2K1JA

Plan homeodomain finger of tumour supressor ing4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
63
structure length
63
Chain Sequence
MDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 4
publication title Solution structure and NMR characterization of the binding to methylated histone tails of the plant homeodomain finger of the tumour suppressor ING4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 2
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k1jA00
5KH7A 5FB0A 5B77A 4UI9B 2CKLB 4CCGX 2LGGA 3O70A 5I3LA 5B79A 1JOCA 1FBVA 2MT5A 2LN0A 2LV9A 5H9MA 3N9LA 2VNFA 4B86C 2QICA 1U6GB 4LLBA 2MNYA 2KREA 3VK6A 2M6MA 1WE9A 2KIZA 2G45A 4O64A 4XI1A 4YABA 2E6SA 2RI7A 4F52B 4TKPB 1WFKA 1E4UA 4YBMA 2IDAA 2MNZA 2MUMA 1WEQA 4V3LC 3PHDA 1WEMA 3ZNIA 2L5UA 4R2YA 4CA1A 1JM7B 4I7CA 3LRQA 5D1MB 4WZ0A 2ECVA 2RSDA 2Y1NA 3HCUA 2YU4A 2Y1MA 5KH9A 2ECWA 4R7EA 4FJCA 5TBNA 4I7DA 3O36A 4Q6FA 3O33A 4X3GA 4YBTA 1MM3A 1WEOA 2YUCA 4AP4A 3ASLA 5C13A 2KR4A 1HYJA 3O35A 2CSYA 2YSMA 2MA6A 2C2VS 4FO9A 3KV6A 2VJEB 2L80A 3N9MA 3FL2A 2QIZA 3RPGC 2YQMA 4WZ2A 3NG2A 3RTRB 2M3HA 5FEYA 2KU3A 4MVTA 5DINA 5B78A 4GNGA 3U5PA 3U5NA 2YHOA 3LQIA 4L58A 3SOWA 5J3XA 2ECJA 5H1VA 2F6JA 2EA6A 5C11A 1WEPA 5D1KB 3O7AA 3GL6A 1X4JA 2LXPC 4A49A 3KV5A 2VJFA 4I7BA 2EODA 4S3OC 3IHPA 1XWHA 2H0DA 2K16A 2JMDA 4A4CA 4GNFA 4YC9A 3HCSA 3RPGB 2LRIC 3ZVYA 2VJEA 3L1ZB 5TABA 1F62A 3U5OA 5DKAA 2YHNA 2KGIA 2K4DA 2K17A 4N3WA 4ZQLA 2VP7A 5LKTA 2AN6A 3MHHA 2MIQA 3L1XA 2PUYA 4LKAA 3EB6A 4AYCA 5H1TA 2I50A 3DPLR 4P5OB 4IC3A 3ZYQA 5FB1A 2M85A 4S3OB 3O34A 4A4BA 1X4UA 5H1UA 2HYED 5G05B 4QF3A 4LK9A 2MD7B 1FP0A 1G25A 2NAAA 2XB1A 3L11A 4GNDA 2QJ0A 2ECGA 4AUQB 2JMJA 3KQIA 1WEVA 5LKXA 2K1JA 4WZ3B 4L7XA 2VJFB 4LJNA 2YYRA 2LGLA 2H0DB 4GNEA 1Z6UA 2KWJA 2KWNA 2ECIA 2LDRA 3PURA 2KWKA 4FIPA 2Y43A 2CSZA 4UP0A 2KYUA 2EGPA 3O37A 1N87A 3HTKC 5D1LB 4GB0A 2YQLA 4A0CD 4NN2A 5B8DA 4BHWA 2DX8A 4IC2A 4PTBA 2MD8C 1VFYA 2LQ6A 1VD4A 3C5KA 4N4FA 1WEUA 4AYCB 3MHSA 1CHCA 1WEWA 4AVXA 2UZGA 3QZVA 5AITA 5TRBA 4WA6A 4MSXA 5B76A 2KWOA 2VPDA 1WIMA 2VPGA 1WENA 2G6QA 1RMDA 2KFTA 5TDRA 2L0BA 1T1HA 4ZUXU 3ZTGA 1HYIA 2JMIA 5FERA 3N9NA 4PPEA 2YT5A 3EB5A 2PNXA 1WILA 2F42A 2VPBA 1WGMA 1WEEA 3V43A 5G04B 3ZPVE 1LDJB 4UP5A 1LDKC 2L75A 1ZBDB 3M63A 3SOXA 3T7LA 2ECNA 4FK5A 1IYMA 4YBSA 3ZPV1 2FUIA 2YURA 3SOUA 2F6NA 2ECTA 3N9PA 2D8SA 2YSJA 2FSAA 5LKUA 3SHBA 2VPEA 1VYXA 5EYAF 1WESA 2KGGA 2LGKA 2CKLA 2FUUA 1K2FA 1BORA 2G43A 3ZVZB 2LXHC 2XEUA 2M1RA 5G0FA 5JG6A 4ZDTA 2JRJA 1Z2QA 4B7YC 2LGVA 3LQJA 3M62A 3HCTA 3LQHA 4C9ZA 2E6RA 3T6RA 4QF2A 2YREA 5TDWA 1MM2A 1V87A 3GV4A 5KH3A 1Z60A 3M99A 1DVPA 5LCWB 4BBQA 2YW8A 2HDPA 2MA5A 4R8PK 3DQVR 2BAYA 3N9QA 3C6WA 1JM7A 3I2DA 3KNVA 2L43A 4YAXA 4W4UA 4YADA 5LKZA 2KE1A 2CT2A 5B75A 2ZETC 5AIUA 3U5MA 4V3KC 3N9OA 4LADB 2C2LA 4YATA 1X4IA 3PUQA 2OXQC
chains in the Genus database with same CATH superfamily
5KH7A 5FB0A 2CONA 5B77A 4UI9B 2CKLB 4CCGX 2LGGA 3O70A 3DDTA 5I3LA 5B79A 1JOCA 1FBVA 3FANA 2DSMA 2MT5A 3PLWA 2LN0A 2LV9A 5H9MA 3N9LA 2VNFA 4B86C 2QICA 1U6GB 4LLBA 2MNYA 2KREA 3VK6A 2M6MA 1WE9A 2KIZA 2G45A 4O64A 4XI1A 2OWAA 4YABA 2E6SA 3O47A 2RI7A 4F52B 4TKPB 1WFKA 1E4UA 4YBMA 2IDAA 2MNZA 2MUMA 1WEQA 4V3LC 3PHDA 1WEMA 3ZNIA 2L5UA 4R2YA 4Z0RA 4CA1A 1JM7B 4I7CA 3LRQA 5D1MB 4WZ0A 2ECVA 2RSDA 2Y1NA 3HCUA 2YU4A 2Y1MA 5KH9A 2ECWA 4R7EA 4FJCA 5TBNA 4I7DA 2CSVA 3O36A 4Q6FA 3O33A 4X3GA 4YBTA 1MM3A 2XOCA 1WEOA 2YUCA 4AP4A 3ASLA 5C13A 2KR4A 1HYJA 3O35A 2CSYA 2YSMA 2MA6A 2C2VS 4FO9A 3KV6A 2VJEB 2L80A 3N9MA 3FL2A 2QIZA 2EXUA 2YQMA 4WZ2A 3NG2A 3RPGC 2DJAA 3RTRB 2M3HA 5FEYA 2KU3A 4MVTA 5DINA 5B78A 2FFWA 3FM8C 4Z0OA 4GNGA 3U5PA 3U5NA 4H9DA 2YHOA 3LQIA 2RR4A 4L58A 3SOWA 3LJUX 2CRWA 2MKEA 5J3XA 2ECJA 5H1VA 2F6JA 2EA6A 2KKYA 5C11A 1WEPA 5D1KB 3O7AA 3MDBC 3GL6A 1X4JA 2LXPC 4A49A 3KV5A 2VJFA 4I7BA 2EODA 4S3OC 3IHPA 1XWHA 2H0DA 2K16A 2JMDA 5SVYA 4A4CA 4GNFA 4YC9A 3HCSA 3RPGB 2LRIC 3ZVYA 2VJEA 3L1ZB 5TABA 1F62A 3U5OA 5DKAA 4O62A 2YHNA 2KGIA 2K4DA 2K17A 4N3WA 4ZQLA 2VP7A 2LAUA 5LKTA 2KKXA 2AN6A 3MHHA 2MIQA 3LVRE 3L1XA 2PUYA 4LKAA 3EB6A 4AYCA 5H1TA 2I50A 3DPLR 4P5OB 4IC3A 2JM3A 3ZYQA 5FB1A 2M85A 4S3OB 3O34A 4A4BA 1X4UA 5H1UA 2HYED 5G05B 4QF3A 4LK9A 2XP0A 2MD7B 1FP0A 1G25A 2NAAA 2XB1A 3L11A 4GNDA 2QJ0A 2ECGA 4AUQB 3M7KA 2JMJA 3KQIA 1WEVA 5LKXA 1DCQA 2K1JA 4WZ3B 4L7XA 2VJFB 4LJNA 2YYRA 2CRRA 2LGLA 2H0DB 4GNEA 1Z6UA 2KWJA 2KWNA 2ECIA 4OGCA 4QQ4A 2LDRA 3PURA 2KWKA 4FIPA 2Y43A 2CSZA 4UP0A 2KYUA 2EGPA 3O37A 3LDYA 2D8UA 1N87A 3Q1DA 3HTKC 5D1LB 4GB0A 2YQLA 4A0CD 4NN2A 2B0OE 3KDEC 5B8DA 4BHWA 2DX8A 4IC2A 3DWDA 4PTBA 1VFYA 2MD8C 2LQ6A 1VD4A 3C5KA 4N4FA 1WEUA 4OGEA 4AYCB 3MHSA 1CHCA 1WEWA 5SVXA 4AVXA 2UZGA 3QZVA 5AITA 5TRBA 4WA6A 4MSXA 5B76A 2KWOA 2VPDA 1WIMA 2VPGA 2YVRA 1WENA 2G6QA 1RMDA 2KFTA 5TDRA 2L0BA 1T1HA 4ZUXU 3ZTGA 1HYIA 2JMIA 5FERA 3N9NA 4PPEA 2YT5A 3EB5A 2PNXA 1WILA 2F42A 2VPBA 3FEHA 1WGMA 2E61A 1WEEA 4F1PA 3V43A 5G04B 3ZPVE 2P57A 1LDJB 4UP5A 3T9KA 3SUBA 2FD4A 1LDKC 2L75A 1ZBDB 3M63A 3SOXA 3T7LA 2ECNA 4FK5A 1IYMA 4YBSA 3ZPV1 1MBMA 2FUIA 2YURA 3SOUA 2F6NA 2ECTA 3N9PA 2D8SA 3E2DA 2JUNA 2YSJA 2FSAA 5LKUA 3SHBA 2VPEA 1VYXA 5EYAF 1WESA 2KGGA 2LGKA 2CKLA 1K2FA 2FUUA 2XOYA 1BORA 2G43A 3LVQE 2IQJA 3JUEA 3ZVZB 2LXHC 2XEUA 2XOZA 3FAOA 2EGMA 2M1RA 5G0FA 5SVIB 5JG6A 4ZDTA 3H7HA 2JRJA 1Z2QA 4B7YC 2LGVA 3LQJA 3FJUB 3M62A 3HCTA 3LQHA 4C9ZA 2E6RA 3T6RA 4QF2A 2YREA 5TDWA 1MM2A 1V87A 3GV4A 5KH3A 1Z60A 3M99A 1DVPA 5LCWB 4BBQA 2YW8A 2HDPA 2MA5A 4R8PK 3DQVR 2BAYA 3N9QA 3C6WA 1JM7A 3I2DA 3KNVA 2L43A 4YAXA 4W4UA 2L7PA 5K3QA 4YADA 5LKZA 2KE1A 5SVIA 2CT2A 5B75A 2ZETC 5AIUA 3U5MA 4V3KC 2M13A 3N9OA 4LADB 2C2LA 4YATA 1X4IA 3PUQA 2OXQC
chains in the Genus database with same CATH topology
5KH7A 5FB0A 5B77A 4UI9B 2CKLB 4CCGX 2LGGA 3O70A 5I3LA 5B79A 1JOCA 1FBVA 2MT5A 2LN0A 2LV9A 5H9MA 3N9LA 2VNFA 4B86C 2QICA 1U6GB 4LLBA 2MNYA 2KREA 3VK6A 2M6MA 1WE9A 2KIZA 2G45A 4O64A 4XI1A 4YABA 2E6SA 2RI7A 4F52B 4TKPB 1WFKA 1E4UA 4YBMA 2IDAA 2MNZA 2MUMA 1WEQA 4V3LC 3PHDA 1WEMA 3ZNIA 2L5UA 4R2YA 4CA1A 1JM7B 4I7CA 3LRQA 5D1MB 4WZ0A 2ECVA 2RSDA 2Y1NA 3HCUA 2YU4A 2Y1MA 5KH9A 2ECWA 4R7EA 4FJCA 5TBNA 4I7DA 3O36A 4Q6FA 3O33A 4X3GA 4YBTA 1MM3A 1WEOA 2YUCA 4AP4A 3ASLA 5C13A 2KR4A 1HYJA 3O35A 2CSYA 2YSMA 2MA6A 2C2VS 4FO9A 3KV6A 2VJEB 2L80A 3N9MA 3FL2A 2QIZA 3RPGC 2YQMA 4WZ2A 3NG2A 3RTRB 2M3HA 5FEYA 2KU3A 4MVTA 5DINA 5B78A 4GNGA 3U5PA 3U5NA 2YHOA 3LQIA 4L58A 3SOWA 5J3XA 2ECJA 5H1VA 2F6JA 2EA6A 5C11A 1WEPA 5D1KB 3O7AA 3GL6A 1X4JA 2LXPC 4A49A 3KV5A 2VJFA 4I7BA 2EODA 4S3OC 3IHPA 1XWHA 2H0DA 2K16A 2JMDA 4A4CA 4GNFA 4YC9A 3HCSA 3RPGB 2LRIC 3ZVYA 2VJEA 3L1ZB 5TABA 1F62A 3U5OA 5DKAA 2YHNA 2KGIA 2K4DA 2K17A 4N3WA 4ZQLA 2VP7A 5LKTA 2AN6A 3MHHA 2MIQA 3L1XA 2PUYA 4LKAA 3EB6A 4AYCA 5H1TA 2I50A 3DPLR 4P5OB 4IC3A 3ZYQA 5FB1A 2M85A 4S3OB 3O34A 4A4BA 1X4UA 5H1UA 2HYED 5G05B 4QF3A 4LK9A 2MD7B 1FP0A 1G25A 2NAAA 2XB1A 3L11A 4GNDA 2QJ0A 2ECGA 4AUQB 2JMJA 3KQIA 1WEVA 5LKXA 2K1JA 4WZ3B 4L7XA 2VJFB 4LJNA 2YYRA 2LGLA 2H0DB 4GNEA 1Z6UA 2KWJA 2KWNA 2ECIA 2LDRA 3PURA 2KWKA 4FIPA 2Y43A 2CSZA 4UP0A 2KYUA 2EGPA 3O37A 1N87A 3HTKC 5D1LB 4GB0A 2YQLA 4A0CD 4NN2A 5B8DA 4BHWA 2DX8A 4IC2A 4PTBA 2MD8C 1VFYA 2LQ6A 1VD4A 3C5KA 4N4FA 1WEUA 4AYCB 3MHSA 1CHCA 1WEWA 4AVXA 2UZGA 3QZVA 5AITA 5TRBA 4WA6A 4MSXA 5B76A 2KWOA 2VPDA 1WIMA 2VPGA 1WENA 2G6QA 1RMDA 2KFTA 5TDRA 2L0BA 1T1HA 4ZUXU 3ZTGA 1HYIA 2JMIA 5FERA 3N9NA 4PPEA 2YT5A 3EB5A 2PNXA 1WILA 2F42A 2VPBA 1WGMA 1WEEA 3V43A 5G04B 3ZPVE 1LDJB 4UP5A 1LDKC 2L75A 1ZBDB 3M63A 3SOXA 3T7LA 2ECNA 4FK5A 1IYMA 4YBSA 3ZPV1 2FUIA 2YURA 3SOUA 2F6NA 2ECTA 3N9PA 2D8SA 2YSJA 2FSAA 5LKUA 3SHBA 2VPEA 1VYXA 5EYAF 1WESA 2KGGA 2LGKA 2CKLA 2FUUA 1K2FA 1BORA 2G43A 3ZVZB 2LXHC 2XEUA 2M1RA 5G0FA 5JG6A 4ZDTA 2JRJA 1Z2QA 4B7YC 2LGVA 3LQJA 3M62A 3HCTA 3LQHA 4C9ZA 2E6RA 3T6RA 4QF2A 2YREA 5TDWA 1MM2A 1V87A 3GV4A 5KH3A 1Z60A 3M99A 1DVPA 5LCWB 4BBQA 2YW8A 2HDPA 2MA5A 4R8PK 3DQVR 2BAYA 3N9QA 3C6WA 1JM7A 3I2DA 3KNVA 2L43A 4YAXA 4W4UA 4YADA 5LKZA 2KE1A 2CT2A 5B75A 2ZETC 5AIUA 3U5MA 4V3KC 3N9OA 4LADB 2C2LA 4YATA 1X4IA 3PUQA 2OXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH7 A;  5FB0 A;  5B77 A;  4UI9 B;  2CKL B;  4CCG X;  2LGG A;  3O70 A;  5I3L A;  5B79 A;  1JOC A;  1FBV A;  2MT5 A;  2LN0 A;  2LV9 A;  5H9M A;  3N9L A;  2VNF A;  4B86 C;  2QIC A;  1U6G B;  4LLB A;  2MNY A;  2KRE A;  3VK6 A;  2M6M A;  1WE9 A;  2KIZ A;  2G45 A;  4O64 A;  4XI1 A;  4YAB A;  2E6S A;  2RI7 A;  4F52 B;  4TKP B;  1WFK A;  1E4U A;  4YBM A;  2IDA A;  2MNZ A;  2MUM A;  1WEQ A;  4V3L C;  3PHD A;  1WEM A;  3ZNI A;  2L5U A;  4R2Y A;  4CA1 A;  1JM7 B;  4I7C A;  3LRQ A;  5D1M B;  4WZ0 A;  2ECV A;  2RSD A;  2Y1N A;  3HCU A;  2YU4 A;  2Y1M A;  5KH9 A;  2ECW A;  4R7E A;  4FJC A;  5TBN A;  4I7D A;  3O36 A;  4Q6F A;  3O33 A;  4X3G A;  4YBT A;  1MM3 A;  1WEO A;  2YUC A;  4AP4 A;  3ASL A;  5C13 A;  2KR4 A;  1HYJ A;  3O35 A;  2CSY A;  2YSM A;  2MA6 A;  2C2V S;  4FO9 A;  3KV6 A;  2VJE B;  2L80 A;  3N9M A;  3FL2 A;  2QIZ A;  3RPG C;  2YQM A;  4WZ2 A;  3NG2 A;  3RTR B;  2M3H A;  5FEY A;  2KU3 A;  4MVT A;  5DIN A;  5B78 A;  4GNG A;  3U5P A;  3U5N A;  2YHO A;  3LQI A;  4L58 A;  3SOW A;  5J3X A;  2ECJ A;  5H1V A;  2F6J A;  2EA6 A;  5C11 A;  1WEP A;  5D1K B;  3O7A A;  3GL6 A;  1X4J A;  2LXP C;  4A49 A;  3KV5 A;  2VJF A;  4I7B A;  2EOD A;  4S3O C;  3IHP A;  1XWH A;  2H0D A;  2K16 A;  2JMD A;  4A4C A;  4GNF A;  4YC9 A;  3HCS A;  3RPG B;  2LRI C;  3ZVY A;  2VJE A;  3L1Z B;  5TAB A;  1F62 A;  3U5O A;  5DKA A;  2YHN A;  2KGI A;  2K4D A;  2K17 A;  4N3W A;  4ZQL A;  2VP7 A;  5LKT A;  2AN6 A;  3MHH A;  2MIQ A;  3L1X A;  2PUY A;  4LKA A;  3EB6 A;  4AYC A;  5H1T A;  2I50 A;  3DPL R;  4P5O B;  4IC3 A;  3ZYQ A;  5FB1 A;  2M85 A;  4S3O B;  3O34 A;  4A4B A;  1X4U A;  5H1U A;  2HYE D;  5G05 B;  4QF3 A;  4LK9 A;  2MD7 B;  1FP0 A;  1G25 A;  2NAA A;  2XB1 A;  3L11 A;  4GND A;  2QJ0 A;  2ECG A;  4AUQ B;  2JMJ A;  3KQI A;  1WEV A;  5LKX A;  2K1J A;  4WZ3 B;  4L7X A;  2VJF B;  4LJN A;  2YYR A;  2LGL A;  2H0D B;  4GNE A;  1Z6U A;  2KWJ A;  2KWN A;  2ECI A;  2LDR A;  3PUR A;  2KWK A;  4FIP A;  2Y43 A;  2CSZ A;  4UP0 A;  2KYU A;  2EGP A;  3O37 A;  1N87 A;  3HTK C;  5D1L B;  4GB0 A;  2YQL A;  4A0C D;  4NN2 A;  5B8D A;  4BHW A;  2DX8 A;  4IC2 A;  4PTB A;  2MD8 C;  1VFY A;  2LQ6 A;  1VD4 A;  3C5K A;  4N4F A;  1WEU A;  4AYC B;  3MHS A;  1CHC A;  1WEW A;  4AVX A;  2UZG A;  3QZV A;  5AIT A;  5TRB A;  4WA6 A;  4MSX A;  5B76 A;  2KWO A;  2VPD A;  1WIM A;  2VPG A;  1WEN A;  2G6Q A;  1RMD A;  2KFT A;  5TDR A;  2L0B A;  1T1H A;  4ZUX U;  3ZTG A;  1HYI A;  2JMI A;  5FER A;  3N9N A;  4PPE A;  2YT5 A;  3EB5 A;  2PNX A;  1WIL A;  2F42 A;  2VPB A;  1WGM A;  1WEE A;  3V43 A;  5G04 B;  3ZPV E;  1LDJ B;  4UP5 A;  1LDK C;  2L75 A;  1ZBD B;  3M63 A;  3SOX A;  3T7L A;  2ECN A;  4FK5 A;  1IYM A;  4YBS A;  3ZPV 1;  2FUI A;  2YUR A;  3SOU A;  2F6N A;  2ECT A;  3N9P A;  2D8S A;  2YSJ A;  2FSA A;  5LKU A;  3SHB A;  2VPE A;  1VYX A;  5EYA F;  1WES A;  2KGG A;  2LGK A;  2CKL A;  2FUU A;  1K2F A;  1BOR A;  2G43 A;  3ZVZ B;  2LXH C;  2XEU A;  2M1R A;  5G0F A;  5JG6 A;  4ZDT A;  2JRJ A;  1Z2Q A;  4B7Y C;  2LGV A;  3LQJ A;  3M62 A;  3HCT A;  3LQH A;  4C9Z A;  2E6R A;  3T6R A;  4QF2 A;  2YRE A;  5TDW A;  1MM2 A;  1V87 A;  3GV4 A;  5KH3 A;  1Z60 A;  3M99 A;  1DVP A;  5LCW B;  4BBQ A;  2YW8 A;  2HDP A;  2MA5 A;  4R8P K;  3DQV R;  2BAY A;  3N9Q A;  3C6W A;  1JM7 A;  3I2D A;  3KNV A;  2L43 A;  4YAX A;  4W4U A;  4YAD A;  5LKZ A;  2KE1 A;  2CT2 A;  5B75 A;  2ZET C;  5AIU A;  3U5M A;  4V3K C;  3N9O A;  4LAD B;  2C2L A;  4YAT A;  1X4I A;  3PUQ A;  2OXQ C; 
#chains in the Genus database with same CATH topology
 5KH7 A;  5FB0 A;  2CON A;  5B77 A;  4UI9 B;  2CKL B;  4CCG X;  2LGG A;  3O70 A;  3DDT A;  5I3L A;  5B79 A;  1JOC A;  1FBV A;  3FAN A;  2DSM A;  2MT5 A;  3PLW A;  2LN0 A;  2LV9 A;  5H9M A;  3N9L A;  2VNF A;  4B86 C;  2QIC A;  1U6G B;  4LLB A;  2MNY A;  2KRE A;  3VK6 A;  2M6M A;  1WE9 A;  2KIZ A;  2G45 A;  4O64 A;  4XI1 A;  2OWA A;  4YAB A;  2E6S A;  3O47 A;  2RI7 A;  4F52 B;  4TKP B;  1WFK A;  1E4U A;  4YBM A;  2IDA A;  2MNZ A;  2MUM A;  1WEQ A;  4V3L C;  3PHD A;  1WEM A;  3ZNI A;  2L5U A;  4R2Y A;  4Z0R A;  4CA1 A;  1JM7 B;  4I7C A;  3LRQ A;  5D1M B;  4WZ0 A;  2ECV A;  2RSD A;  2Y1N A;  3HCU A;  2YU4 A;  2Y1M A;  5KH9 A;  2ECW A;  4R7E A;  4FJC A;  5TBN A;  4I7D A;  2CSV A;  3O36 A;  4Q6F A;  3O33 A;  4X3G A;  4YBT A;  1MM3 A;  2XOC A;  1WEO A;  2YUC A;  4AP4 A;  3ASL A;  5C13 A;  2KR4 A;  1HYJ A;  3O35 A;  2CSY A;  2YSM A;  2MA6 A;  2C2V S;  4FO9 A;  3KV6 A;  2VJE B;  2L80 A;  3N9M A;  3FL2 A;  2QIZ A;  2EXU A;  2YQM A;  4WZ2 A;  3NG2 A;  3RPG C;  2DJA A;  3RTR B;  2M3H A;  5FEY A;  2KU3 A;  4MVT A;  5DIN A;  5B78 A;  2FFW A;  3FM8 C;  4Z0O A;  4GNG A;  3U5P A;  3U5N A;  4H9D A;  2YHO A;  3LQI A;  2RR4 A;  4L58 A;  3SOW A;  3LJU X;  2CRW A;  2MKE A;  5J3X A;  2ECJ A;  5H1V A;  2F6J A;  2EA6 A;  2KKY A;  5C11 A;  1WEP A;  5D1K B;  3O7A A;  3MDB C;  3GL6 A;  1X4J A;  2LXP C;  4A49 A;  3KV5 A;  2VJF A;  4I7B A;  2EOD A;  4S3O C;  3IHP A;  1XWH A;  2H0D A;  2K16 A;  2JMD A;  5SVY A;  4A4C A;  4GNF A;  4YC9 A;  3HCS A;  3RPG B;  2LRI C;  3ZVY A;  2VJE A;  3L1Z B;  5TAB A;  1F62 A;  3U5O A;  5DKA A;  4O62 A;  2YHN A;  2KGI A;  2K4D A;  2K17 A;  4N3W A;  4ZQL A;  2VP7 A;  2LAU A;  5LKT A;  2KKX A;  2AN6 A;  3MHH A;  2MIQ A;  3LVR E;  3L1X A;  2PUY A;  4LKA A;  3EB6 A;  4AYC A;  5H1T A;  2I50 A;  3DPL R;  4P5O B;  4IC3 A;  2JM3 A;  3ZYQ A;  5FB1 A;  2M85 A;  4S3O B;  3O34 A;  4A4B A;  1X4U A;  5H1U A;  2HYE D;  5G05 B;  4QF3 A;  4LK9 A;  2XP0 A;  2MD7 B;  1FP0 A;  1G25 A;  2NAA A;  2XB1 A;  3L11 A;  4GND A;  2QJ0 A;  2ECG A;  4AUQ B;  3M7K A;  2JMJ A;  3KQI A;  1WEV A;  5LKX A;  1DCQ A;  2K1J A;  4WZ3 B;  4L7X A;  2VJF B;  4LJN A;  2YYR A;  2CRR A;  2LGL A;  2H0D B;  4GNE A;  1Z6U A;  2KWJ A;  2KWN A;  2ECI A;  4OGC A;  4QQ4 A;  2LDR A;  3PUR A;  2KWK A;  4FIP A;  2Y43 A;  2CSZ A;  4UP0 A;  2KYU A;  2EGP A;  3O37 A;  3LDY A;  2D8U A;  1N87 A;  3Q1D A;  3HTK C;  5D1L B;  4GB0 A;  2YQL A;  4A0C D;  4NN2 A;  2B0O E;  3KDE C;  5B8D A;  4BHW A;  2DX8 A;  4IC2 A;  3DWD A;  4PTB A;  1VFY A;  2MD8 C;  2LQ6 A;  1VD4 A;  3C5K A;  4N4F A;  1WEU A;  4OGE A;  4AYC B;  3MHS A;  1CHC A;  1WEW A;  5SVX A;  4AVX A;  2UZG A;  3QZV A;  5AIT A;  5TRB A;  4WA6 A;  4MSX A;  5B76 A;  2KWO A;  2VPD A;  1WIM A;  2VPG A;  2YVR A;  1WEN A;  2G6Q A;  1RMD A;  2KFT A;  5TDR A;  2L0B A;  1T1H A;  4ZUX U;  3ZTG A;  1HYI A;  2JMI A;  5FER A;  3N9N A;  4PPE A;  2YT5 A;  3EB5 A;  2PNX A;  1WIL A;  2F42 A;  2VPB A;  3FEH A;  1WGM A;  2E61 A;  1WEE A;  4F1P A;  3V43 A;  5G04 B;  3ZPV E;  2P57 A;  1LDJ B;  4UP5 A;  3T9K A;  3SUB A;  2FD4 A;  1LDK C;  2L75 A;  1ZBD B;  3M63 A;  3SOX A;  3T7L A;  2ECN A;  4FK5 A;  1IYM A;  4YBS A;  3ZPV 1;  1MBM A;  2FUI A;  2YUR A;  3SOU A;  2F6N A;  2ECT A;  3N9P A;  2D8S A;  3E2D A;  2JUN A;  2YSJ A;  2FSA A;  5LKU A;  3SHB A;  2VPE A;  1VYX A;  5EYA F;  1WES A;  2KGG A;  2LGK A;  2CKL A;  1K2F A;  2FUU A;  2XOY A;  1BOR A;  2G43 A;  3LVQ E;  2IQJ A;  3JUE A;  3ZVZ B;  2LXH C;  2XEU A;  2XOZ A;  3FAO A;  2EGM A;  2M1R A;  5G0F A;  5SVI B;  5JG6 A;  4ZDT A;  3H7H A;  2JRJ A;  1Z2Q A;  4B7Y C;  2LGV A;  3LQJ A;  3FJU B;  3M62 A;  3HCT A;  3LQH A;  4C9Z A;  2E6R A;  3T6R A;  4QF2 A;  2YRE A;  5TDW A;  1MM2 A;  1V87 A;  3GV4 A;  5KH3 A;  1Z60 A;  3M99 A;  1DVP A;  5LCW B;  4BBQ A;  2YW8 A;  2HDP A;  2MA5 A;  4R8P K;  3DQV R;  2BAY A;  3N9Q A;  3C6W A;  1JM7 A;  3I2D A;  3KNV A;  2L43 A;  4YAX A;  4W4U A;  2L7P A;  5K3Q A;  4YAD A;  5LKZ A;  2KE1 A;  5SVI A;  2CT2 A;  5B75 A;  2ZET C;  5AIU A;  3U5M A;  4V3K C;  2M13 A;  3N9O A;  4LAD B;  2C2L A;  4YAT A;  1X4I A;  3PUQ A;  2OXQ C; 
#chains in the Genus database with same CATH homology
 5KH7 A;  5FB0 A;  5B77 A;  4UI9 B;  2CKL B;  4CCG X;  2LGG A;  3O70 A;  5I3L A;  5B79 A;  1JOC A;  1FBV A;  2MT5 A;  2LN0 A;  2LV9 A;  5H9M A;  3N9L A;  2VNF A;  4B86 C;  2QIC A;  1U6G B;  4LLB A;  2MNY A;  2KRE A;  3VK6 A;  2M6M A;  1WE9 A;  2KIZ A;  2G45 A;  4O64 A;  4XI1 A;  4YAB A;  2E6S A;  2RI7 A;  4F52 B;  4TKP B;  1WFK A;  1E4U A;  4YBM A;  2IDA A;  2MNZ A;  2MUM A;  1WEQ A;  4V3L C;  3PHD A;  1WEM A;  3ZNI A;  2L5U A;  4R2Y A;  4CA1 A;  1JM7 B;  4I7C A;  3LRQ A;  5D1M B;  4WZ0 A;  2ECV A;  2RSD A;  2Y1N A;  3HCU A;  2YU4 A;  2Y1M A;  5KH9 A;  2ECW A;  4R7E A;  4FJC A;  5TBN A;  4I7D A;  3O36 A;  4Q6F A;  3O33 A;  4X3G A;  4YBT A;  1MM3 A;  1WEO A;  2YUC A;  4AP4 A;  3ASL A;  5C13 A;  2KR4 A;  1HYJ A;  3O35 A;  2CSY A;  2YSM A;  2MA6 A;  2C2V S;  4FO9 A;  3KV6 A;  2VJE B;  2L80 A;  3N9M A;  3FL2 A;  2QIZ A;  3RPG C;  2YQM A;  4WZ2 A;  3NG2 A;  3RTR B;  2M3H A;  5FEY A;  2KU3 A;  4MVT A;  5DIN A;  5B78 A;  4GNG A;  3U5P A;  3U5N A;  2YHO A;  3LQI A;  4L58 A;  3SOW A;  5J3X A;  2ECJ A;  5H1V A;  2F6J A;  2EA6 A;  5C11 A;  1WEP A;  5D1K B;  3O7A A;  3GL6 A;  1X4J A;  2LXP C;  4A49 A;  3KV5 A;  2VJF A;  4I7B A;  2EOD A;  4S3O C;  3IHP A;  1XWH A;  2H0D A;  2K16 A;  2JMD A;  4A4C A;  4GNF A;  4YC9 A;  3HCS A;  3RPG B;  2LRI C;  3ZVY A;  2VJE A;  3L1Z B;  5TAB A;  1F62 A;  3U5O A;  5DKA A;  2YHN A;  2KGI A;  2K4D A;  2K17 A;  4N3W A;  4ZQL A;  2VP7 A;  5LKT A;  2AN6 A;  3MHH A;  2MIQ A;  3L1X A;  2PUY A;  4LKA A;  3EB6 A;  4AYC A;  5H1T A;  2I50 A;  3DPL R;  4P5O B;  4IC3 A;  3ZYQ A;  5FB1 A;  2M85 A;  4S3O B;  3O34 A;  4A4B A;  1X4U A;  5H1U A;  2HYE D;  5G05 B;  4QF3 A;  4LK9 A;  2MD7 B;  1FP0 A;  1G25 A;  2NAA A;  2XB1 A;  3L11 A;  4GND A;  2QJ0 A;  2ECG A;  4AUQ B;  2JMJ A;  3KQI A;  1WEV A;  5LKX A;  2K1J A;  4WZ3 B;  4L7X A;  2VJF B;  4LJN A;  2YYR A;  2LGL A;  2H0D B;  4GNE A;  1Z6U A;  2KWJ A;  2KWN A;  2ECI A;  2LDR A;  3PUR A;  2KWK A;  4FIP A;  2Y43 A;  2CSZ A;  4UP0 A;  2KYU A;  2EGP A;  3O37 A;  1N87 A;  3HTK C;  5D1L B;  4GB0 A;  2YQL A;  4A0C D;  4NN2 A;  5B8D A;  4BHW A;  2DX8 A;  4IC2 A;  4PTB A;  2MD8 C;  1VFY A;  2LQ6 A;  1VD4 A;  3C5K A;  4N4F A;  1WEU A;  4AYC B;  3MHS A;  1CHC A;  1WEW A;  4AVX A;  2UZG A;  3QZV A;  5AIT A;  5TRB A;  4WA6 A;  4MSX A;  5B76 A;  2KWO A;  2VPD A;  1WIM A;  2VPG A;  1WEN A;  2G6Q A;  1RMD A;  2KFT A;  5TDR A;  2L0B A;  1T1H A;  4ZUX U;  3ZTG A;  1HYI A;  2JMI A;  5FER A;  3N9N A;  4PPE A;  2YT5 A;  3EB5 A;  2PNX A;  1WIL A;  2F42 A;  2VPB A;  1WGM A;  1WEE A;  3V43 A;  5G04 B;  3ZPV E;  1LDJ B;  4UP5 A;  1LDK C;  2L75 A;  1ZBD B;  3M63 A;  3SOX A;  3T7L A;  2ECN A;  4FK5 A;  1IYM A;  4YBS A;  3ZPV 1;  2FUI A;  2YUR A;  3SOU A;  2F6N A;  2ECT A;  3N9P A;  2D8S A;  2YSJ A;  2FSA A;  5LKU A;  3SHB A;  2VPE A;  1VYX A;  5EYA F;  1WES A;  2KGG A;  2LGK A;  2CKL A;  2FUU A;  1K2F A;  1BOR A;  2G43 A;  3ZVZ B;  2LXH C;  2XEU A;  2M1R A;  5G0F A;  5JG6 A;  4ZDT A;  2JRJ A;  1Z2Q A;  4B7Y C;  2LGV A;  3LQJ A;  3M62 A;  3HCT A;  3LQH A;  4C9Z A;  2E6R A;  3T6R A;  4QF2 A;  2YRE A;  5TDW A;  1MM2 A;  1V87 A;  3GV4 A;  5KH3 A;  1Z60 A;  3M99 A;  1DVP A;  5LCW B;  4BBQ A;  2YW8 A;  2HDP A;  2MA5 A;  4R8P K;  3DQV R;  2BAY A;  3N9Q A;  3C6W A;  1JM7 A;  3I2D A;  3KNV A;  2L43 A;  4YAX A;  4W4U A;  4YAD A;  5LKZ A;  2KE1 A;  2CT2 A;  5B75 A;  2ZET C;  5AIU A;  3U5M A;  4V3K C;  3N9O A;  4LAD B;  2C2L A;  4YAT A;  1X4I A;  3PUQ A;  2OXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...