IC2A 1WEVA 5LKUA 2F6JA 2LGGA 3O35A 2F6NA 4CCGX 3KV6A 4X3GA 2YUCA 1FP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHO A;  2KWN A;  3O37 A;  2EA6 A;  5LKT A;  5B76 A;  1WGM A;  3M62 A;  5TAB A;  3SOU A;  4GNE A;  2VJF B;  4V3K C;  2MNY A;  3T6R A;  3KNV A;  2CKL A;  4A49 A;  3GL6 A;  2ECG A;  1HYJ A;  4V3L C;  2YQM A;  3O7A A;  5TDW A;  2YUR A;  5H9M A;  3N9Q A;  2RI7 A;  1IYM A;  4ZDT A;  1XWH A;  3V43 A;  3KV5 A;  5KH7 A;  3T7L A;  2D8S A;  1RMD A;  1JM7 B;  2LN0 A;  5DIN A;  3HCT A;  2L75 A;  4R7E A;  3I2D A;  2YRE A;  2OXQ C;  3SHB A;  5D1M B;  2FUU A;  5B79 A;  1Z60 A;  5AIT A;  3IHP A;  4A4B A;  2L80 A;  2E6S A;  3C5K A;  5TDR A;  5JG6 A;  3ZVY A;  4FK5 A;  2ECJ A;  5LKX A;  2JRJ A;  3N9L A;  2YYR A;  1N87 A;  5B78 A;  4MSX A;  2MA6 A;  3PUR A;  5B8D A;  5TBN A;  3RPG C;  2MIQ A;  2VJF A;  4FO9 A;  3NG2 A;  4PPE A;  2BAY A;  4WZ2 A;  2G45 A;  2NAA A;  4YBT A;  5H1V A;  1WEQ A;  2ECT A;  2C2L A;  1MM2 A;  2LXH C;  2HYE D;  2KGI A;  4LJN A;  3N9P A;  4BBQ A;  4BHW A;  3L1X A;  2MNZ A;  2JMJ A;  1CHC A;  4B7Y C;  3LQJ A;  2H0D B;  1FBV A;  2YT5 A;  2QJ0 A;  2F42 A;  3FL2 A;  3M63 A;  1JM7 A;  4CA1 A;  2YSJ A;  4WA6 A;  5FB1 A;  2M85 A;  1WEE A;  2KFT A;  3U5O A;  3PUQ A;  2JMD A;  3PHD A;  5J3X A;  4TKP B;  3HTK C;  3C6W A;  3ZNI A;  2ECN A;  2YHN A;  2XEU A;  4R8P K;  2HDP A;  1LDJ B;  2ECI A;  4WZ0 A;  5D1K B;  2VJE A;  2VPE A;  3EB5 A;  4GB0 A;  1HYI A;  2VPB A;  4GNF A;  4O64 A;  5G0F A;  2KIZ A;  4I7B A;  3N9N A;  3MHS A;  1WIL A;  3GV4 A;  4ZUX U;  2MD8 C;  2FUI A;  1WEP A;  2QIC A;  2KE1 A;  1MM3 A;  2FSA A;  1WFK A;  3QZV A;  2C2V S;  3RPG B;  1V87 A;  2G43 A;  1G25 A;  2EGP A;  4L7X A;  4I7D A;  5LKZ A;  4R2Y A;  3MHH A;  4GNG A;  2H0D A;  4PTB A;  4XI1 A;  5FB0 A;  3ZPV E;  2L5U A;  2G6Q A;  3LQI A;  5FEY A;  3HCU A;  4A0C D;  1ZBD B;  2VPG A;  4B86 C;  1U6G B;  2QIZ A;  2DX8 A;  4Q6F A;  4MVT A;  2MT5 A;  1WEU A;  2CSY A;  2K16 A;  1F62 A;  4AYC B;  2CKL B;  4LKA A;  4UI9 B;  2YQL A;  2KWK A;  5AIU A;  1VD4 A;  4YBM A;  1WEN A;  3L11 A;  2MUM A;  2LGV A;  4NN2 A;  3N9M A;  5KH3 A;  2YSM A;  1WIM A;  3RTR B;  5C13 A;  3ZTG A;  4LK9 A;  4YAD A;  3HCS A;  4I7C A;  2LXP C;  2YW8 A;  2K1J A;  4ZQL A;  5H1U A;  3U5M A;  3KQI A;  4LAD B;  4LLB A;  2XB1 A;  3M99 A;  3O33 A;  5EYA F;  4N4F A;  2L0B A;  3O34 A;  4IC3 A;  2CT2 A;  2K17 A;  5G04 B;  2MA5 A;  4YAT A;  4AVX A;  3ASL A;  3ZVZ B;  2JMI A;  4AUQ B;  5G05 B;  1VFY A;  2Y1N A;  3VK6 A;  4YAX A;  3O70 A;  4FIP A;  4YC9 A;  2K4D A;  3U5P A;  2E6R A;  2KWO A;  4UP5 A;  2LRI C;  2CSZ A;  2M6M A;  3SOW A;  5DKA A;  1JOC A;  4AYC A;  5H1T A;  3DQV R;  2ECV A;  2KYU A;  5B77 A;  1T1H A;  4YAB A;  5C11 A;  1WEW A;  1DVP A;  2VP7 A;  3ZPV 1;  4L58 A;  2I50 A;  2ZET C;  4YBS A;  2EOD A;  2M1R A;  2LGL A;  3N9O A;  2KRE A;  2Y1M A;  5KH9 A;  4C9Z A;  4S3O B;  3LQH A;  5TRB A;  1X4U A;  2LQ6 A;  2KU3 A;  4P5O B;  4W4U A;  1BOR A;  2RSD A;  1WEO A;  4QF2 A;  4GND A;  2PUY A;  5I3L A;  3DPL R;  2L43 A;  2ECW A;  1X4I A;  2VPD A;  3EB6 A;  1Z2Q A;  2IDA A;  2Y43 A;  2M3H A;  4QF3 A;  4FJC A;  2LDR A;  2KGG A;  3U5N A;  2LGK A;  3O36 A;  4AP4 A;  1X4J A;  4S3O C;  2PNX A;  3ZYQ A;  2UZG A;  4N3W A;  2VJE B;  3LRQ A;  2LV9 A;  4WZ3 B;  4A4C A;  3L1Z B;  1K2F A;  1VYX A;  5D1L B;  1WEM A;  2AN6 A;  5LCW B;  1WE9 A;  5B75 A;  3SOX A;  1WES A;  2KWJ A;  2KR4 A;  2MD7 B;  2VNF A;  5FER A;  1Z6U A;  4UP0 A;  1LDK C;  4F52 B;  1E4U A;  2YU4 A;  4IC2 A;  1WEV A;  5LKU A;  2F6J A;  2LGG A;  3O35 A;  2F6N A;  4CCG X;  3KV6 A;  4X3G A;  2YUC A;  1FP0 A; 
#chains in the Genus database with same CATH topology
 2YHO A;  2KWN A;  3O37 A;  2EA6 A;  2EGM A;  2M13 A;  5LKT A;  5B76 A;  2DSM A;  1WGM A;  3M62 A;  5TAB A;  3SOU A;  2IQJ A;  4GNE A;  2VJF B;  2XOY A;  4V3K C;  2MNY A;  3T6R A;  3KNV A;  2CKL A;  4A49 A;  3GL6 A;  2FD4 A;  2ECG A;  1HYJ A;  4V3L C;  2YQM A;  3O7A A;  5TDW A;  2YUR A;  3N9Q A;  5H9M A;  2RI7 A;  1IYM A;  4ZDT A;  1XWH A;  3V43 A;  3KV5 A;  5KH7 A;  3T7L A;  2D8S A;  4F1P A;  1RMD A;  1JM7 B;  2LN0 A;  5DIN A;  3HCT A;  2L75 A;  4R7E A;  3I2D A;  2YRE A;  2OXQ C;  3SHB A;  5D1M B;  2FUU A;  5B79 A;  1Z60 A;  5AIT A;  2RR4 A;  3IHP A;  4A4B A;  2JUN A;  2L80 A;  2E6S A;  3C5K A;  4Z0R A;  2E61 A;  5TDR A;  5JG6 A;  3ZVY A;  4FK5 A;  2ECJ A;  5LKX A;  2JRJ A;  3N9L A;  2YYR A;  3DDT A;  1N87 A;  4QQ4 A;  5B78 A;  4MSX A;  2MA6 A;  3PUR A;  5B8D A;  5TBN A;  3RPG C;  2MIQ A;  4H9D A;  2VJF A;  4FO9 A;  3NG2 A;  2YVR A;  4PPE A;  2BAY A;  4WZ2 A;  2G45 A;  2NAA A;  2CRR A;  4YBT A;  5H1V A;  1WEQ A;  2ECT A;  2C2L A;  1MM2 A;  2CON A;  2LXH C;  2HYE D;  2KGI A;  4LJN A;  3N9P A;  4BBQ A;  4BHW A;  3L1X A;  5SVI B;  2MNZ A;  2JMJ A;  1CHC A;  4B7Y C;  3LQJ A;  4Z0O A;  2H0D B;  1FBV A;  2YT5 A;  2QJ0 A;  2F42 A;  3LVR E;  3FL2 A;  3M63 A;  1JM7 A;  4CA1 A;  2YSJ A;  4WA6 A;  5FB1 A;  2M85 A;  1WEE A;  2KFT A;  3U5O A;  3PUQ A;  2JMD A;  3PHD A;  5J3X A;  4TKP B;  3HTK C;  3C6W A;  3ZNI A;  2ECN A;  2YHN A;  2XEU A;  4R8P K;  2HDP A;  1LDJ B;  2ECI A;  4WZ0 A;  3MDB C;  2P57 A;  5D1K B;  1MBM A;  2VJE A;  2VPE A;  3EB5 A;  4GB0 A;  1HYI A;  3LVQ E;  2VPB A;  4GNF A;  2OWA A;  4O64 A;  5G0F A;  2KIZ A;  4OGE A;  4I7B A;  3E2D A;  3N9N A;  3MHS A;  1WIL A;  3GV4 A;  4ZUX U;  2MD8 C;  2FUI A;  1WEP A;  2KKX A;  2QIC A;  2KE1 A;  1MM3 A;  2FSA A;  1WFK A;  3QZV A;  3LDY A;  2C2V S;  3RPG B;  1V87 A;  2G43 A;  1G25 A;  5K3Q A;  2EGP A;  4L7X A;  5SVY A;  4I7D A;  5LKZ A;  3PLW A;  4R2Y A;  5SVI A;  3MHH A;  4GNG A;  2H0D A;  4PTB A;  4XI1 A;  5FB0 A;  3ZPV E;  2L5U A;  2G6Q A;  3LQI A;  5FEY A;  2CSV A;  3HCU A;  4A0C D;  1ZBD B;  2VPG A;  4B86 C;  1U6G B;  3FM8 C;  2QIZ A;  2DX8 A;  4Q6F A;  4MVT A;  2FFW A;  2MT5 A;  1WEU A;  2CSY A;  2K16 A;  3SUB A;  1F62 A;  4AYC B;  2CKL B;  4LKA A;  4UI9 B;  2YQL A;  2KWK A;  5AIU A;  1VD4 A;  4YBM A;  1WEN A;  3L11 A;  2D8U A;  2CRW A;  2MUM A;  2LGV A;  4NN2 A;  3N9M A;  5KH3 A;  2YSM A;  1WIM A;  2B0O E;  3RTR B;  5C13 A;  3ZTG A;  4LK9 A;  4YAD A;  3HCS A;  4I7C A;  2LXP C;  2YW8 A;  2K1J A;  4ZQL A;  5H1U A;  3U5M A;  2LAU A;  3KQI A;  4LAD B;  2XOC A;  3KDE C;  4LLB A;  2XB1 A;  3M99 A;  3O33 A;  5EYA F;  4N4F A;  2L0B A;  3O34 A;  4IC3 A;  2CT2 A;  2K17 A;  5G04 B;  2MA5 A;  4YAT A;  4AVX A;  3ASL A;  3LJU X;  3FAN A;  2JMI A;  3ZVZ B;  4AUQ B;  5G05 B;  1VFY A;  2Y1N A;  3VK6 A;  4YAX A;  3T9K A;  2L7P A;  3O70 A;  4FIP A;  4YC9 A;  2K4D A;  3U5P A;  2E6R A;  2KWO A;  4UP5 A;  2LRI C;  2EXU A;  2CSZ A;  2M6M A;  3SOW A;  2JM3 A;  5DKA A;  1JOC A;  4AYC A;  3FAO A;  5H1T A;  3DQV R;  2ECV A;  2KYU A;  5B77 A;  5SVX A;  1T1H A;  4YAB A;  5C11 A;  1WEW A;  1DVP A;  2VP7 A;  3ZPV 1;  4L58 A;  2I50 A;  2ZET C;  4YBS A;  2EOD A;  2M1R A;  3H7H A;  2LGL A;  3N9O A;  2KRE A;  2Y1M A;  1DCQ A;  5KH9 A;  4C9Z A;  4S3O B;  3LQH A;  5TRB A;  1X4U A;  2LQ6 A;  4OGC A;  2KU3 A;  4P5O B;  4W4U A;  1BOR A;  2RSD A;  1WEO A;  4QF2 A;  4GND A;  2PUY A;  3FJU B;  5I3L A;  3O47 A;  3DPL R;  2L43 A;  2ECW A;  1X4I A;  2MKE A;  2VPD A;  2XOZ A;  3EB6 A;  1Z2Q A;  2IDA A;  2Y43 A;  2M3H A;  3DWD A;  4QF3 A;  4FJC A;  2LDR A;  2KGG A;  3U5N A;  2LGK A;  3O36 A;  4AP4 A;  2KKY A;  1X4J A;  4S3O C;  3FEH A;  2PNX A;  3JUE A;  3ZYQ A;  2UZG A;  4N3W A;  2VJE B;  3LRQ A;  3M7K A;  2LV9 A;  4WZ3 B;  4A4C A;  3L1Z B;  1K2F A;  1VYX A;  5D1L B;  1WEM A;  2AN6 A;  2DJA A;  5LCW B;  1WE9 A;  5B75 A;  3SOX A;  1WES A;  2KWJ A;  2KR4 A;  2MD7 B;  2VNF A;  5FER A;  1Z6U A;  4UP0 A;  1LDK C;  4F52 B;  1E4U A;  2YU4 A;  4IC2 A;  1WEV A;  5LKU A;  2F6J A;  2LGG A;  3O35 A;  2F6N A;  4CCG X;  3KV6 A;  4X3G A;  3Q1D A;  2XP0 A;  4O62 A;  2YUC A;  1FP0 A; 
#chains in the Genus database with same CATH homology
 2YHO A;  2KWN A;  3O37 A;  2EA6 A;  5LKT A;  5B76 A;  1WGM A;  3M62 A;  5TAB A;  3SOU A;  4GNE A;  2VJF B;  4V3K C;  2MNY A;  3T6R A;  3KNV A;  2CKL A;  4A49 A;  3GL6 A;  2ECG A;  1HYJ A;  4V3L C;  2YQM A;  3O7A A;  5TDW A;  2YUR A;  5H9M A;  3N9Q A;  2RI7 A;  1IYM A;  4ZDT A;  1XWH A;  3V43 A;  3KV5 A;  5KH7 A;  3T7L A;  2D8S A;  1RMD A;  1JM7 B;  2LN0 A;  5DIN A;  3HCT A;  2L75 A;  4R7E A;  3I2D A;  2YRE A;  2OXQ C;  3SHB A;  5D1M B;  2FUU A;  5B79 A;  1Z60 A;  5AIT A;  3IHP A;  4A4B A;  2L80 A;  2E6S A;  3C5K A;  5TDR A;  5JG6 A;  3ZVY A;  4FK5 A;  2ECJ A;  5LKX A;  2JRJ A;  3N9L A;  2YYR A;  1N87 A;  5B78 A;  4MSX A;  2MA6 A;  3PUR A;  5B8D A;  5TBN A;  3RPG C;  2MIQ A;  2VJF A;  4FO9 A;  3NG2 A;  4PPE A;  2BAY A;  4WZ2 A;  2G45 A;  2NAA A;  4YBT A;  5H1V A;  1WEQ A;  2ECT A;  2C2L A;  1MM2 A;  2LXH C;  2HYE D;  2KGI A;  4LJN A;  3N9P A;  4BBQ A;  4BHW A;  3L1X A;  2MNZ A;  2JMJ A;  1CHC A;  4B7Y C;  3LQJ A;  2H0D B;  1FBV A;  2YT5 A;  2QJ0 A;  2F42 A;  3FL2 A;  3M63 A;  1JM7 A;  4CA1 A;  2YSJ A;  4WA6 A;  5FB1 A;  2M85 A;  1WEE A;  2KFT A;  3U5O A;  3PUQ A;  2JMD A;  3PHD A;  5J3X A;  4TKP B;  3HTK C;  3C6W A;  3ZNI A;  2ECN A;  2YHN A;  2XEU A;  4R8P K;  2HDP A;  1LDJ B;  2ECI A;  4WZ0 A;  5D1K B;  2VJE A;  2VPE A;  3EB5 A;  4GB0 A;  1HYI A;  2VPB A;  4GNF A;  4O64 A;  5G0F A;  2KIZ A;  4I7B A;  3N9N A;  3MHS A;  1WIL A;  3GV4 A;  4ZUX U;  2MD8 C;  2FUI A;  1WEP A;  2QIC A;  2KE1 A;  1MM3 A;  2FSA A;  1WFK A;  3QZV A;  2C2V S;  3RPG B;  1V87 A;  2G43 A;  1G25 A;  2EGP A;  4L7X A;  4I7D A;  5LKZ A;  4R2Y A;  3MHH A;  4GNG A;  2H0D A;  4PTB A;  4XI1 A;  5FB0 A;  3ZPV E;  2L5U A;  2G6Q A;  3LQI A;  5FEY A;  3HCU A;  4A0C D;  1ZBD B;  2VPG A;  4B86 C;  1U6G B;  2QIZ A;  2DX8 A;  4Q6F A;  4MVT A;  2MT5 A;  1WEU A;  2CSY A;  2K16 A;  1F62 A;  4AYC B;  2CKL B;  4LKA A;  4UI9 B;  2YQL A;  2KWK A;  5AIU A;  1VD4 A;  4YBM A;  1WEN A;  3L11 A;  2MUM A;  2LGV A;  4NN2 A;  3N9M A;  5KH3 A;  2YSM A;  1WIM A;  3RTR B;  5C13 A;  3ZTG A;  4LK9 A;  4YAD A;  3HCS A;  4I7C A;  2LXP C;  2YW8 A;  2K1J A;  4ZQL A;  5H1U A;  3U5M A;  3KQI A;  4LAD B;  4LLB A;  2XB1 A;  3M99 A;  3O33 A;  5EYA F;  4N4F A;  2L0B A;  3O34 A;  4IC3 A;  2CT2 A;  2K17 A;  5G04 B;  2MA5 A;  4YAT A;  4AVX A;  3ASL A;  3ZVZ B;  2JMI A;  4AUQ B;  5G05 B;  1VFY A;  2Y1N A;  3VK6 A;  4YAX A;  3O70 A;  4FIP A;  4YC9 A;  2K4D A;  3U5P A;  2E6R A;  2KWO A;  4UP5 A;  2LRI C;  2CSZ A;  2M6M A;  3SOW A;  5DKA A;  1JOC A;  4AYC A;  5H1T A;  3DQV R;  2ECV A;  2KYU A;  5B77 A;  1T1H A;  4YAB A;  5C11 A;  1WEW A;  1DVP A;  2VP7 A;  3ZPV 1;  4L58 A;  2I50 A;  2ZET C;  4YBS A;  2EOD A;  2M1R A;  2LGL A;  3N9O A;  2KRE A;  2Y1M A;  5KH9 A;  4C9Z A;  4S3O B;  3LQH A;  5TRB A;  1X4U A;  2LQ6 A;  2KU3 A;  4P5O B;  4W4U A;  1BOR A;  2RSD A;  1WEO A;  4QF2 A;  4GND A;  2PUY A;  5I3L A;  3DPL R;  2L43 A;  2ECW A;  1X4I A;  2VPD A;  3EB6 A;  1Z2Q A;  2IDA A;  2Y43 A;  2M3H A;  4QF3 A;  4FJC A;  2LDR A;  2KGG A;  3U5N A;  2LGK A;  3O36 A;  4AP4 A;  1X4J A;  4S3O C;  2PNX A;  3ZYQ A;  2UZG A;  4N3W A;  2VJE B;  3LRQ A;  2LV9 A;  4WZ3 B;  4A4C A;  3L1Z B;  1K2F A;  1VYX A;  5D1L B;  1WEM A;  2AN6 A;  5LCW B;  1WE9 A;  5B75 A;  3SOX A;  1WES A;  2KWJ A;  2KR4 A;  2MD7 B;  2VNF A;  5FER A;  1Z6U A;  4UP0 A;  1LDK C;  4F52 B;  1E4U A;  2YU4 A;  4IC2 A;  1WEV A;  5LKU A;  2F6J A;  2LGG A;  3O35 A;  2F6N A;  4CCG X;  3KV6 A;  4X3G A;  2YUC A;  1FP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...