2ECTA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of ring finger protein 126
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
GSSGSSGTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of RING finger protein 126
rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords RING finger protein 126
total genus 5
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ectA00
2QICA 1FP0A 3NG2A 1U6GB 4QF2A 4YAXA 1V87A 1WFKA 2ECIA 2YREA 2VNFA 3RPGB 5H1UA 1WEPA 1WEEA 4GB0A 1JM7B 2LGKA 2KE1A 2VJEA 3ASLA 2VP7A 3N9QA 3RPGC 2LGVA 2MA5A 2D8SA 3M63A 1WEWA 1XWHA 3N9OA 4GNDA 2OXQC 4I7BA 4AP4A 3L1XA 3ZNIA 2FSAA 2K4DA 4PTBA 1ZBDB 3SOWA 4L58A 4C9ZA 4YC9A 1F62A 1WEMA 2HDPA 3U5MA 5H1TA 4A49A 2LXHC 2KFTA 3N9PA 2LN0A 3LQHA 2BAYA 4MVTA 1E4UA 2L43A 5AIUA 4CCGX 2RI7A 4R2YA 3HCSA 4N3WA 5B78A 4UP5A 5TBNA 5KH7A 5J3XA 2C2LA 2YT5A 3SHBA 2LGGA 5C11A 2YSMA 3DQVR 3KQIA 4FJCA 2QJ0A 2MT5A 2K17A 2KU3A 4O64A 4FK5A 2JMJA 2LV9A 2LXPC 2LRIC 2K16A 3L11A 2ECTA 2MD8C 2C2VS 3O33A 5TABA 2M1RA 5KH3A 4BHWA 2VPDA 5H9MA 2Y43A 4ZDTA 2KWOA 2G43A 1N87A 2YYRA 5D1MB 2YHNA 3O37A 2VJEB 2E6SA 3O35A 1K2FA 4WA6A 2MUMA 2VJFB 4MSXA 1WENA 2L0BA 1Z60A 1WEVA 3O34A 5D1LB 3LQIA 2MIQA 2M6MA 2LGLA 2JMDA 3KV6A 5B77A 4YATA 2JRJA 1WE9A 4B7YC 2LDRA 5AITA 2KGGA 1MM2A 3ZPV1 5LKZA 5TDRA 2K1JA 3MHSA 5TRBA 2MNZA 3HCTA 1DVPA 4N4FA 5LKTA 5FEYA 2ZETC 4TKPB 2L80A 2KIZA 4AVXA 4V3LC 3ZPVE 4IC3A 4LJNA 2KWKA 3PUQA 2VJFA 3FL2A 1Z2QA 5EYAF 4A4CA 5G0FA 3KV5A 2KR4A 4GNFA 2CT2A 4IC2A 4P5OB 1JOCA 3L1ZB 4S3OC 2XB1A 3KNVA 4V3KC 3ZYQA 2JMIA 2NAAA 3GV4A 2KWJA 3SOXA 4ZUXU 2RSDA 1WILA 3M62A 4ZQLA 4F52B 4NN2A 2LQ6A 3C5KA 2FUUA 5KH9A 3QZVA 2YUCA 3O70A 2F6NA 2Y1MA 4YBTA 3N9MA 3M99A 4AYCA 1WEUA 2G6QA 2HYED 1JM7A 3T6RA 2VPBA 1LDJB 3LQJA 3N9LA 5LKXA 5C13A 2ECNA 1X4IA 2KGIA 2Y1NA 2L75A 3PURA 1Z6UA 4FIPA 1BORA 2F42A 1WEOA 4FO9A 4WZ0A 1MM3A 2ECJA 2PNXA 2E6RA 3SOUA 4LK9A 5FB1A 2YQMA 1WIMA 4X3GA 1VYXA 2CSYA 3U5PA 1WESA 4PPEA 5B8DA 5LKUA 1G25A 4YADA 3V43A 4LADB 3U5NA 2F6JA 2L5UA 5B79A 3U5OA 4AUQB 4YBSA 5DINA 1X4UA 3O7AA 4R8PK 3C6WA 4A0CD 4WZ3B 2YURA 4R7EA 3ZTGA 1RMDA 2FUIA 2MA6A 5TDWA 2KWNA 5JG6A 4BBQA 3DPLR 2UZGA 2VPGA 4LKAA 3N9NA 1WGMA 3IHPA 2YU4A 3I2DA 1X4JA 3PHDA 2EGPA 2MNYA 5H1VA 4AYCB 2XEUA 4W4UA 4Q6FA 2MD7B 4I7CA 4UP0A 2DX8A 5G05B 3HTKC 4LLBA 5FERA 2VPEA 5LCWB 5B75A 3EB5A 3T7LA 3LRQA 2M3HA 1LDKC 3HCUA 4B86C 1VD4A 2CKLA 1HYIA 2I50A 2CSZA 4S3OB 4WZ2A 2CKLB 3EB6A 4L7XA 2M85A 2YHOA 5DKAA 2KREA 1HYJA 1FBVA 2EODA 2QIZA 4QF3A 4YBMA 3MHHA 5I3LA 4I7DA 3RTRB 4YABA 5D1KB 1T1HA 2PUYA 2H0DB 5FB0A 5G04B 1IYMA 3GL6A 2H0DA 2G45A 4XI1A 2ECWA 1WEQA 5B76A 4A4BA 2EA6A 3O36A 2ECVA 3ZVZB 2KYUA 2YW8A 2AN6A 3ZVYA 4GNGA 2ECGA 4UI9B 3VK6A 1VFYA 2YSJA 4CA1A 1CHCA 2IDAA 4GNEA 2YQLA
chains in the Genus database with same CATH superfamily
2QICA 1FP0A 3NG2A 1U6GB 4QF2A 2EXUA 5SVIB 4YAXA 1V87A 1WFKA 2ECIA 2YREA 2VNFA 3RPGB 5H1UA 1WEPA 1WEEA 4GB0A 1JM7B 2LGKA 2KE1A 2VJEA 3ASLA 2VP7A 3N9QA 3RPGC 2XOCA 2LGVA 2MA5A 2D8SA 3M63A 1WEWA 1XWHA 3N9OA 4H9DA 4GNDA 2OXQC 4I7BA 4AP4A 3H7HA 3L1XA 3FANA 3ZNIA 2FSAA 2K4DA 4PTBA 5SVXA 4F1PA 1ZBDB 3SOWA 2DSMA 4L58A 4C9ZA 4YC9A 1F62A 1WEMA 2HDPA 3U5MA 5H1TA 4A49A 2LXHC 2KFTA 3N9PA 2YVRA 2LN0A 3LQHA 2BAYA 2LAUA 4MVTA 1E4UA 2L43A 2P57A 5AIUA 4CCGX 2RI7A 4R2YA 3HCSA 4N3WA 5B78A 2CRRA 2B0OE 4UP5A 5TBNA 5KH7A 5J3XA 2MKEA 2C2LA 2YT5A 3SHBA 2LGGA 5C11A 2YSMA 3DQVR 3KQIA 4FJCA 2QJ0A 2MT5A 2K17A 2KU3A 4O64A 4FK5A 2JMJA 2LV9A 2LXPC 2LRIC 2K16A 3L11A 1DCQA 2ECTA 4QQ4A 2MD8C 3LVQE 2C2VS 3Q1DA 3O33A 5TABA 2M1RA 5KH3A 4Z0RA 4BHWA 2VPDA 5H9MA 2Y43A 4ZDTA 2KWOA 2G43A 1N87A 2YYRA 5D1MB 2YHNA 3O37A 2VJEB 2KKXA 2E6SA 2KKYA 3O35A 1K2FA 4WA6A 2MUMA 2VJFB 4MSXA 2CONA 1WENA 2L0BA 1Z60A 1WEVA 3O34A 5D1LB 3LQIA 2MIQA 2M6MA 2LGLA 2JMDA 3KV6A 3T9KA 5B77A 4YATA 2JRJA 1WE9A 3JUEA 4B7YC 2LDRA 5AITA 2KGGA 1MM2A 5SVYA 3ZPV1 5LKZA 4Z0OA 5TDRA 2K1JA 3MHSA 5TRBA 2MNZA 3HCTA 1DVPA 4N4FA 5LKTA 5FEYA 3FEHA 2ZETC 2CSVA 4OGEA 4TKPB 2L80A 2KIZA 4AVXA 4V3LC 3ZPVE 3DDTA 4IC3A 4LJNA 2KWKA 3PUQA 2VJFA 3FL2A 1Z2QA 5EYAF 4A4CA 5G0FA 3KV5A 3FM8C 2KR4A 4GNFA 2CT2A 4IC2A 4P5OB 1MBMA 1JOCA 3L1ZB 4S3OC 2M13A 3FJUB 2XB1A 3KNVA 4V3KC 3ZYQA 2JMIA 5K3QA 2NAAA 3GV4A 2KWJA 3SOXA 4ZUXU 2RSDA 1WILA 3SUBA 3M62A 4ZQLA 4F52B 4NN2A 2E61A 2LQ6A 3C5KA 2FUUA 2EGMA 5KH9A 3QZVA 2YUCA 3O70A 2F6NA 2Y1MA 3LJUX 4YBTA 3N9MA 2JM3A 3M99A 4AYCA 3DWDA 1WEUA 2G6QA 2HYED 2OWAA 1JM7A 3T6RA 2VPBA 1LDJB 3E2DA 3LQJA 3N9LA 5LKXA 5C13A 2ECNA 1X4IA 2KGIA 2Y1NA 3KDEC 2CRWA 2L75A 3PURA 2FD4A 1Z6UA 4FIPA 1BORA 2F42A 1WEOA 4FO9A 2RR4A 4WZ0A 1MM3A 2ECJA 3PLWA 2PNXA 2E6RA 3SOUA 4LK9A 2D8UA 5FB1A 2YQMA 1WIMA 4X3GA 2FFWA 1VYXA 2CSYA 3U5PA 3MDBC 1WESA 4PPEA 5B8DA 2XOZA 5LKUA 1G25A 4YADA 3V43A 4LADB 3U5NA 2F6JA 2L5UA 5B79A 3U5OA 4AUQB 4YBSA 5SVIA 5DINA 1X4UA 3O7AA 4R8PK 3O47A 3C6WA 4WZ3B 2YURA 2JUNA 4R7EA 4A0CD 3ZTGA 1RMDA 2FUIA 2MA6A 5TDWA 2KWNA 5JG6A 2XOYA 4BBQA 3DPLR 2UZGA 2VPGA 4LKAA 3N9NA 1WGMA 3IHPA 2YU4A 3I2DA 3LDYA 1X4JA 3PHDA 2EGPA 2MNYA 5H1VA 4AYCB 2L7PA 2XEUA 4W4UA 4Q6FA 2MD7B 4I7CA 4UP0A 2DX8A 5G05B 2XP0A 3HTKC 4LLBA 3FAOA 5FERA 2VPEA 5LCWB 5B75A 3EB5A 3T7LA 2DJAA 3LRQA 2M3HA 1LDKC 3HCUA 4B86C 1VD4A 2CKLA 1HYIA 2I50A 2CSZA 4S3OB 4WZ2A 2CKLB 3EB6A 4L7XA 2M85A 2YHOA 5DKAA 2KREA 1HYJA 1FBVA 2EODA 2QIZA 3LVRE 3M7KA 4QF3A 4YBMA 3MHHA 5I3LA 4I7DA 3RTRB 4YABA 5D1KB 5FB0A 1T1HA 2PUYA 2H0DB 5G04B 1IYMA 3GL6A 2H0DA 2G45A 4XI1A 2ECWA 1WEQA 5B76A 4A4BA 4OGCA 2EA6A 4O62A 3O36A 2ECVA 3ZVZB 2KYUA 2YW8A 2AN6A 3ZVYA 4GNGA 2ECGA 4UI9B 3VK6A 1VFYA 2YSJA 4CA1A 1CHCA 2IDAA 2IQJA 4GNEA 2YQLA
chains in the Genus database with same CATH topology
2QICA 1FP0A 3NG2A 1U6GB 4QF2A 4YAXA 1V87A 1WFKA 2ECIA 2YREA 2VNFA 3RPGB 5H1UA 1WEPA 1WEEA 4GB0A 1JM7B 2LGKA 2KE1A 2VJEA 3ASLA 2VP7A 3N9QA 3RPGC 2LGVA 2MA5A 2D8SA 3M63A 1WEWA 1XWHA 3N9OA 4GNDA 2OXQC 4I7BA 4AP4A 3L1XA 3ZNIA 2FSAA 2K4DA 4PTBA 1ZBDB 3SOWA 4L58A 4C9ZA 4YC9A 1F62A 1WEMA 2HDPA 3U5MA 5H1TA 4A49A 2LXHC 2KFTA 3N9PA 2LN0A 3LQHA 2BAYA 4MVTA 1E4UA 2L43A 5AIUA 4CCGX 2RI7A 4R2YA 3HCSA 4N3WA 5B78A 4UP5A 5TBNA 5KH7A 5J3XA 2C2LA 2YT5A 3SHBA 2LGGA 5C11A 2YSMA 3DQVR 3KQIA 4FJCA 2QJ0A 2MT5A 2K17A 2KU3A 4O64A 4FK5A 2JMJA 2LV9A 2LXPC 2LRIC 2K16A 3L11A 2ECTA 2MD8C 2C2VS 3O33A 5TABA 2M1RA 5KH3A 4BHWA 2VPDA 5H9MA 2Y43A 4ZDTA 2KWOA 2G43A 1N87A 2YYRA 5D1MB 2YHNA 3O37A 2VJEB 2E6SA 3O35A 1K2FA 4WA6A 2MUMA 2VJFB 4MSXA 1WENA 2L0BA 1Z60A 1WEVA 3O34A 5D1LB 3LQIA 2MIQA 2M6MA 2LGLA 2JMDA 3KV6A 5B77A 4YATA 2JRJA 1WE9A 4B7YC 2LDRA 5AITA 2KGGA 1MM2A 3ZPV1 5LKZA 5TDRA 2K1JA 3MHSA 5TRBA 2MNZA 3HCTA 1DVPA 4N4FA 5LKTA 5FEYA 2ZETC 4TKPB 2L80A 2KIZA 4AVXA 4V3LC 3ZPVE 4IC3A 4LJNA 2KWKA 3PUQA 2VJFA 3FL2A 1Z2QA 5EYAF 4A4CA 5G0FA 3KV5A 2KR4A 4GNFA 2CT2A 4IC2A 4P5OB 1JOCA 3L1ZB 4S3OC 2XB1A 3KNVA 4V3KC 3ZYQA 2JMIA 2NAAA 3GV4A 2KWJA 3SOXA 4ZUXU 2RSDA 1WILA 3M62A 4ZQLA 4F52B 4NN2A 2LQ6A 3C5KA 2FUUA 5KH9A 3QZVA 2YUCA 3O70A 2F6NA 2Y1MA 4YBTA 3N9MA 3M99A 4AYCA 1WEUA 2G6QA 2HYED 1JM7A 3T6RA 2VPBA 1LDJB 3LQJA 3N9LA 5LKXA 5C13A 2ECNA 1X4IA 2KGIA 2Y1NA 2L75A 3PURA 1Z6UA 4FIPA 1BORA 2F42A 1WEOA 4FO9A 4WZ0A 1MM3A 2ECJA 2PNXA 2E6RA 3SOUA 4LK9A 5FB1A 2YQMA 1WIMA 4X3GA 1VYXA 2CSYA 3U5PA 1WESA 4PPEA 5B8DA 5LKUA 1G25A 4YADA 3V43A 4LADB 3U5NA 2F6JA 2L5UA 5B79A 3U5OA 4AUQB 4YBSA 5DINA 1X4UA 3O7AA 4R8PK 3C6WA 4A0CD 4WZ3B 2YURA 4R7EA 3ZTGA 1RMDA 2FUIA 2MA6A 5TDWA 2KWNA 5JG6A 4BBQA 3DPLR 2UZGA 2VPGA 4LKAA 3N9NA 1WGMA 3IHPA 2YU4A 3I2DA 1X4JA 3PHDA 2EGPA 2MNYA 5H1VA 4AYCB 2XEUA 4W4UA 4Q6FA 2MD7B 4I7CA 4UP0A 2DX8A 5G05B 3HTKC 4LLBA 5FERA 2VPEA 5LCWB 5B75A 3EB5A 3T7LA 3LRQA 2M3HA 1LDKC 3HCUA 4B86C 1VD4A 2CKLA 1HYIA 2I50A 2CSZA 4S3OB 4WZ2A 2CKLB 3EB6A 4L7XA 2M85A 2YHOA 5DKAA 2KREA 1HYJA 1FBVA 2EODA 2QIZA 4QF3A 4YBMA 3MHHA 5I3LA 4I7DA 3RTRB 4YABA 5D1KB 1T1HA 2PUYA 2H0DB 5FB0A 5G04B 1IYMA 3GL6A 2H0DA 2G45A 4XI1A 2ECWA 1WEQA 5B76A 4A4BA 2EA6A 3O36A 2ECVA 3ZVZB 2KYUA 2YW8A 2AN6A 3ZVYA 4GNGA 2ECGA 4UI9B 3VK6A 1VFYA 2YSJA 4CA1A 1CHCA 2IDAA 4GNEA 2YQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIC A;  1FP0 A;  3NG2 A;  1U6G B;  4QF2 A;  4YAX A;  1V87 A;  1WFK A;  2ECI A;  2YRE A;  2VNF A;  3RPG B;  5H1U A;  1WEP A;  1WEE A;  4GB0 A;  1JM7 B;  2LGK A;  2KE1 A;  2VJE A;  3ASL A;  2VP7 A;  3N9Q A;  3RPG C;  2LGV A;  2MA5 A;  2D8S A;  3M63 A;  1WEW A;  1XWH A;  3N9O A;  4GND A;  2OXQ C;  4I7B A;  4AP4 A;  3L1X A;  3ZNI A;  2FSA A;  2K4D A;  4PTB A;  1ZBD B;  3SOW A;  4L58 A;  4C9Z A;  4YC9 A;  1F62 A;  1WEM A;  2HDP A;  3U5M A;  5H1T A;  4A49 A;  2LXH C;  2KFT A;  3N9P A;  2LN0 A;  3LQH A;  2BAY A;  4MVT A;  1E4U A;  2L43 A;  5AIU A;  4CCG X;  2RI7 A;  4R2Y A;  3HCS A;  4N3W A;  5B78 A;  4UP5 A;  5TBN A;  5KH7 A;  5J3X A;  2C2L A;  2YT5 A;  3SHB A;  2LGG A;  5C11 A;  2YSM A;  3DQV R;  3KQI A;  4FJC A;  2QJ0 A;  2MT5 A;  2K17 A;  2KU3 A;  4O64 A;  4FK5 A;  2JMJ A;  2LV9 A;  2LXP C;  2LRI C;  2K16 A;  3L11 A;  2ECT A;  2MD8 C;  2C2V S;  3O33 A;  5TAB A;  2M1R A;  5KH3 A;  4BHW A;  2VPD A;  5H9M A;  2Y43 A;  4ZDT A;  2KWO A;  2G43 A;  1N87 A;  2YYR A;  5D1M B;  2YHN A;  3O37 A;  2VJE B;  2E6S A;  3O35 A;  1K2F A;  4WA6 A;  2MUM A;  2VJF B;  4MSX A;  1WEN A;  2L0B A;  1Z60 A;  1WEV A;  3O34 A;  5D1L B;  3LQI A;  2MIQ A;  2M6M A;  2LGL A;  2JMD A;  3KV6 A;  5B77 A;  4YAT A;  2JRJ A;  1WE9 A;  4B7Y C;  2LDR A;  5AIT A;  2KGG A;  1MM2 A;  3ZPV 1;  5LKZ A;  5TDR A;  2K1J A;  3MHS A;  5TRB A;  2MNZ A;  3HCT A;  1DVP A;  4N4F A;  5LKT A;  5FEY A;  2ZET C;  4TKP B;  2L80 A;  2KIZ A;  4AVX A;  4V3L C;  3ZPV E;  4IC3 A;  4LJN A;  2KWK A;  3PUQ A;  2VJF A;  3FL2 A;  1Z2Q A;  5EYA F;  4A4C A;  5G0F A;  3KV5 A;  2KR4 A;  4GNF A;  2CT2 A;  4IC2 A;  4P5O B;  1JOC A;  3L1Z B;  4S3O C;  2XB1 A;  3KNV A;  4V3K C;  3ZYQ A;  2JMI A;  2NAA A;  3GV4 A;  2KWJ A;  3SOX A;  4ZUX U;  2RSD A;  1WIL A;  3M62 A;  4ZQL A;  4F52 B;  4NN2 A;  2LQ6 A;  3C5K A;  2FUU A;  5KH9 A;  3QZV A;  2YUC A;  3O70 A;  2F6N A;  2Y1M A;  4YBT A;  3N9M A;  3M99 A;  4AYC A;  1WEU A;  2G6Q A;  2HYE D;  1JM7 A;  3T6R A;  2VPB A;  1LDJ B;  3LQJ A;  3N9L A;  5LKX A;  5C13 A;  2ECN A;  1X4I A;  2KGI A;  2Y1N A;  2L75 A;  3PUR A;  1Z6U A;  4FIP A;  1BOR A;  2F42 A;  1WEO A;  4FO9 A;  4WZ0 A;  1MM3 A;  2ECJ A;  2PNX A;  2E6R A;  3SOU A;  4LK9 A;  5FB1 A;  2YQM A;  1WIM A;  4X3G A;  1VYX A;  2CSY A;  3U5P A;  1WES A;  4PPE A;  5B8D A;  5LKU A;  1G25 A;  4YAD A;  3V43 A;  4LAD B;  3U5N A;  2F6J A;  2L5U A;  5B79 A;  3U5O A;  4AUQ B;  4YBS A;  5DIN A;  1X4U A;  3O7A A;  4R8P K;  3C6W A;  4A0C D;  4WZ3 B;  2YUR A;  4R7E A;  3ZTG A;  1RMD A;  2FUI A;  2MA6 A;  5TDW A;  2KWN A;  5JG6 A;  4BBQ A;  3DPL R;  2UZG A;  2VPG A;  4LKA A;  3N9N A;  1WGM A;  3IHP A;  2YU4 A;  3I2D A;  1X4J A;  3PHD A;  2EGP A;  2MNY A;  5H1V A;  4AYC B;  2XEU A;  4W4U A;  4Q6F A;  2MD7 B;  4I7C A;  4UP0 A;  2DX8 A;  5G05 B;  3HTK C;  4LLB A;  5FER A;  2VPE A;  5LCW B;  5B75 A;  3EB5 A;  3T7L A;  3LRQ A;  2M3H A;  1LDK C;  3HCU A;  4B86 C;  1VD4 A;  2CKL A;  1HYI A;  2I50 A;  2CSZ A;  4S3O B;  4WZ2 A;  2CKL B;  3EB6 A;  4L7X A;  2M85 A;  2YHO A;  5DKA A;  2KRE A;  1HYJ A;  1FBV A;  2EOD A;  2QIZ A;  4QF3 A;  4YBM A;  3MHH A;  5I3L A;  4I7D A;  3RTR B;  4YAB A;  5D1K B;  1T1H A;  2PUY A;  2H0D B;  5FB0 A;  5G04 B;  1IYM A;  3GL6 A;  2H0D A;  2G45 A;  4XI1 A;  2ECW A;  1WEQ A;  5B76 A;  4A4B A;  2EA6 A;  3O36 A;  2ECV A;  3ZVZ B;  2KYU A;  2YW8 A;  2AN6 A;  3ZVY A;  4GNG A;  2ECG A;  4UI9 B;  3VK6 A;  1VFY A;  2YSJ A;  4CA1 A;  1CHC A;  2IDA A;  4GNE A;  2YQL A; 
#chains in the Genus database with same CATH topology
 2QIC A;  1FP0 A;  3NG2 A;  1U6G B;  4QF2 A;  2EXU A;  5SVI B;  4YAX A;  1V87 A;  1WFK A;  2ECI A;  2YRE A;  2VNF A;  3RPG B;  5H1U A;  1WEP A;  1WEE A;  4GB0 A;  1JM7 B;  2LGK A;  2KE1 A;  2VJE A;  3ASL A;  2VP7 A;  3N9Q A;  3RPG C;  2XOC A;  2LGV A;  2MA5 A;  2D8S A;  3M63 A;  1WEW A;  1XWH A;  3N9O A;  4H9D A;  4GND A;  2OXQ C;  4I7B A;  4AP4 A;  3H7H A;  3L1X A;  3FAN A;  3ZNI A;  2FSA A;  2K4D A;  4PTB A;  5SVX A;  4F1P A;  1ZBD B;  3SOW A;  2DSM A;  4L58 A;  4C9Z A;  4YC9 A;  1F62 A;  1WEM A;  2HDP A;  3U5M A;  5H1T A;  4A49 A;  2LXH C;  2KFT A;  3N9P A;  2YVR A;  2LN0 A;  3LQH A;  2BAY A;  2LAU A;  4MVT A;  1E4U A;  2L43 A;  2P57 A;  5AIU A;  4CCG X;  2RI7 A;  4R2Y A;  3HCS A;  4N3W A;  5B78 A;  2CRR A;  2B0O E;  4UP5 A;  5TBN A;  5KH7 A;  5J3X A;  2MKE A;  2C2L A;  2YT5 A;  3SHB A;  2LGG A;  5C11 A;  2YSM A;  3DQV R;  3KQI A;  4FJC A;  2QJ0 A;  2MT5 A;  2K17 A;  2KU3 A;  4O64 A;  4FK5 A;  2JMJ A;  2LV9 A;  2LXP C;  2LRI C;  2K16 A;  3L11 A;  1DCQ A;  2ECT A;  4QQ4 A;  2MD8 C;  3LVQ E;  2C2V S;  3Q1D A;  3O33 A;  5TAB A;  2M1R A;  5KH3 A;  4Z0R A;  4BHW A;  2VPD A;  5H9M A;  2Y43 A;  4ZDT A;  2KWO A;  2G43 A;  1N87 A;  2YYR A;  5D1M B;  2YHN A;  3O37 A;  2VJE B;  2KKX A;  2E6S A;  2KKY A;  3O35 A;  1K2F A;  4WA6 A;  2MUM A;  2VJF B;  4MSX A;  2CON A;  1WEN A;  2L0B A;  1Z60 A;  1WEV A;  3O34 A;  5D1L B;  3LQI A;  2MIQ A;  2M6M A;  2LGL A;  2JMD A;  3KV6 A;  3T9K A;  5B77 A;  4YAT A;  2JRJ A;  1WE9 A;  3JUE A;  4B7Y C;  2LDR A;  5AIT A;  2KGG A;  1MM2 A;  5SVY A;  3ZPV 1;  5LKZ A;  4Z0O A;  5TDR A;  2K1J A;  3MHS A;  5TRB A;  2MNZ A;  3HCT A;  1DVP A;  4N4F A;  5LKT A;  5FEY A;  3FEH A;  2ZET C;  2CSV A;  4OGE A;  4TKP B;  2L80 A;  2KIZ A;  4AVX A;  4V3L C;  3ZPV E;  3DDT A;  4IC3 A;  4LJN A;  2KWK A;  3PUQ A;  2VJF A;  3FL2 A;  1Z2Q A;  5EYA F;  4A4C A;  5G0F A;  3KV5 A;  3FM8 C;  2KR4 A;  4GNF A;  2CT2 A;  4IC2 A;  4P5O B;  1MBM A;  1JOC A;  3L1Z B;  4S3O C;  2M13 A;  3FJU B;  2XB1 A;  3KNV A;  4V3K C;  3ZYQ A;  2JMI A;  5K3Q A;  2NAA A;  3GV4 A;  2KWJ A;  3SOX A;  4ZUX U;  2RSD A;  1WIL A;  3SUB A;  3M62 A;  4ZQL A;  4F52 B;  4NN2 A;  2E61 A;  2LQ6 A;  3C5K A;  2FUU A;  2EGM A;  5KH9 A;  3QZV A;  2YUC A;  3O70 A;  2F6N A;  2Y1M A;  3LJU X;  4YBT A;  3N9M A;  2JM3 A;  3M99 A;  4AYC A;  3DWD A;  1WEU A;  2G6Q A;  2HYE D;  2OWA A;  1JM7 A;  3T6R A;  2VPB A;  1LDJ B;  3E2D A;  3LQJ A;  3N9L A;  5LKX A;  5C13 A;  2ECN A;  1X4I A;  2KGI A;  2Y1N A;  3KDE C;  2CRW A;  2L75 A;  3PUR A;  2FD4 A;  1Z6U A;  4FIP A;  1BOR A;  2F42 A;  1WEO A;  4FO9 A;  2RR4 A;  4WZ0 A;  1MM3 A;  2ECJ A;  3PLW A;  2PNX A;  2E6R A;  3SOU A;  4LK9 A;  2D8U A;  5FB1 A;  2YQM A;  1WIM A;  4X3G A;  2FFW A;  1VYX A;  2CSY A;  3U5P A;  3MDB C;  1WES A;  4PPE A;  5B8D A;  2XOZ A;  5LKU A;  1G25 A;  4YAD A;  3V43 A;  4LAD B;  3U5N A;  2F6J A;  2L5U A;  5B79 A;  3U5O A;  4AUQ B;  4YBS A;  5SVI A;  5DIN A;  1X4U A;  3O7A A;  4R8P K;  3O47 A;  3C6W A;  4WZ3 B;  2YUR A;  2JUN A;  4R7E A;  4A0C D;  3ZTG A;  1RMD A;  2FUI A;  2MA6 A;  5TDW A;  2KWN A;  5JG6 A;  2XOY A;  4BBQ A;  3DPL R;  2UZG A;  2VPG A;  4LKA A;  3N9N A;  1WGM A;  3IHP A;  2YU4 A;  3I2D A;  3LDY A;  1X4J A;  3PHD A;  2EGP A;  2MNY A;  5H1V A;  4AYC B;  2L7P A;  2XEU A;  4W4U A;  4Q6F A;  2MD7 B;  4I7C A;  4UP0 A;  2DX8 A;  5G05 B;  2XP0 A;  3HTK C;  4LLB A;  3FAO A;  5FER A;  2VPE A;  5LCW B;  5B75 A;  3EB5 A;  3T7L A;  2DJA A;  3LRQ A;  2M3H A;  1LDK C;  3HCU A;  4B86 C;  1VD4 A;  2CKL A;  1HYI A;  2I50 A;  2CSZ A;  4S3O B;  4WZ2 A;  2CKL B;  3EB6 A;  4L7X A;  2M85 A;  2YHO A;  5DKA A;  2KRE A;  1HYJ A;  1FBV A;  2EOD A;  2QIZ A;  3LVR E;  3M7K A;  4QF3 A;  4YBM A;  3MHH A;  5I3L A;  4I7D A;  3RTR B;  4YAB A;  5D1K B;  5FB0 A;  1T1H A;  2PUY A;  2H0D B;  5G04 B;  1IYM A;  3GL6 A;  2H0D A;  2G45 A;  4XI1 A;  2ECW A;  1WEQ A;  5B76 A;  4A4B A;  4OGC A;  2EA6 A;  4O62 A;  3O36 A;  2ECV A;  3ZVZ B;  2KYU A;  2YW8 A;  2AN6 A;  3ZVY A;  4GNG A;  2ECG A;  4UI9 B;  3VK6 A;  1VFY A;  2YSJ A;  4CA1 A;  1CHC A;  2IDA A;  2IQJ A;  4GNE A;  2YQL A; 
#chains in the Genus database with same CATH homology
 2QIC A;  1FP0 A;  3NG2 A;  1U6G B;  4QF2 A;  4YAX A;  1V87 A;  1WFK A;  2ECI A;  2YRE A;  2VNF A;  3RPG B;  5H1U A;  1WEP A;  1WEE A;  4GB0 A;  1JM7 B;  2LGK A;  2KE1 A;  2VJE A;  3ASL A;  2VP7 A;  3N9Q A;  3RPG C;  2LGV A;  2MA5 A;  2D8S A;  3M63 A;  1WEW A;  1XWH A;  3N9O A;  4GND A;  2OXQ C;  4I7B A;  4AP4 A;  3L1X A;  3ZNI A;  2FSA A;  2K4D A;  4PTB A;  1ZBD B;  3SOW A;  4L58 A;  4C9Z A;  4YC9 A;  1F62 A;  1WEM A;  2HDP A;  3U5M A;  5H1T A;  4A49 A;  2LXH C;  2KFT A;  3N9P A;  2LN0 A;  3LQH A;  2BAY A;  4MVT A;  1E4U A;  2L43 A;  5AIU A;  4CCG X;  2RI7 A;  4R2Y A;  3HCS A;  4N3W A;  5B78 A;  4UP5 A;  5TBN A;  5KH7 A;  5J3X A;  2C2L A;  2YT5 A;  3SHB A;  2LGG A;  5C11 A;  2YSM A;  3DQV R;  3KQI A;  4FJC A;  2QJ0 A;  2MT5 A;  2K17 A;  2KU3 A;  4O64 A;  4FK5 A;  2JMJ A;  2LV9 A;  2LXP C;  2LRI C;  2K16 A;  3L11 A;  2ECT A;  2MD8 C;  2C2V S;  3O33 A;  5TAB A;  2M1R A;  5KH3 A;  4BHW A;  2VPD A;  5H9M A;  2Y43 A;  4ZDT A;  2KWO A;  2G43 A;  1N87 A;  2YYR A;  5D1M B;  2YHN A;  3O37 A;  2VJE B;  2E6S A;  3O35 A;  1K2F A;  4WA6 A;  2MUM A;  2VJF B;  4MSX A;  1WEN A;  2L0B A;  1Z60 A;  1WEV A;  3O34 A;  5D1L B;  3LQI A;  2MIQ A;  2M6M A;  2LGL A;  2JMD A;  3KV6 A;  5B77 A;  4YAT A;  2JRJ A;  1WE9 A;  4B7Y C;  2LDR A;  5AIT A;  2KGG A;  1MM2 A;  3ZPV 1;  5LKZ A;  5TDR A;  2K1J A;  3MHS A;  5TRB A;  2MNZ A;  3HCT A;  1DVP A;  4N4F A;  5LKT A;  5FEY A;  2ZET C;  4TKP B;  2L80 A;  2KIZ A;  4AVX A;  4V3L C;  3ZPV E;  4IC3 A;  4LJN A;  2KWK A;  3PUQ A;  2VJF A;  3FL2 A;  1Z2Q A;  5EYA F;  4A4C A;  5G0F A;  3KV5 A;  2KR4 A;  4GNF A;  2CT2 A;  4IC2 A;  4P5O B;  1JOC A;  3L1Z B;  4S3O C;  2XB1 A;  3KNV A;  4V3K C;  3ZYQ A;  2JMI A;  2NAA A;  3GV4 A;  2KWJ A;  3SOX A;  4ZUX U;  2RSD A;  1WIL A;  3M62 A;  4ZQL A;  4F52 B;  4NN2 A;  2LQ6 A;  3C5K A;  2FUU A;  5KH9 A;  3QZV A;  2YUC A;  3O70 A;  2F6N A;  2Y1M A;  4YBT A;  3N9M A;  3M99 A;  4AYC A;  1WEU A;  2G6Q A;  2HYE D;  1JM7 A;  3T6R A;  2VPB A;  1LDJ B;  3LQJ A;  3N9L A;  5LKX A;  5C13 A;  2ECN A;  1X4I A;  2KGI A;  2Y1N A;  2L75 A;  3PUR A;  1Z6U A;  4FIP A;  1BOR A;  2F42 A;  1WEO A;  4FO9 A;  4WZ0 A;  1MM3 A;  2ECJ A;  2PNX A;  2E6R A;  3SOU A;  4LK9 A;  5FB1 A;  2YQM A;  1WIM A;  4X3G A;  1VYX A;  2CSY A;  3U5P A;  1WES A;  4PPE A;  5B8D A;  5LKU A;  1G25 A;  4YAD A;  3V43 A;  4LAD B;  3U5N A;  2F6J A;  2L5U A;  5B79 A;  3U5O A;  4AUQ B;  4YBS A;  5DIN A;  1X4U A;  3O7A A;  4R8P K;  3C6W A;  4A0C D;  4WZ3 B;  2YUR A;  4R7E A;  3ZTG A;  1RMD A;  2FUI A;  2MA6 A;  5TDW A;  2KWN A;  5JG6 A;  4BBQ A;  3DPL R;  2UZG A;  2VPG A;  4LKA A;  3N9N A;  1WGM A;  3IHP A;  2YU4 A;  3I2D A;  1X4J A;  3PHD A;  2EGP A;  2MNY A;  5H1V A;  4AYC B;  2XEU A;  4W4U A;  4Q6F A;  2MD7 B;  4I7C A;  4UP0 A;  2DX8 A;  5G05 B;  3HTK C;  4LLB A;  5FER A;  2VPE A;  5LCW B;  5B75 A;  3EB5 A;  3T7L A;  3LRQ A;  2M3H A;  1LDK C;  3HCU A;  4B86 C;  1VD4 A;  2CKL A;  1HYI A;  2I50 A;  2CSZ A;  4S3O B;  4WZ2 A;  2CKL B;  3EB6 A;  4L7X A;  2M85 A;  2YHO A;  5DKA A;  2KRE A;  1HYJ A;  1FBV A;  2EOD A;  2QIZ A;  4QF3 A;  4YBM A;  3MHH A;  5I3L A;  4I7D A;  3RTR B;  4YAB A;  5D1K B;  1T1H A;  2PUY A;  2H0D B;  5FB0 A;  5G04 B;  1IYM A;  3GL6 A;  2H0D A;  2G45 A;  4XI1 A;  2ECW A;  1WEQ A;  5B76 A;  4A4B A;  2EA6 A;  3O36 A;  2ECV A;  3ZVZ B;  2KYU A;  2YW8 A;  2AN6 A;  3ZVY A;  4GNG A;  2ECG A;  4UI9 B;  3VK6 A;  1VFY A;  2YSJ A;  4CA1 A;  1CHC A;  2IDA A;  4GNE A;  2YQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...