2K1JA

Plan homeodomain finger of tumour supressor ing4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
63
structure length
63
Chain Sequence
b'MDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 4
publication title Solution structure and NMR characterization of the binding to methylated histone tails of the plant homeodomain finger of the tumour suppressor ING4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 2
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k1jA00
4MVTA 3ZPVE 4YABA 1HYIA 2M85A 5LCWB 1V87A 1Z6UA 3RPGB 3HCTA 3IHPA 2AN6A 2XB1A 1JOCA 2LXPC 3PHDA 3U5PA 2FUIA 2ECJA 1X4JA 2L43A 1E4UA 4R7EA 2PUYA 1N87A 4N4FA 5C11A 4YADA 5G05B 4CCGX 2JMJA 3L11A 4LJNA 1WEEA 4N3WA 3PUQA 2C2LA 2ECGA 3QZVA 4I7BA 3SOXA 4GNEA 2KGGA 2YREA 4L58A 5H1VA 2QJ0A 3MHSA 5B78A 3ZNIA 3ZVYA 2VPBA 3O33A 4XI1A 2F42A 2G45A 3SOWA 3LQJA 2KU3A 4B7YC 2CKLB 3KNVA 2I50A 3LQIA 4AP4A 3U5NA 4GNDA 1VYXA 2KIZA 5FERA 2MD8C 2DX8A 2ECTA 1WEPA 5TDWA 3HCUA 1WE9A 1F62A 2KWKA 3N9QA 1WGMA 2FSAA 4P5OB 5FB0A 5FB1A 2KR4A 2VNFA 2MA6A 3VK6A 2L75A 1WESA 2YURA 1VFYA 2JRJA 1WEMA 1MM2A 3ASLA 4BBQA 5I3LA 5KH9A 4FK5A 1WEQA 5KH7A 1WFKA 2YQLA 2LGGA 4UI9B 2CKLA 2LQ6A 1RMDA 3L1XA 1G25A 2Y1NA 2IDAA 2UZGA 2LGVA 4QF3A 5J3XA 3RTRB 4FJCA 3PURA 1X4IA 2RI7A 2KE1A 5DKAA 5EYAF 2QICA 5B8DA 2RSDA 3NG2A 4QF2A 2BAYA 5LKXA 4V3KC 5TRBA 2KWOA 3O35A 4YATA 5H1UA 2LXHC 5B76A 5B75A 1FP0A 1JM7B 1WEVA 4BHWA 4L7XA 2YUCA 2KFTA 2H0DA 3C5KA 2YQMA 4ZQLA 4I7CA 2KGIA 2M6MA 4ZDTA 2K1JA 4WZ2A 3U5OA 1K2FA 1Z2QA 5AITA 4YBMA 2KWNA 4YBSA 4PTBA 2VP7A 4A49A 2E6RA 1U6GB 3GL6A 4YAXA 2Y1MA 2VPGA 5B79A 2Y43A 3EB5A 3HTKC 4S3OC 2XEUA 2PNXA 1WENA 3ZTGA 4ZUXU 2ECIA 1WEWA 2M1RA 4YBTA 3GV4A 1JM7A 5G04B 2ECWA 5FEYA 3O34A 4R8PK 2E6SA 2G6QA 4LLBA 2MNZA 4WA6A 3N9LA 2MT5A 2MUMA 3T6RA 2H0DB 2CSYA 4NN2A 4GNGA 4IC2A 4I7DA 2YHNA 1WEUA 4FO9A 4X3GA 4AUQB 4C9ZA 4R2YA 5TABA 3N9OA 4O64A 1WILA 2K16A 2L0BA 4WZ3B 3ZPV1 2LV9A 5TDRA 2MIQA 2LDRA 5G0FA 4LKAA 2KWJA 3HCSA 3SHBA 3M99A 4V3LC 4WZ0A 3O70A 2HYED 4A4BA 2ECVA 4FIPA 4W4UA 3ZVZB 2F6NA 4MSXA 2VJFB 2FUUA 2VJEB 2KREA 2K17A 3U5MA 3DPLR 2ECNA 3ZYQA 3V43A 4GB0A 4UP5A 2YW8A 4Q6FA 4B86C 2LN0A 2VPEA 2YSJA 4S3OB 3L1ZB 2QIZA 4LADB 5LKTA 4YC9A 3N9MA 2YSMA 3O7AA 5D1MB 2YU4A 2YT5A 2EODA 3M63A 2EA6A 2JMDA 3LRQA 3KQIA 3LQHA 3RPGC 2MNYA 2LGLA 3N9NA 1FBVA 2CSZA 4AYCA 3O36A 3O37A 2VJFA 2LRIC 5TBNA 2G43A 2LGKA 2ZETC 1BORA 2VJEA 1X4UA 3MHHA 1WEOA 3C6WA 5KH3A 4A0CD 2MA5A 2C2VS 5DINA 2KYUA 3FL2A 4F52B 1IYMA 5B77A 2M3HA 2YHOA 2CT2A 3DQVR 4UP0A 1Z60A 5H9MA 4TKPB 1VD4A 1LDJB 5AIUA 3T7LA 4A4CA 4GNFA 2EGPA 5LKZA 1T1HA 2VPDA 2L80A 2F6JA 1WIMA 4IC3A 1HYJA 4CA1A 1DVPA 2L5UA 3N9PA 4LK9A 2OXQC 1MM3A 2HDPA 2K4DA 2MD7B 3EB6A 2NAAA 1CHCA 5JG6A 4AYCB 5C13A 1LDKC 3KV6A 4PPEA 1ZBDB 2D8SA 5D1KB 2YYRA 4AVXA 3I2DA 3KV5A 5H1TA 3M62A 5D1LB 3SOUA 5LKUA 2JMIA 1XWHA
chains in the Genus database with same CATH superfamily
4MVTA 3ZPVE 4YABA 1HYIA 2M85A 2IQJA 5LCWB 1V87A 1Z6UA 3RPGB 3HCTA 2XOCA 2AN6A 3IHPA 2XB1A 1JOCA 2LXPC 3PHDA 3U5PA 2FUIA 2ECJA 1X4JA 2L43A 1E4UA 4R7EA 2PUYA 1N87A 2OWAA 4N4FA 5C11A 4YADA 5G05B 4CCGX 2JMJA 3JUEA 3L11A 4LJNA 1WEEA 4N3WA 3PUQA 2C2LA 2ECGA 4Z0OA 3QZVA 4I7BA 3SOXA 4GNEA 2KGGA 2YREA 4L58A 5H1VA 2QJ0A 3MHSA 5B78A 3ZNIA 2JUNA 3ZVYA 3O47A 2VPBA 3O33A 5K3QA 4XI1A 3DDTA 2F42A 2G45A 3SOWA 3LQJA 2KU3A 4B7YC 2CKLB 3KNVA 2I50A 3LQIA 4AP4A 3U5NA 4GNDA 1VYXA 2KIZA 5FERA 2MD8C 2DX8A 2ECTA 1WEPA 2P57A 4OGEA 5TDWA 3HCUA 1WE9A 1F62A 5SVXA 2KWKA 3N9QA 1WGMA 2FSAA 4P5OB 5FB0A 5FB1A 2KR4A 2VNFA 2MA6A 3VK6A 2L75A 1WESA 2YURA 1VFYA 2JRJA 5SVYA 1WEMA 1MM2A 3ASLA 4BBQA 2KKXA 5I3LA 5KH9A 2EGMA 4FK5A 1WEQA 5KH7A 1WFKA 2YQLA 2LGGA 4UI9B 2CKLA 2LQ6A 1RMDA 3L1XA 1G25A 2Y1NA 2IDAA 2UZGA 2LGVA 4QF3A 5J3XA 3RTRB 4FJCA 3PURA 2CONA 1X4IA 2RI7A 2KE1A 2DSMA 5DKAA 5EYAF 2QICA 3LJUX 5B8DA 2RSDA 3NG2A 2EXUA 4QF2A 2BAYA 5LKXA 4V3KC 5TRBA 2KWOA 3O35A 3T9KA 4YATA 5H1UA 2LXHC 5B76A 2XOYA 5B75A 1FP0A 1JM7B 1WEVA 3SUBA 4BHWA 4L7XA 2YUCA 2KFTA 2H0DA 3C5KA 3LDYA 2YQMA 4ZQLA 4I7CA 2KGIA 2M6MA 3Q1DA 4ZDTA 2K1JA 4WZ2A 3U5OA 1K2FA 1Z2QA 5AITA 4YBMA 2KWNA 4YBSA 2MKEA 4PTBA 2CRWA 2VP7A 3FAOA 4A49A 2E6RA 1U6GB 3GL6A 4YAXA 2Y1MA 2VPGA 5B79A 2Y43A 3EB5A 3HTKC 3DWDA 4S3OC 2XEUA 2PNXA 1WENA 2FD4A 3ZTGA 4ZUXU 2ECIA 1WEWA 2M1RA 4O62A 4OGCA 4YBTA 3GV4A 1JM7A 4Z0RA 5G04B 2ECWA 5FEYA 3O34A 4R8PK 2E6SA 2G6QA 3H7HA 3LVRE 4LLBA 2MNZA 4WA6A 3N9LA 2MT5A 2MUMA 3E2DA 3FANA 3T6RA 2H0DB 2CSYA 4NN2A 4GNGA 4IC2A 4I7DA 2YHNA 1WEUA 2DJAA 4FO9A 4X3GA 4AUQB 4C9ZA 4R2YA 5TABA 2D8UA 3N9OA 4O64A 1WILA 2K16A 2L0BA 3FJUB 4WZ3B 3ZPV1 2LV9A 5TDRA 2MIQA 2LDRA 5G0FA 4LKAA 2KWJA 3HCSA 3SHBA 2FFWA 3M99A 3M7KA 4V3LC 4WZ0A 3O70A 2HYED 4A4BA 2ECVA 4FIPA 4W4UA 3ZVZB 2F6NA 4MSXA 2VJFB 2FUUA 2KKYA 2VJEB 2KREA 2YVRA 1DCQA 2K17A 3U5MA 3DPLR 2ECNA 3ZYQA 2JM3A 3PLWA 3V43A 4GB0A 4UP5A 2YW8A 4Q6FA 4B86C 2LN0A 3FEHA 2VPEA 2YSJA 4S3OB 5SVIA 2B0OE 3L1ZB 2QIZA 4LADB 5LKTA 4YC9A 3N9MA 2YSMA 3O7AA 5D1MB 2YU4A 2YT5A 2EODA 3M63A 2EA6A 2L7PA 2JMDA 2XP0A 3LRQA 4H9DA 3KQIA 3LQHA 3RPGC 2MNYA 2CSVA 2LGLA 3N9NA 1FBVA 2CSZA 4AYCA 3O36A 3O37A 4QQ4A 1MBMA 2VJFA 2LRIC 5TBNA 2G43A 2LGKA 2XOZA 2ZETC 1BORA 2VJEA 1X4UA 3MHHA 1WEOA 3LVQE 2CRRA 3C6WA 5KH3A 4A0CD 2MA5A 2C2VS 5DINA 2KYUA 3FL2A 4F52B 1IYMA 5B77A 2M3HA 2YHOA 2CT2A 3DQVR 4UP0A 1Z60A 5H9MA 4TKPB 1VD4A 1LDJB 5AIUA 5SVIB 3T7LA 4F1PA 4A4CA 4GNFA 2EGPA 2LAUA 5LKZA 1T1HA 2VPDA 2L80A 2F6JA 1WIMA 4IC3A 1HYJA 4CA1A 1DVPA 2L5UA 3N9PA 4LK9A 2OXQC 3FM8C 1MM3A 2HDPA 2K4DA 2MD7B 3EB6A 2NAAA 2E61A 1CHCA 5JG6A 4AYCB 5C13A 1LDKC 3KV6A 4PPEA 1ZBDB 2D8SA 5D1KB 2YYRA 4AVXA 3I2DA 3KV5A 5H1TA 3KDEC 3M62A 3MDBC 5D1LB 3SOUA 2M13A 5LKUA 2JMIA 2RR4A 1XWHA
chains in the Genus database with same CATH topology
4MVTA 3ZPVE 4YABA 1HYIA 2M85A 5LCWB 1V87A 1Z6UA 3RPGB 3HCTA 3IHPA 2AN6A 2XB1A 1JOCA 2LXPC 3PHDA 3U5PA 2FUIA 2ECJA 1X4JA 2L43A 1E4UA 4R7EA 2PUYA 1N87A 4N4FA 5C11A 4YADA 5G05B 4CCGX 2JMJA 3L11A 4LJNA 1WEEA 4N3WA 3PUQA 2C2LA 2ECGA 3QZVA 4I7BA 3SOXA 4GNEA 2KGGA 2YREA 4L58A 5H1VA 2QJ0A 3MHSA 5B78A 3ZNIA 3ZVYA 2VPBA 3O33A 4XI1A 2F42A 2G45A 3SOWA 3LQJA 2KU3A 4B7YC 2CKLB 3KNVA 2I50A 3LQIA 4AP4A 3U5NA 4GNDA 1VYXA 2KIZA 5FERA 2MD8C 2DX8A 2ECTA 1WEPA 5TDWA 3HCUA 1WE9A 1F62A 2KWKA 3N9QA 1WGMA 2FSAA 4P5OB 5FB0A 5FB1A 2KR4A 2VNFA 2MA6A 3VK6A 2L75A 1WESA 2YURA 1VFYA 2JRJA 1WEMA 1MM2A 3ASLA 4BBQA 5I3LA 5KH9A 4FK5A 1WEQA 5KH7A 1WFKA 2YQLA 2LGGA 4UI9B 2CKLA 2LQ6A 1RMDA 3L1XA 1G25A 2Y1NA 2IDAA 2UZGA 2LGVA 4QF3A 5J3XA 3RTRB 4FJCA 3PURA 1X4IA 2RI7A 2KE1A 5DKAA 5EYAF 2QICA 5B8DA 2RSDA 3NG2A 4QF2A 2BAYA 5LKXA 4V3KC 5TRBA 2KWOA 3O35A 4YATA 5H1UA 2LXHC 5B76A 5B75A 1FP0A 1JM7B 1WEVA 4BHWA 4L7XA 2YUCA 2KFTA 2H0DA 3C5KA 2YQMA 4ZQLA 4I7CA 2KGIA 2M6MA 4ZDTA 2K1JA 4WZ2A 3U5OA 1K2FA 1Z2QA 5AITA 4YBMA 2KWNA 4YBSA 4PTBA 2VP7A 4A49A 2E6RA 1U6GB 3GL6A 4YAXA 2Y1MA 2VPGA 5B79A 2Y43A 3EB5A 3HTKC 4S3OC 2XEUA 2PNXA 1WENA 3ZTGA 4ZUXU 2ECIA 1WEWA 2M1RA 4YBTA 3GV4A 1JM7A 5G04B 2ECWA 5FEYA 3O34A 4R8PK 2E6SA 2G6QA 4LLBA 2MNZA 4WA6A 3N9LA 2MT5A 2MUMA 3T6RA 2H0DB 2CSYA 4NN2A 4GNGA 4IC2A 4I7DA 2YHNA 1WEUA 4FO9A 4X3GA 4AUQB 4C9ZA 4R2YA 5TABA 3N9OA 4O64A 1WILA 2K16A 2L0BA 4WZ3B 3ZPV1 2LV9A 5TDRA 2MIQA 2LDRA 5G0FA 4LKAA 2KWJA 3HCSA 3SHBA 3M99A 4V3LC 4WZ0A 3O70A 2HYED 4A4BA 2ECVA 4FIPA 4W4UA 3ZVZB 2F6NA 4MSXA 2VJFB 2FUUA 2VJEB 2KREA 2K17A 3U5MA 3DPLR 2ECNA 3ZYQA 3V43A 4GB0A 4UP5A 2YW8A 4Q6FA 4B86C 2LN0A 2VPEA 2YSJA 4S3OB 3L1ZB 2QIZA 4LADB 5LKTA 4YC9A 3N9MA 2YSMA 3O7AA 5D1MB 2YU4A 2YT5A 2EODA 3M63A 2EA6A 2JMDA 3LRQA 3KQIA 3LQHA 3RPGC 2MNYA 2LGLA 3N9NA 1FBVA 2CSZA 4AYCA 3O36A 3O37A 2VJFA 2LRIC 5TBNA 2G43A 2LGKA 2ZETC 1BORA 2VJEA 1X4UA 3MHHA 1WEOA 3C6WA 5KH3A 4A0CD 2MA5A 2C2VS 5DINA 2KYUA 3FL2A 4F52B 1IYMA 5B77A 2M3HA 2YHOA 2CT2A 3DQVR 4UP0A 1Z60A 5H9MA 4TKPB 1VD4A 1LDJB 5AIUA 3T7LA 4A4CA 4GNFA 2EGPA 5LKZA 1T1HA 2VPDA 2L80A 2F6JA 1WIMA 4IC3A 1HYJA 4CA1A 1DVPA 2L5UA 3N9PA 4LK9A 2OXQC 1MM3A 2HDPA 2K4DA 2MD7B 3EB6A 2NAAA 1CHCA 5JG6A 4AYCB 5C13A 1LDKC 3KV6A 4PPEA 1ZBDB 2D8SA 5D1KB 2YYRA 4AVXA 3I2DA 3KV5A 5H1TA 3M62A 5D1LB 3SOUA 5LKUA 2JMIA 1XWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVT A;  3ZPV E;  4YAB A;  1HYI A;  2M85 A;  5LCW B;  1V87 A;  1Z6U A;  3RPG B;  3HCT A;  3IHP A;  2AN6 A;  2XB1 A;  1JOC A;  2LXP C;  3PHD A;  3U5P A;  2FUI A;  2ECJ A;  1X4J A;  2L43 A;  1E4U A;  4R7E A;  2PUY A;  1N87 A;  4N4F A;  5C11 A;  4YAD A;  5G05 B;  4CCG X;  2JMJ A;  3L11 A;  4LJN A;  1WEE A;  4N3W A;  3PUQ A;  2C2L A;  2ECG A;  3QZV A;  4I7B A;  3SOX A;  4GNE A;  2KGG A;  2YRE A;  4L58 A;  5H1V A;  2QJ0 A;  3MHS A;  5B78 A;  3ZNI A;  3ZVY A;  2VPB A;  3O33 A;  4XI1 A;  2F42 A;  2G45 A;  3SOW A;  3LQJ A;  2KU3 A;  4B7Y C;  2CKL B;  3KNV A;  2I50 A;  3LQI A;  4AP4 A;  3U5N A;  4GND A;  1VYX A;  2KIZ A;  5FER A;  2MD8 C;  2DX8 A;  2ECT A;  1WEP A;  5TDW A;  3HCU A;  1WE9 A;  1F62 A;  2KWK A;  3N9Q A;  1WGM A;  2FSA A;  4P5O B;  5FB0 A;  5FB1 A;  2KR4 A;  2VNF A;  2MA6 A;  3VK6 A;  2L75 A;  1WES A;  2YUR A;  1VFY A;  2JRJ A;  1WEM A;  1MM2 A;  3ASL A;  4BBQ A;  5I3L A;  5KH9 A;  4FK5 A;  1WEQ A;  5KH7 A;  1WFK A;  2YQL A;  2LGG A;  4UI9 B;  2CKL A;  2LQ6 A;  1RMD A;  3L1X A;  1G25 A;  2Y1N A;  2IDA A;  2UZG A;  2LGV A;  4QF3 A;  5J3X A;  3RTR B;  4FJC A;  3PUR A;  1X4I A;  2RI7 A;  2KE1 A;  5DKA A;  5EYA F;  2QIC A;  5B8D A;  2RSD A;  3NG2 A;  4QF2 A;  2BAY A;  5LKX A;  4V3K C;  5TRB A;  2KWO A;  3O35 A;  4YAT A;  5H1U A;  2LXH C;  5B76 A;  5B75 A;  1FP0 A;  1JM7 B;  1WEV A;  4BHW A;  4L7X A;  2YUC A;  2KFT A;  2H0D A;  3C5K A;  2YQM A;  4ZQL A;  4I7C A;  2KGI A;  2M6M A;  4ZDT A;  2K1J A;  4WZ2 A;  3U5O A;  1K2F A;  1Z2Q A;  5AIT A;  4YBM A;  2KWN A;  4YBS A;  4PTB A;  2VP7 A;  4A49 A;  2E6R A;  1U6G B;  3GL6 A;  4YAX A;  2Y1M A;  2VPG A;  5B79 A;  2Y43 A;  3EB5 A;  3HTK C;  4S3O C;  2XEU A;  2PNX A;  1WEN A;  3ZTG A;  4ZUX U;  2ECI A;  1WEW A;  2M1R A;  4YBT A;  3GV4 A;  1JM7 A;  5G04 B;  2ECW A;  5FEY A;  3O34 A;  4R8P K;  2E6S A;  2G6Q A;  4LLB A;  2MNZ A;  4WA6 A;  3N9L A;  2MT5 A;  2MUM A;  3T6R A;  2H0D B;  2CSY A;  4NN2 A;  4GNG A;  4IC2 A;  4I7D A;  2YHN A;  1WEU A;  4FO9 A;  4X3G A;  4AUQ B;  4C9Z A;  4R2Y A;  5TAB A;  3N9O A;  4O64 A;  1WIL A;  2K16 A;  2L0B A;  4WZ3 B;  3ZPV 1;  2LV9 A;  5TDR A;  2MIQ A;  2LDR A;  5G0F A;  4LKA A;  2KWJ A;  3HCS A;  3SHB A;  3M99 A;  4V3L C;  4WZ0 A;  3O70 A;  2HYE D;  4A4B A;  2ECV A;  4FIP A;  4W4U A;  3ZVZ B;  2F6N A;  4MSX A;  2VJF B;  2FUU A;  2VJE B;  2KRE A;  2K17 A;  3U5M A;  3DPL R;  2ECN A;  3ZYQ A;  3V43 A;  4GB0 A;  4UP5 A;  2YW8 A;  4Q6F A;  4B86 C;  2LN0 A;  2VPE A;  2YSJ A;  4S3O B;  3L1Z B;  2QIZ A;  4LAD B;  5LKT A;  4YC9 A;  3N9M A;  2YSM A;  3O7A A;  5D1M B;  2YU4 A;  2YT5 A;  2EOD A;  3M63 A;  2EA6 A;  2JMD A;  3LRQ A;  3KQI A;  3LQH A;  3RPG C;  2MNY A;  2LGL A;  3N9N A;  1FBV A;  2CSZ A;  4AYC A;  3O36 A;  3O37 A;  2VJF A;  2LRI C;  5TBN A;  2G43 A;  2LGK A;  2ZET C;  1BOR A;  2VJE A;  1X4U A;  3MHH A;  1WEO A;  3C6W A;  5KH3 A;  4A0C D;  2MA5 A;  2C2V S;  5DIN A;  2KYU A;  3FL2 A;  4F52 B;  1IYM A;  5B77 A;  2M3H A;  2YHO A;  2CT2 A;  3DQV R;  4UP0 A;  1Z60 A;  5H9M A;  4TKP B;  1VD4 A;  1LDJ B;  5AIU A;  3T7L A;  4A4C A;  4GNF A;  2EGP A;  5LKZ A;  1T1H A;  2VPD A;  2L80 A;  2F6J A;  1WIM A;  4IC3 A;  1HYJ A;  4CA1 A;  1DVP A;  2L5U A;  3N9P A;  4LK9 A;  2OXQ C;  1MM3 A;  2HDP A;  2K4D A;  2MD7 B;  3EB6 A;  2NAA A;  1CHC A;  5JG6 A;  4AYC B;  5C13 A;  1LDK C;  3KV6 A;  4PPE A;  1ZBD B;  2D8S A;  5D1K B;  2YYR A;  4AVX A;  3I2D A;  3KV5 A;  5H1T A;  3M62 A;  5D1L B;  3SOU A;  5LKU A;  2JMI A;  1XWH A; 
#chains in the Genus database with same CATH topology
 4MVT A;  3ZPV E;  4YAB A;  1HYI A;  2M85 A;  2IQJ A;  5LCW B;  1V87 A;  1Z6U A;  3RPG B;  3HCT A;  2XOC A;  2AN6 A;  3IHP A;  2XB1 A;  1JOC A;  2LXP C;  3PHD A;  3U5P A;  2FUI A;  2ECJ A;  1X4J A;  2L43 A;  1E4U A;  4R7E A;  2PUY A;  1N87 A;  2OWA A;  4N4F A;  5C11 A;  4YAD A;  5G05 B;  4CCG X;  2JMJ A;  3JUE A;  3L11 A;  4LJN A;  1WEE A;  4N3W A;  3PUQ A;  2C2L A;  2ECG A;  4Z0O A;  3QZV A;  4I7B A;  3SOX A;  4GNE A;  2KGG A;  2YRE A;  4L58 A;  5H1V A;  2QJ0 A;  3MHS A;  5B78 A;  3ZNI A;  2JUN A;  3ZVY A;  3O47 A;  2VPB A;  3O33 A;  5K3Q A;  4XI1 A;  3DDT A;  2F42 A;  2G45 A;  3SOW A;  3LQJ A;  2KU3 A;  4B7Y C;  2CKL B;  3KNV A;  2I50 A;  3LQI A;  4AP4 A;  3U5N A;  4GND A;  1VYX A;  2KIZ A;  5FER A;  2MD8 C;  2DX8 A;  2ECT A;  1WEP A;  2P57 A;  4OGE A;  5TDW A;  3HCU A;  1WE9 A;  1F62 A;  5SVX A;  2KWK A;  3N9Q A;  1WGM A;  2FSA A;  4P5O B;  5FB0 A;  5FB1 A;  2KR4 A;  2VNF A;  2MA6 A;  3VK6 A;  2L75 A;  1WES A;  2YUR A;  1VFY A;  2JRJ A;  5SVY A;  1WEM A;  1MM2 A;  3ASL A;  4BBQ A;  2KKX A;  5I3L A;  5KH9 A;  2EGM A;  4FK5 A;  1WEQ A;  5KH7 A;  1WFK A;  2YQL A;  2LGG A;  4UI9 B;  2CKL A;  2LQ6 A;  1RMD A;  3L1X A;  1G25 A;  2Y1N A;  2IDA A;  2UZG A;  2LGV A;  4QF3 A;  5J3X A;  3RTR B;  4FJC A;  3PUR A;  2CON A;  1X4I A;  2RI7 A;  2KE1 A;  2DSM A;  5DKA A;  5EYA F;  2QIC A;  3LJU X;  5B8D A;  2RSD A;  3NG2 A;  2EXU A;  4QF2 A;  2BAY A;  5LKX A;  4V3K C;  5TRB A;  2KWO A;  3O35 A;  3T9K A;  4YAT A;  5H1U A;  2LXH C;  5B76 A;  2XOY A;  5B75 A;  1FP0 A;  1JM7 B;  1WEV A;  3SUB A;  4BHW A;  4L7X A;  2YUC A;  2KFT A;  2H0D A;  3C5K A;  3LDY A;  2YQM A;  4ZQL A;  4I7C A;  2KGI A;  2M6M A;  3Q1D A;  4ZDT A;  2K1J A;  4WZ2 A;  3U5O A;  1K2F A;  1Z2Q A;  5AIT A;  4YBM A;  2KWN A;  4YBS A;  2MKE A;  4PTB A;  2CRW A;  2VP7 A;  3FAO A;  4A49 A;  2E6R A;  1U6G B;  3GL6 A;  4YAX A;  2Y1M A;  2VPG A;  5B79 A;  2Y43 A;  3EB5 A;  3HTK C;  3DWD A;  4S3O C;  2XEU A;  2PNX A;  1WEN A;  2FD4 A;  3ZTG A;  4ZUX U;  2ECI A;  1WEW A;  2M1R A;  4O62 A;  4OGC A;  4YBT A;  3GV4 A;  1JM7 A;  4Z0R A;  5G04 B;  2ECW A;  5FEY A;  3O34 A;  4R8P K;  2E6S A;  2G6Q A;  3H7H A;  3LVR E;  4LLB A;  2MNZ A;  4WA6 A;  3N9L A;  2MT5 A;  2MUM A;  3E2D A;  3FAN A;  3T6R A;  2H0D B;  2CSY A;  4NN2 A;  4GNG A;  4IC2 A;  4I7D A;  2YHN A;  1WEU A;  2DJA A;  4FO9 A;  4X3G A;  4AUQ B;  4C9Z A;  4R2Y A;  5TAB A;  2D8U A;  3N9O A;  4O64 A;  1WIL A;  2K16 A;  2L0B A;  3FJU B;  4WZ3 B;  3ZPV 1;  2LV9 A;  5TDR A;  2MIQ A;  2LDR A;  5G0F A;  4LKA A;  2KWJ A;  3HCS A;  3SHB A;  2FFW A;  3M99 A;  3M7K A;  4V3L C;  4WZ0 A;  3O70 A;  2HYE D;  4A4B A;  2ECV A;  4FIP A;  4W4U A;  3ZVZ B;  2F6N A;  4MSX A;  2VJF B;  2FUU A;  2KKY A;  2VJE B;  2KRE A;  2YVR A;  1DCQ A;  2K17 A;  3U5M A;  3DPL R;  2ECN A;  3ZYQ A;  2JM3 A;  3PLW A;  3V43 A;  4GB0 A;  4UP5 A;  2YW8 A;  4Q6F A;  4B86 C;  2LN0 A;  3FEH A;  2VPE A;  2YSJ A;  4S3O B;  5SVI A;  2B0O E;  3L1Z B;  2QIZ A;  4LAD B;  5LKT A;  4YC9 A;  3N9M A;  2YSM A;  3O7A A;  5D1M B;  2YU4 A;  2YT5 A;  2EOD A;  3M63 A;  2EA6 A;  2L7P A;  2JMD A;  2XP0 A;  3LRQ A;  4H9D A;  3KQI A;  3LQH A;  3RPG C;  2MNY A;  2CSV A;  2LGL A;  3N9N A;  1FBV A;  2CSZ A;  4AYC A;  3O36 A;  3O37 A;  4QQ4 A;  1MBM A;  2VJF A;  2LRI C;  5TBN A;  2G43 A;  2LGK A;  2XOZ A;  2ZET C;  1BOR A;  2VJE A;  1X4U A;  3MHH A;  1WEO A;  3LVQ E;  2CRR A;  3C6W A;  5KH3 A;  4A0C D;  2MA5 A;  2C2V S;  5DIN A;  2KYU A;  3FL2 A;  4F52 B;  1IYM A;  5B77 A;  2M3H A;  2YHO A;  2CT2 A;  3DQV R;  4UP0 A;  1Z60 A;  5H9M A;  4TKP B;  1VD4 A;  1LDJ B;  5AIU A;  5SVI B;  3T7L A;  4F1P A;  4A4C A;  4GNF A;  2EGP A;  2LAU A;  5LKZ A;  1T1H A;  2VPD A;  2L80 A;  2F6J A;  1WIM A;  4IC3 A;  1HYJ A;  4CA1 A;  1DVP A;  2L5U A;  3N9P A;  4LK9 A;  2OXQ C;  3FM8 C;  1MM3 A;  2HDP A;  2K4D A;  2MD7 B;  3EB6 A;  2NAA A;  2E61 A;  1CHC A;  5JG6 A;  4AYC B;  5C13 A;  1LDK C;  3KV6 A;  4PPE A;  1ZBD B;  2D8S A;  5D1K B;  2YYR A;  4AVX A;  3I2D A;  3KV5 A;  5H1T A;  3KDE C;  3M62 A;  3MDB C;  5D1L B;  3SOU A;  2M13 A;  5LKU A;  2JMI A;  2RR4 A;  1XWH A; 
#chains in the Genus database with same CATH homology
 4MVT A;  3ZPV E;  4YAB A;  1HYI A;  2M85 A;  5LCW B;  1V87 A;  1Z6U A;  3RPG B;  3HCT A;  3IHP A;  2AN6 A;  2XB1 A;  1JOC A;  2LXP C;  3PHD A;  3U5P A;  2FUI A;  2ECJ A;  1X4J A;  2L43 A;  1E4U A;  4R7E A;  2PUY A;  1N87 A;  4N4F A;  5C11 A;  4YAD A;  5G05 B;  4CCG X;  2JMJ A;  3L11 A;  4LJN A;  1WEE A;  4N3W A;  3PUQ A;  2C2L A;  2ECG A;  3QZV A;  4I7B A;  3SOX A;  4GNE A;  2KGG A;  2YRE A;  4L58 A;  5H1V A;  2QJ0 A;  3MHS A;  5B78 A;  3ZNI A;  3ZVY A;  2VPB A;  3O33 A;  4XI1 A;  2F42 A;  2G45 A;  3SOW A;  3LQJ A;  2KU3 A;  4B7Y C;  2CKL B;  3KNV A;  2I50 A;  3LQI A;  4AP4 A;  3U5N A;  4GND A;  1VYX A;  2KIZ A;  5FER A;  2MD8 C;  2DX8 A;  2ECT A;  1WEP A;  5TDW A;  3HCU A;  1WE9 A;  1F62 A;  2KWK A;  3N9Q A;  1WGM A;  2FSA A;  4P5O B;  5FB0 A;  5FB1 A;  2KR4 A;  2VNF A;  2MA6 A;  3VK6 A;  2L75 A;  1WES A;  2YUR A;  1VFY A;  2JRJ A;  1WEM A;  1MM2 A;  3ASL A;  4BBQ A;  5I3L A;  5KH9 A;  4FK5 A;  1WEQ A;  5KH7 A;  1WFK A;  2YQL A;  2LGG A;  4UI9 B;  2CKL A;  2LQ6 A;  1RMD A;  3L1X A;  1G25 A;  2Y1N A;  2IDA A;  2UZG A;  2LGV A;  4QF3 A;  5J3X A;  3RTR B;  4FJC A;  3PUR A;  1X4I A;  2RI7 A;  2KE1 A;  5DKA A;  5EYA F;  2QIC A;  5B8D A;  2RSD A;  3NG2 A;  4QF2 A;  2BAY A;  5LKX A;  4V3K C;  5TRB A;  2KWO A;  3O35 A;  4YAT A;  5H1U A;  2LXH C;  5B76 A;  5B75 A;  1FP0 A;  1JM7 B;  1WEV A;  4BHW A;  4L7X A;  2YUC A;  2KFT A;  2H0D A;  3C5K A;  2YQM A;  4ZQL A;  4I7C A;  2KGI A;  2M6M A;  4ZDT A;  2K1J A;  4WZ2 A;  3U5O A;  1K2F A;  1Z2Q A;  5AIT A;  4YBM A;  2KWN A;  4YBS A;  4PTB A;  2VP7 A;  4A49 A;  2E6R A;  1U6G B;  3GL6 A;  4YAX A;  2Y1M A;  2VPG A;  5B79 A;  2Y43 A;  3EB5 A;  3HTK C;  4S3O C;  2XEU A;  2PNX A;  1WEN A;  3ZTG A;  4ZUX U;  2ECI A;  1WEW A;  2M1R A;  4YBT A;  3GV4 A;  1JM7 A;  5G04 B;  2ECW A;  5FEY A;  3O34 A;  4R8P K;  2E6S A;  2G6Q A;  4LLB A;  2MNZ A;  4WA6 A;  3N9L A;  2MT5 A;  2MUM A;  3T6R A;  2H0D B;  2CSY A;  4NN2 A;  4GNG A;  4IC2 A;  4I7D A;  2YHN A;  1WEU A;  4FO9 A;  4X3G A;  4AUQ B;  4C9Z A;  4R2Y A;  5TAB A;  3N9O A;  4O64 A;  1WIL A;  2K16 A;  2L0B A;  4WZ3 B;  3ZPV 1;  2LV9 A;  5TDR A;  2MIQ A;  2LDR A;  5G0F A;  4LKA A;  2KWJ A;  3HCS A;  3SHB A;  3M99 A;  4V3L C;  4WZ0 A;  3O70 A;  2HYE D;  4A4B A;  2ECV A;  4FIP A;  4W4U A;  3ZVZ B;  2F6N A;  4MSX A;  2VJF B;  2FUU A;  2VJE B;  2KRE A;  2K17 A;  3U5M A;  3DPL R;  2ECN A;  3ZYQ A;  3V43 A;  4GB0 A;  4UP5 A;  2YW8 A;  4Q6F A;  4B86 C;  2LN0 A;  2VPE A;  2YSJ A;  4S3O B;  3L1Z B;  2QIZ A;  4LAD B;  5LKT A;  4YC9 A;  3N9M A;  2YSM A;  3O7A A;  5D1M B;  2YU4 A;  2YT5 A;  2EOD A;  3M63 A;  2EA6 A;  2JMD A;  3LRQ A;  3KQI A;  3LQH A;  3RPG C;  2MNY A;  2LGL A;  3N9N A;  1FBV A;  2CSZ A;  4AYC A;  3O36 A;  3O37 A;  2VJF A;  2LRI C;  5TBN A;  2G43 A;  2LGK A;  2ZET C;  1BOR A;  2VJE A;  1X4U A;  3MHH A;  1WEO A;  3C6W A;  5KH3 A;  4A0C D;  2MA5 A;  2C2V S;  5DIN A;  2KYU A;  3FL2 A;  4F52 B;  1IYM A;  5B77 A;  2M3H A;  2YHO A;  2CT2 A;  3DQV R;  4UP0 A;  1Z60 A;  5H9M A;  4TKP B;  1VD4 A;  1LDJ B;  5AIU A;  3T7L A;  4A4C A;  4GNF A;  2EGP A;  5LKZ A;  1T1H A;  2VPD A;  2L80 A;  2F6J A;  1WIM A;  4IC3 A;  1HYJ A;  4CA1 A;  1DVP A;  2L5U A;  3N9P A;  4LK9 A;  2OXQ C;  1MM3 A;  2HDP A;  2K4D A;  2MD7 B;  3EB6 A;  2NAA A;  1CHC A;  5JG6 A;  4AYC B;  5C13 A;  1LDK C;  3KV6 A;  4PPE A;  1ZBD B;  2D8S A;  5D1K B;  2YYR A;  4AVX A;  3I2D A;  3KV5 A;  5H1T A;  3M62 A;  5D1L B;  3SOU A;  5LKU A;  2JMI A;  1XWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...