2ECTA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of ring finger protein 126
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
GSSGSSGTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein 126
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of RING finger protein 126
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 5
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ectA00
2QIZA 4FK5A 5AITA 4LKAA 1X4UA 1FP0A 5I3LA 4CCGX 2LV9A 2CKLA 2YQLA 2LDRA 3N9QA 4C9ZA 2YHNA 3KV6A 2KU3A 2MD7B 2K1JA 1N87A 2EA6A 2ECGA 5B79A 4WA6A 4AYCA 2VPGA 4Q6FA 2LGVA 3LRQA 4I7CA 2K17A 2C2LA 2MA6A 3LQJA 4GNGA 3LQIA 4W4UA 4A0CD 1WEEA 1XWHA 5B8DA 3MHHA 4XI1A 1WEUA 2Y1NA 2MIQA 3L1XA 3U5MA 3ZVZB 5G04B 2KGGA 1JOCA 2VP7A 3O36A 4NN2A 2ECIA 3PURA 2XB1A 1WFKA 3L11A 2HDPA 4PPEA 2ECVA 2QJ0A 4S3OC 2YUCA 1HYIA 1MM3A 4YBSA 4YC9A 3T6RA 4I7DA 2OXQC 4AVXA 4YAXA 3GV4A 5TDWA 2FUUA 2KE1A 2ECNA 5B78A 1LDKC 4ZDTA 2VPBA 5FB1A 2VJEA 4V3KC 2L75A 5C13A 2LRIC 4MSXA 2RI7A 4P5OB 4WZ0A 4CA1A 3EB5A 1BORA 2VJFB 2IDAA 2FSAA 5EYAF 3N9LA 5TABA 2F6JA 5G0FA 2L5UA 1WENA 2VPDA 4UP0A 2XEUA 4X3GA 3U5PA 5D1MB 1K2FA 2KWJA 2H0DA 2M6MA 2MNYA 1WESA 3O7AA 3ASLA 4WZ3B 2L0BA 3ZVYA 3DQVR 3PUQA 5B77A 4YBTA 2YSJA 1DVPA 2YHOA 2YYRA 3SHBA 4N3WA 2G6QA 2KIZA 4A4BA 4BHWA 3PHDA 3KNVA 4MVTA 5C11A 5FERA 1WEMA 3O34A 5DINA 4B86C 2K16A 3RPGB 3N9NA 2LGKA 5TRBA 2CT2A 3SOXA 3IHPA 1WEPA 2QICA 4FIPA 4R2YA 1WEVA 2F42A 5H1TA 4B7YC 2MA5A 5FB0A 2L80A 2JMIA 4ZUXU 1MM2A 3HCTA 2YW8A 2ECTA 4IC3A 4FJCA 4LJNA 2FUIA 2ECJA 2PUYA 1U6GB 5B76A 2EGPA 2LQ6A 2YSMA 2D8SA 5B75A 2BAYA 2M3HA 1WEWA 4TKPB 4GNEA 5H1UA 2KREA 2DX8A 2KR4A 4R7EA 2E6SA 2EODA 1IYMA 3GL6A 2AN6A 2G43A 2KWOA 3C6WA 4R8PK 2CSYA 3U5OA 1HYJA 4YADA 2VJFA 3O70A 3QZVA 4A49A 2HYED 4LK9A 3N9OA 4S3OB 3V43A 1E4UA 4GNDA 3I2DA 2KGIA 2MT5A 5KH7A 1T1HA 1WGMA 3ZPV1 2Y43A 5H1VA 2VJEB 3KQIA 1X4JA 1VFYA 4QF3A 4V3LC 2KFTA 4QF2A 3U5NA 5DKAA 3M63A 3LQHA 5LKXA 1LDJB 5D1KB 4UP5A 5JG6A 1JM7B 2NAAA 4YABA 4GNFA 5TDRA 2K4DA 3N9MA 5H9MA 5LKUA 5LKTA 3O37A 3ZPVE 4AUQB 1WEQA 5J3XA 2MUMA 5KH3A 2L43A 2KWNA 5FEYA 2CKLB 2MD8C 4UI9B 3EB6A 2G45A 2YURA 2ECWA 1WILA 3L1ZB 2Y1MA 2JMJA 3HCUA 1CHCA 4ZQLA 2LGLA 3RTRB 4AYCB 1RMDA 2KWKA 2YREA 1VD4A 1V87A 4YATA 1WEOA 4YBMA 4GB0A 2E6RA 1F62A 3M99A 2PNXA 2JMDA 3SOWA 2C2VS 1G25A 4IC2A 3HTKC 1ZBDB 4LLBA 2M85A 3VK6A 4WZ2A 4F52B 4A4CA 1Z2QA 3KV5A 1Z6UA 1WIMA 2VPEA 4N4FA 5TBNA 2CSZA 1X4IA 2KYUA 1WE9A 3N9PA 5LKZA 2LXPC 2I50A 2RSDA 4BBQA 1Z60A 3M62A 4PTBA 4I7BA 2YT5A 3O33A 2VNFA 5G05B 3SOUA 3T7LA 4LADB 2F6NA 2JRJA 3MHSA 3FL2A 2M1RA 2YU4A 4AP4A 4L7XA 3ZNIA 4FO9A 3DPLR 3NG2A 2UZGA 2LXHC 4L58A 1FBVA 5LCWB 3HCSA 5D1LB 3C5KA 2MNZA 2ZETC 1VYXA 1JM7A 4O64A 2LN0A 3ZTGA 2H0DB 2YQMA 2LGGA 3O35A 5KH9A 3ZYQA 5AIUA 3RPGC
chains in the Genus database with same CATH superfamily
2D8UA 2QIZA 4FK5A 5AITA 4LKAA 1X4UA 1FP0A 5I3LA 2DJAA 4CCGX 2LV9A 2CKLA 2YQLA 2LDRA 3N9QA 4C9ZA 2YHNA 3KV6A 3M7KA 2KU3A 2MD7B 2K1JA 1N87A 2EA6A 2ECGA 5B79A 4WA6A 4AYCA 2VPGA 4Q6FA 2LGVA 3LRQA 4I7CA 2K17A 2C2LA 2MA6A 3LQJA 5SVIA 4GNGA 3LQIA 4W4UA 2KKXA 4A0CD 3LDYA 1WEEA 2IQJA 1XWHA 5B8DA 1MBMA 3MHHA 2MKEA 4XI1A 3PLWA 1WEUA 2Y1NA 2MIQA 3L1XA 3T9KA 3U5MA 3FAOA 3LVQE 3ZVZB 5G04B 2KGGA 1JOCA 2VP7A 3O36A 4NN2A 2ECIA 3PURA 2CRRA 1WFKA 2XB1A 3L11A 2HDPA 4PPEA 2ECVA 2QJ0A 4S3OC 2YUCA 1HYIA 2XOYA 1MM3A 4YBSA 4YC9A 3T6RA 4I7DA 2OXQC 4AVXA 4YAXA 3GV4A 5TDWA 2FUUA 2KE1A 2ECNA 5B78A 2DSMA 1LDKC 4ZDTA 2VPBA 5FB1A 2VJEA 4V3KC 2L75A 4F1PA 5C13A 2LRIC 4MSXA 2RI7A 4P5OB 4WZ0A 4CA1A 3EB5A 2RR4A 1BORA 2VJFB 2IDAA 3LJUX 2FSAA 5EYAF 3N9LA 5TABA 2F6JA 5G0FA 2FD4A 2L5UA 1WENA 2B0OE 2VPDA 4UP0A 1DCQA 2XEUA 2OWAA 4X3GA 3U5PA 5D1MB 1K2FA 2KWJA 2H0DA 2M6MA 2MNYA 1WESA 3O7AA 3ASLA 4WZ3B 2L0BA 3ZVYA 3DQVR 3PUQA 5B77A 2XP0A 2LAUA 4YBTA 2YSJA 1DVPA 2YHOA 2YYRA 3SHBA 4N3WA 3FM8C 2G6QA 2KIZA 2JM3A 3DDTA 3E2DA 4A4BA 4BHWA 3PHDA 3KNVA 4MVTA 5C11A 5FERA 1WEMA 3FANA 3O34A 5DINA 4B86C 2K16A 3RPGB 3N9NA 2LGKA 5TRBA 4Z0OA 2CT2A 3SOXA 3IHPA 1WEPA 2QICA 4FIPA 4R2YA 1WEVA 2F42A 2M13A 5SVYA 5H1TA 4B7YC 2XOZA 2MA5A 5FB0A 2L80A 2JMIA 4ZUXU 1MM2A 3HCTA 2YW8A 2ECTA 4IC3A 4FJCA 4LJNA 2FUIA 2ECJA 2PUYA 1U6GB 5B76A 4H9DA 2EGPA 2LQ6A 2YSMA 2D8SA 3O47A 4OGCA 2JUNA 5B75A 2BAYA 2M3HA 1WEWA 4TKPB 4GNEA 5H1UA 2KREA 2DX8A 2FFWA 2KR4A 2CRWA 4R7EA 2E6SA 2EODA 1IYMA 3GL6A 2AN6A 2G43A 2KWOA 3C6WA 4R8PK 4OGEA 2CSYA 3U5OA 1HYJA 4YADA 2VJFA 3O70A 3QZVA 4A49A 2HYED 4LK9A 3N9OA 4S3OB 3V43A 1E4UA 4GNDA 3I2DA 4O62A 2KGIA 2MT5A 5KH7A 1T1HA 1WGMA 3ZPV1 2Y43A 5H1VA 2VJEB 3KQIA 1X4JA 1VFYA 4QF3A 4V3LC 2KFTA 4QF2A 3U5NA 3JUEA 5DKAA 3M63A 3LQHA 5LKXA 1LDJB 5D1KB 4UP5A 5JG6A 1JM7B 2NAAA 4YABA 4GNFA 5K3QA 5TDRA 3Q1DA 5SVXA 2K4DA 3N9MA 5H9MA 5LKUA 5LKTA 3KDEC 3O37A 3ZPVE 4AUQB 1WEQA 2XOCA 5J3XA 2MUMA 5KH3A 2L43A 2KWNA 5FEYA 2CKLB 2MD8C 4UI9B 3EB6A 2G45A 2YURA 2ECWA 1WILA 3L1ZB 2Y1MA 2JMJA 3HCUA 1CHCA 2KKYA 4ZQLA 2LGLA 3RTRB 4AYCB 1RMDA 2KWKA 2YREA 1VD4A 1V87A 4YATA 1WEOA 4YBMA 5SVIB 3DWDA 4GB0A 2E6RA 1F62A 3M99A 2PNXA 2JMDA 3SOWA 2C2VS 1G25A 4IC2A 3HTKC 2P57A 1ZBDB 4LLBA 2M85A 3VK6A 4WZ2A 4F52B 4A4CA 3MDBC 1Z2QA 3KV5A 1Z6UA 1WIMA 2VPEA 4N4FA 4Z0RA 5TBNA 2CSZA 3LVRE 1X4IA 2EGMA 2KYUA 2E61A 1WE9A 3N9PA 5LKZA 2LXPC 2I50A 2RSDA 4BBQA 1Z60A 3M62A 4PTBA 4I7BA 4QQ4A 2YT5A 3O33A 2VNFA 5G05B 3SOUA 3T7LA 4LADB 2YVRA 2F6NA 2JRJA 3MHSA 3FL2A 2M1RA 2YU4A 4AP4A 4L7XA 3ZNIA 4FO9A 3FEHA 3DPLR 3NG2A 2UZGA 3SUBA 2EXUA 2LXHC 4L58A 1FBVA 3H7HA 5LCWB 2CSVA 3HCSA 5D1LB 3C5KA 2MNZA 2ZETC 1VYXA 1JM7A 4O64A 2LN0A 3FJUB 2L7PA 3ZTGA 2H0DB 2YQMA 2CONA 2LGGA 3O35A 5KH9A 3ZYQA 5AIUA 3RPGC
chains in the Genus database with same CATH topology
2QIZA 4FK5A 5AITA 4LKAA 1X4UA 1FP0A 5I3LA 4CCGX 2LV9A 2CKLA 2YQLA 2LDRA 3N9QA 4C9ZA 2YHNA 3KV6A 2KU3A 2MD7B 2K1JA 1N87A 2EA6A 2ECGA 5B79A 4WA6A 4AYCA 2VPGA 4Q6FA 2LGVA 3LRQA 4I7CA 2K17A 2C2LA 2MA6A 3LQJA 4GNGA 3LQIA 4W4UA 4A0CD 1WEEA 1XWHA 5B8DA 3MHHA 4XI1A 1WEUA 2Y1NA 2MIQA 3L1XA 3U5MA 3ZVZB 5G04B 2KGGA 1JOCA 2VP7A 3O36A 4NN2A 2ECIA 3PURA 2XB1A 1WFKA 3L11A 2HDPA 4PPEA 2ECVA 2QJ0A 4S3OC 2YUCA 1HYIA 1MM3A 4YBSA 4YC9A 3T6RA 4I7DA 2OXQC 4AVXA 4YAXA 3GV4A 5TDWA 2FUUA 2KE1A 2ECNA 5B78A 1LDKC 4ZDTA 2VPBA 5FB1A 2VJEA 4V3KC 2L75A 5C13A 2LRIC 4MSXA 2RI7A 4P5OB 4WZ0A 4CA1A 3EB5A 1BORA 2VJFB 2IDAA 2FSAA 5EYAF 3N9LA 5TABA 2F6JA 5G0FA 2L5UA 1WENA 2VPDA 4UP0A 2XEUA 4X3GA 3U5PA 5D1MB 1K2FA 2KWJA 2H0DA 2M6MA 2MNYA 1WESA 3O7AA 3ASLA 4WZ3B 2L0BA 3ZVYA 3DQVR 3PUQA 5B77A 4YBTA 2YSJA 1DVPA 2YHOA 2YYRA 3SHBA 4N3WA 2G6QA 2KIZA 4A4BA 4BHWA 3PHDA 3KNVA 4MVTA 5C11A 5FERA 1WEMA 3O34A 5DINA 4B86C 2K16A 3RPGB 3N9NA 2LGKA 5TRBA 2CT2A 3SOXA 3IHPA 1WEPA 2QICA 4FIPA 4R2YA 1WEVA 2F42A 5H1TA 4B7YC 2MA5A 5FB0A 2L80A 2JMIA 4ZUXU 1MM2A 3HCTA 2YW8A 2ECTA 4IC3A 4FJCA 4LJNA 2FUIA 2ECJA 2PUYA 1U6GB 5B76A 2EGPA 2LQ6A 2YSMA 2D8SA 5B75A 2BAYA 2M3HA 1WEWA 4TKPB 4GNEA 5H1UA 2KREA 2DX8A 2KR4A 4R7EA 2E6SA 2EODA 1IYMA 3GL6A 2AN6A 2G43A 2KWOA 3C6WA 4R8PK 2CSYA 3U5OA 1HYJA 4YADA 2VJFA 3O70A 3QZVA 4A49A 2HYED 4LK9A 3N9OA 4S3OB 3V43A 1E4UA 4GNDA 3I2DA 2KGIA 2MT5A 5KH7A 1T1HA 1WGMA 3ZPV1 2Y43A 5H1VA 2VJEB 3KQIA 1X4JA 1VFYA 4QF3A 4V3LC 2KFTA 4QF2A 3U5NA 5DKAA 3M63A 3LQHA 5LKXA 1LDJB 5D1KB 4UP5A 5JG6A 1JM7B 2NAAA 4YABA 4GNFA 5TDRA 2K4DA 3N9MA 5H9MA 5LKUA 5LKTA 3O37A 3ZPVE 4AUQB 1WEQA 5J3XA 2MUMA 5KH3A 2L43A 2KWNA 5FEYA 2CKLB 2MD8C 4UI9B 3EB6A 2G45A 2YURA 2ECWA 1WILA 3L1ZB 2Y1MA 2JMJA 3HCUA 1CHCA 4ZQLA 2LGLA 3RTRB 4AYCB 1RMDA 2KWKA 2YREA 1VD4A 1V87A 4YATA 1WEOA 4YBMA 4GB0A 2E6RA 1F62A 3M99A 2PNXA 2JMDA 3SOWA 2C2VS 1G25A 4IC2A 3HTKC 1ZBDB 4LLBA 2M85A 3VK6A 4WZ2A 4F52B 4A4CA 1Z2QA 3KV5A 1Z6UA 1WIMA 2VPEA 4N4FA 5TBNA 2CSZA 1X4IA 2KYUA 1WE9A 3N9PA 5LKZA 2LXPC 2I50A 2RSDA 4BBQA 1Z60A 3M62A 4PTBA 4I7BA 2YT5A 3O33A 2VNFA 5G05B 3SOUA 3T7LA 4LADB 2F6NA 2JRJA 3MHSA 3FL2A 2M1RA 2YU4A 4AP4A 4L7XA 3ZNIA 4FO9A 3DPLR 3NG2A 2UZGA 2LXHC 4L58A 1FBVA 5LCWB 3HCSA 5D1LB 3C5KA 2MNZA 2ZETC 1VYXA 1JM7A 4O64A 2LN0A 3ZTGA 2H0DB 2YQMA 2LGGA 3O35A 5KH9A 3ZYQA 5AIUA 3RPGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIZ A;  4FK5 A;  5AIT A;  4LKA A;  1X4U A;  1FP0 A;  5I3L A;  4CCG X;  2LV9 A;  2CKL A;  2YQL A;  2LDR A;  3N9Q A;  4C9Z A;  2YHN A;  3KV6 A;  2KU3 A;  2MD7 B;  2K1J A;  1N87 A;  2EA6 A;  2ECG A;  5B79 A;  4WA6 A;  4AYC A;  2VPG A;  4Q6F A;  2LGV A;  3LRQ A;  4I7C A;  2K17 A;  2C2L A;  2MA6 A;  3LQJ A;  4GNG A;  3LQI A;  4W4U A;  4A0C D;  1WEE A;  1XWH A;  5B8D A;  3MHH A;  4XI1 A;  1WEU A;  2Y1N A;  2MIQ A;  3L1X A;  3U5M A;  3ZVZ B;  5G04 B;  2KGG A;  1JOC A;  2VP7 A;  3O36 A;  4NN2 A;  2ECI A;  3PUR A;  2XB1 A;  1WFK A;  3L11 A;  2HDP A;  4PPE A;  2ECV A;  2QJ0 A;  4S3O C;  2YUC A;  1HYI A;  1MM3 A;  4YBS A;  4YC9 A;  3T6R A;  4I7D A;  2OXQ C;  4AVX A;  4YAX A;  3GV4 A;  5TDW A;  2FUU A;  2KE1 A;  2ECN A;  5B78 A;  1LDK C;  4ZDT A;  2VPB A;  5FB1 A;  2VJE A;  4V3K C;  2L75 A;  5C13 A;  2LRI C;  4MSX A;  2RI7 A;  4P5O B;  4WZ0 A;  4CA1 A;  3EB5 A;  1BOR A;  2VJF B;  2IDA A;  2FSA A;  5EYA F;  3N9L A;  5TAB A;  2F6J A;  5G0F A;  2L5U A;  1WEN A;  2VPD A;  4UP0 A;  2XEU A;  4X3G A;  3U5P A;  5D1M B;  1K2F A;  2KWJ A;  2H0D A;  2M6M A;  2MNY A;  1WES A;  3O7A A;  3ASL A;  4WZ3 B;  2L0B A;  3ZVY A;  3DQV R;  3PUQ A;  5B77 A;  4YBT A;  2YSJ A;  1DVP A;  2YHO A;  2YYR A;  3SHB A;  4N3W A;  2G6Q A;  2KIZ A;  4A4B A;  4BHW A;  3PHD A;  3KNV A;  4MVT A;  5C11 A;  5FER A;  1WEM A;  3O34 A;  5DIN A;  4B86 C;  2K16 A;  3RPG B;  3N9N A;  2LGK A;  5TRB A;  2CT2 A;  3SOX A;  3IHP A;  1WEP A;  2QIC A;  4FIP A;  4R2Y A;  1WEV A;  2F42 A;  5H1T A;  4B7Y C;  2MA5 A;  5FB0 A;  2L80 A;  2JMI A;  4ZUX U;  1MM2 A;  3HCT A;  2YW8 A;  2ECT A;  4IC3 A;  4FJC A;  4LJN A;  2FUI A;  2ECJ A;  2PUY A;  1U6G B;  5B76 A;  2EGP A;  2LQ6 A;  2YSM A;  2D8S A;  5B75 A;  2BAY A;  2M3H A;  1WEW A;  4TKP B;  4GNE A;  5H1U A;  2KRE A;  2DX8 A;  2KR4 A;  4R7E A;  2E6S A;  2EOD A;  1IYM A;  3GL6 A;  2AN6 A;  2G43 A;  2KWO A;  3C6W A;  4R8P K;  2CSY A;  3U5O A;  1HYJ A;  4YAD A;  2VJF A;  3O70 A;  3QZV A;  4A49 A;  2HYE D;  4LK9 A;  3N9O A;  4S3O B;  3V43 A;  1E4U A;  4GND A;  3I2D A;  2KGI A;  2MT5 A;  5KH7 A;  1T1H A;  1WGM A;  3ZPV 1;  2Y43 A;  5H1V A;  2VJE B;  3KQI A;  1X4J A;  1VFY A;  4QF3 A;  4V3L C;  2KFT A;  4QF2 A;  3U5N A;  5DKA A;  3M63 A;  3LQH A;  5LKX A;  1LDJ B;  5D1K B;  4UP5 A;  5JG6 A;  1JM7 B;  2NAA A;  4YAB A;  4GNF A;  5TDR A;  2K4D A;  3N9M A;  5H9M A;  5LKU A;  5LKT A;  3O37 A;  3ZPV E;  4AUQ B;  1WEQ A;  5J3X A;  2MUM A;  5KH3 A;  2L43 A;  2KWN A;  5FEY A;  2CKL B;  2MD8 C;  4UI9 B;  3EB6 A;  2G45 A;  2YUR A;  2ECW A;  1WIL A;  3L1Z B;  2Y1M A;  2JMJ A;  3HCU A;  1CHC A;  4ZQL A;  2LGL A;  3RTR B;  4AYC B;  1RMD A;  2KWK A;  2YRE A;  1VD4 A;  1V87 A;  4YAT A;  1WEO A;  4YBM A;  4GB0 A;  2E6R A;  1F62 A;  3M99 A;  2PNX A;  2JMD A;  3SOW A;  2C2V S;  1G25 A;  4IC2 A;  3HTK C;  1ZBD B;  4LLB A;  2M85 A;  3VK6 A;  4WZ2 A;  4F52 B;  4A4C A;  1Z2Q A;  3KV5 A;  1Z6U A;  1WIM A;  2VPE A;  4N4F A;  5TBN A;  2CSZ A;  1X4I A;  2KYU A;  1WE9 A;  3N9P A;  5LKZ A;  2LXP C;  2I50 A;  2RSD A;  4BBQ A;  1Z60 A;  3M62 A;  4PTB A;  4I7B A;  2YT5 A;  3O33 A;  2VNF A;  5G05 B;  3SOU A;  3T7L A;  4LAD B;  2F6N A;  2JRJ A;  3MHS A;  3FL2 A;  2M1R A;  2YU4 A;  4AP4 A;  4L7X A;  3ZNI A;  4FO9 A;  3DPL R;  3NG2 A;  2UZG A;  2LXH C;  4L58 A;  1FBV A;  5LCW B;  3HCS A;  5D1L B;  3C5K A;  2MNZ A;  2ZET C;  1VYX A;  1JM7 A;  4O64 A;  2LN0 A;  3ZTG A;  2H0D B;  2YQM A;  2LGG A;  3O35 A;  5KH9 A;  3ZYQ A;  5AIU A;  3RPG C; 
#chains in the Genus database with same CATH topology
 2D8U A;  2QIZ A;  4FK5 A;  5AIT A;  4LKA A;  1X4U A;  1FP0 A;  5I3L A;  2DJA A;  4CCG X;  2LV9 A;  2CKL A;  2YQL A;  2LDR A;  3N9Q A;  4C9Z A;  2YHN A;  3KV6 A;  3M7K A;  2KU3 A;  2MD7 B;  2K1J A;  1N87 A;  2EA6 A;  2ECG A;  5B79 A;  4WA6 A;  4AYC A;  2VPG A;  4Q6F A;  2LGV A;  3LRQ A;  4I7C A;  2K17 A;  2C2L A;  2MA6 A;  3LQJ A;  5SVI A;  4GNG A;  3LQI A;  4W4U A;  2KKX A;  4A0C D;  3LDY A;  1WEE A;  2IQJ A;  1XWH A;  5B8D A;  1MBM A;  3MHH A;  2MKE A;  4XI1 A;  3PLW A;  1WEU A;  2Y1N A;  2MIQ A;  3L1X A;  3T9K A;  3U5M A;  3FAO A;  3LVQ E;  3ZVZ B;  5G04 B;  2KGG A;  1JOC A;  2VP7 A;  3O36 A;  4NN2 A;  2ECI A;  3PUR A;  2CRR A;  1WFK A;  2XB1 A;  3L11 A;  2HDP A;  4PPE A;  2ECV A;  2QJ0 A;  4S3O C;  2YUC A;  1HYI A;  2XOY A;  1MM3 A;  4YBS A;  4YC9 A;  3T6R A;  4I7D A;  2OXQ C;  4AVX A;  4YAX A;  3GV4 A;  5TDW A;  2FUU A;  2KE1 A;  2ECN A;  5B78 A;  2DSM A;  1LDK C;  4ZDT A;  2VPB A;  5FB1 A;  2VJE A;  4V3K C;  2L75 A;  4F1P A;  5C13 A;  2LRI C;  4MSX A;  2RI7 A;  4P5O B;  4WZ0 A;  4CA1 A;  3EB5 A;  2RR4 A;  1BOR A;  2VJF B;  2IDA A;  3LJU X;  2FSA A;  5EYA F;  3N9L A;  5TAB A;  2F6J A;  5G0F A;  2FD4 A;  2L5U A;  1WEN A;  2B0O E;  2VPD A;  4UP0 A;  1DCQ A;  2XEU A;  2OWA A;  4X3G A;  3U5P A;  5D1M B;  1K2F A;  2KWJ A;  2H0D A;  2M6M A;  2MNY A;  1WES A;  3O7A A;  3ASL A;  4WZ3 B;  2L0B A;  3ZVY A;  3DQV R;  3PUQ A;  5B77 A;  2XP0 A;  2LAU A;  4YBT A;  2YSJ A;  1DVP A;  2YHO A;  2YYR A;  3SHB A;  4N3W A;  3FM8 C;  2G6Q A;  2KIZ A;  2JM3 A;  3DDT A;  3E2D A;  4A4B A;  4BHW A;  3PHD A;  3KNV A;  4MVT A;  5C11 A;  5FER A;  1WEM A;  3FAN A;  3O34 A;  5DIN A;  4B86 C;  2K16 A;  3RPG B;  3N9N A;  2LGK A;  5TRB A;  4Z0O A;  2CT2 A;  3SOX A;  3IHP A;  1WEP A;  2QIC A;  4FIP A;  4R2Y A;  1WEV A;  2F42 A;  2M13 A;  5SVY A;  5H1T A;  4B7Y C;  2XOZ A;  2MA5 A;  5FB0 A;  2L80 A;  2JMI A;  4ZUX U;  1MM2 A;  3HCT A;  2YW8 A;  2ECT A;  4IC3 A;  4FJC A;  4LJN A;  2FUI A;  2ECJ A;  2PUY A;  1U6G B;  5B76 A;  4H9D A;  2EGP A;  2LQ6 A;  2YSM A;  2D8S A;  3O47 A;  4OGC A;  2JUN A;  5B75 A;  2BAY A;  2M3H A;  1WEW A;  4TKP B;  4GNE A;  5H1U A;  2KRE A;  2DX8 A;  2FFW A;  2KR4 A;  2CRW A;  4R7E A;  2E6S A;  2EOD A;  1IYM A;  3GL6 A;  2AN6 A;  2G43 A;  2KWO A;  3C6W A;  4R8P K;  4OGE A;  2CSY A;  3U5O A;  1HYJ A;  4YAD A;  2VJF A;  3O70 A;  3QZV A;  4A49 A;  2HYE D;  4LK9 A;  3N9O A;  4S3O B;  3V43 A;  1E4U A;  4GND A;  3I2D A;  4O62 A;  2KGI A;  2MT5 A;  5KH7 A;  1T1H A;  1WGM A;  3ZPV 1;  2Y43 A;  5H1V A;  2VJE B;  3KQI A;  1X4J A;  1VFY A;  4QF3 A;  4V3L C;  2KFT A;  4QF2 A;  3U5N A;  3JUE A;  5DKA A;  3M63 A;  3LQH A;  5LKX A;  1LDJ B;  5D1K B;  4UP5 A;  5JG6 A;  1JM7 B;  2NAA A;  4YAB A;  4GNF A;  5K3Q A;  5TDR A;  3Q1D A;  5SVX A;  2K4D A;  3N9M A;  5H9M A;  5LKU A;  5LKT A;  3KDE C;  3O37 A;  3ZPV E;  4AUQ B;  1WEQ A;  2XOC A;  5J3X A;  2MUM A;  5KH3 A;  2L43 A;  2KWN A;  5FEY A;  2CKL B;  2MD8 C;  4UI9 B;  3EB6 A;  2G45 A;  2YUR A;  2ECW A;  1WIL A;  3L1Z B;  2Y1M A;  2JMJ A;  3HCU A;  1CHC A;  2KKY A;  4ZQL A;  2LGL A;  3RTR B;  4AYC B;  1RMD A;  2KWK A;  2YRE A;  1VD4 A;  1V87 A;  4YAT A;  1WEO A;  4YBM A;  5SVI B;  3DWD A;  4GB0 A;  2E6R A;  1F62 A;  3M99 A;  2PNX A;  2JMD A;  3SOW A;  2C2V S;  1G25 A;  4IC2 A;  3HTK C;  2P57 A;  1ZBD B;  4LLB A;  2M85 A;  3VK6 A;  4WZ2 A;  4F52 B;  4A4C A;  3MDB C;  1Z2Q A;  3KV5 A;  1Z6U A;  1WIM A;  2VPE A;  4N4F A;  4Z0R A;  5TBN A;  2CSZ A;  3LVR E;  1X4I A;  2EGM A;  2KYU A;  2E61 A;  1WE9 A;  3N9P A;  5LKZ A;  2LXP C;  2I50 A;  2RSD A;  4BBQ A;  1Z60 A;  3M62 A;  4PTB A;  4I7B A;  4QQ4 A;  2YT5 A;  3O33 A;  2VNF A;  5G05 B;  3SOU A;  3T7L A;  4LAD B;  2YVR A;  2F6N A;  2JRJ A;  3MHS A;  3FL2 A;  2M1R A;  2YU4 A;  4AP4 A;  4L7X A;  3ZNI A;  4FO9 A;  3FEH A;  3DPL R;  3NG2 A;  2UZG A;  3SUB A;  2EXU A;  2LXH C;  4L58 A;  1FBV A;  3H7H A;  5LCW B;  2CSV A;  3HCS A;  5D1L B;  3C5K A;  2MNZ A;  2ZET C;  1VYX A;  1JM7 A;  4O64 A;  2LN0 A;  3FJU B;  2L7P A;  3ZTG A;  2H0D B;  2YQM A;  2CON A;  2LGG A;  3O35 A;  5KH9 A;  3ZYQ A;  5AIU A;  3RPG C; 
#chains in the Genus database with same CATH homology
 2QIZ A;  4FK5 A;  5AIT A;  4LKA A;  1X4U A;  1FP0 A;  5I3L A;  4CCG X;  2LV9 A;  2CKL A;  2YQL A;  2LDR A;  3N9Q A;  4C9Z A;  2YHN A;  3KV6 A;  2KU3 A;  2MD7 B;  2K1J A;  1N87 A;  2EA6 A;  2ECG A;  5B79 A;  4WA6 A;  4AYC A;  2VPG A;  4Q6F A;  2LGV A;  3LRQ A;  4I7C A;  2K17 A;  2C2L A;  2MA6 A;  3LQJ A;  4GNG A;  3LQI A;  4W4U A;  4A0C D;  1WEE A;  1XWH A;  5B8D A;  3MHH A;  4XI1 A;  1WEU A;  2Y1N A;  2MIQ A;  3L1X A;  3U5M A;  3ZVZ B;  5G04 B;  2KGG A;  1JOC A;  2VP7 A;  3O36 A;  4NN2 A;  2ECI A;  3PUR A;  2XB1 A;  1WFK A;  3L11 A;  2HDP A;  4PPE A;  2ECV A;  2QJ0 A;  4S3O C;  2YUC A;  1HYI A;  1MM3 A;  4YBS A;  4YC9 A;  3T6R A;  4I7D A;  2OXQ C;  4AVX A;  4YAX A;  3GV4 A;  5TDW A;  2FUU A;  2KE1 A;  2ECN A;  5B78 A;  1LDK C;  4ZDT A;  2VPB A;  5FB1 A;  2VJE A;  4V3K C;  2L75 A;  5C13 A;  2LRI C;  4MSX A;  2RI7 A;  4P5O B;  4WZ0 A;  4CA1 A;  3EB5 A;  1BOR A;  2VJF B;  2IDA A;  2FSA A;  5EYA F;  3N9L A;  5TAB A;  2F6J A;  5G0F A;  2L5U A;  1WEN A;  2VPD A;  4UP0 A;  2XEU A;  4X3G A;  3U5P A;  5D1M B;  1K2F A;  2KWJ A;  2H0D A;  2M6M A;  2MNY A;  1WES A;  3O7A A;  3ASL A;  4WZ3 B;  2L0B A;  3ZVY A;  3DQV R;  3PUQ A;  5B77 A;  4YBT A;  2YSJ A;  1DVP A;  2YHO A;  2YYR A;  3SHB A;  4N3W A;  2G6Q A;  2KIZ A;  4A4B A;  4BHW A;  3PHD A;  3KNV A;  4MVT A;  5C11 A;  5FER A;  1WEM A;  3O34 A;  5DIN A;  4B86 C;  2K16 A;  3RPG B;  3N9N A;  2LGK A;  5TRB A;  2CT2 A;  3SOX A;  3IHP A;  1WEP A;  2QIC A;  4FIP A;  4R2Y A;  1WEV A;  2F42 A;  5H1T A;  4B7Y C;  2MA5 A;  5FB0 A;  2L80 A;  2JMI A;  4ZUX U;  1MM2 A;  3HCT A;  2YW8 A;  2ECT A;  4IC3 A;  4FJC A;  4LJN A;  2FUI A;  2ECJ A;  2PUY A;  1U6G B;  5B76 A;  2EGP A;  2LQ6 A;  2YSM A;  2D8S A;  5B75 A;  2BAY A;  2M3H A;  1WEW A;  4TKP B;  4GNE A;  5H1U A;  2KRE A;  2DX8 A;  2KR4 A;  4R7E A;  2E6S A;  2EOD A;  1IYM A;  3GL6 A;  2AN6 A;  2G43 A;  2KWO A;  3C6W A;  4R8P K;  2CSY A;  3U5O A;  1HYJ A;  4YAD A;  2VJF A;  3O70 A;  3QZV A;  4A49 A;  2HYE D;  4LK9 A;  3N9O A;  4S3O B;  3V43 A;  1E4U A;  4GND A;  3I2D A;  2KGI A;  2MT5 A;  5KH7 A;  1T1H A;  1WGM A;  3ZPV 1;  2Y43 A;  5H1V A;  2VJE B;  3KQI A;  1X4J A;  1VFY A;  4QF3 A;  4V3L C;  2KFT A;  4QF2 A;  3U5N A;  5DKA A;  3M63 A;  3LQH A;  5LKX A;  1LDJ B;  5D1K B;  4UP5 A;  5JG6 A;  1JM7 B;  2NAA A;  4YAB A;  4GNF A;  5TDR A;  2K4D A;  3N9M A;  5H9M A;  5LKU A;  5LKT A;  3O37 A;  3ZPV E;  4AUQ B;  1WEQ A;  5J3X A;  2MUM A;  5KH3 A;  2L43 A;  2KWN A;  5FEY A;  2CKL B;  2MD8 C;  4UI9 B;  3EB6 A;  2G45 A;  2YUR A;  2ECW A;  1WIL A;  3L1Z B;  2Y1M A;  2JMJ A;  3HCU A;  1CHC A;  4ZQL A;  2LGL A;  3RTR B;  4AYC B;  1RMD A;  2KWK A;  2YRE A;  1VD4 A;  1V87 A;  4YAT A;  1WEO A;  4YBM A;  4GB0 A;  2E6R A;  1F62 A;  3M99 A;  2PNX A;  2JMD A;  3SOW A;  2C2V S;  1G25 A;  4IC2 A;  3HTK C;  1ZBD B;  4LLB A;  2M85 A;  3VK6 A;  4WZ2 A;  4F52 B;  4A4C A;  1Z2Q A;  3KV5 A;  1Z6U A;  1WIM A;  2VPE A;  4N4F A;  5TBN A;  2CSZ A;  1X4I A;  2KYU A;  1WE9 A;  3N9P A;  5LKZ A;  2LXP C;  2I50 A;  2RSD A;  4BBQ A;  1Z60 A;  3M62 A;  4PTB A;  4I7B A;  2YT5 A;  3O33 A;  2VNF A;  5G05 B;  3SOU A;  3T7L A;  4LAD B;  2F6N A;  2JRJ A;  3MHS A;  3FL2 A;  2M1R A;  2YU4 A;  4AP4 A;  4L7X A;  3ZNI A;  4FO9 A;  3DPL R;  3NG2 A;  2UZG A;  2LXH C;  4L58 A;  1FBV A;  5LCW B;  3HCS A;  5D1L B;  3C5K A;  2MNZ A;  2ZET C;  1VYX A;  1JM7 A;  4O64 A;  2LN0 A;  3ZTG A;  2H0D B;  2YQM A;  2LGG A;  3O35 A;  5KH9 A;  3ZYQ A;  5AIU A;  3RPG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...