2ECTA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of ring finger protein 126
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein 126
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of RING finger protein 126
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 5
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ectA00
4AUQB 2EGPA 4FIPA 5C13A 2KYUA 4V3LC 5J3XA 3O7AA 2LGVA 4YABA 4WZ0A 2YURA 2Y43A 4UP0A 5AITA 5D1MB 3FL2A 3VK6A 2LRIC 2YSMA 4V3KC 4I7CA 2MT5A 2LDRA 5B79A 3O35A 1WEPA 2D8SA 2M6MA 4NN2A 5H1UA 2ECTA 4IC3A 3HTKC 2ECWA 2L0BA 4GB0A 1X4JA 2L75A 3KNVA 4N3WA 4S3OB 5G05B 2G6QA 2DX8A 5DKAA 3GV4A 2K17A 1HYIA 4WZ2A 2YREA 2CSZA 3O37A 4W4UA 2MD7B 4BHWA 1WEWA 2FUUA 3ZVZB 1JOCA 5G0FA 4GNFA 4WZ3B 1RMDA 2EA6A 2MNZA 2OXQC 2VJFB 1T1HA 4ZDTA 2KWOA 2LXHC 1N87A 5KH7A 2MIQA 3KQIA 1F62A 2CKLB 2L43A 1X4IA 4L58A 2Y1NA 2AN6A 5H1VA 3N9LA 4QF2A 2H0DA 4FJCA 2MD8C 2PNXA 1JM7A 3RPGC 2LGLA 4CA1A 2MA6A 4R2YA 2G45A 2QIZA 1WE9A 3SOUA 4N4FA 5TABA 2M1RA 5LKUA 3ZPVE 4UI9B 4MVTA 2VPBA 4CCGX 3M99A 3M63A 4A49A 2ECNA 2KGGA 3PUQA 2QICA 4BBQA 5B76A 2KWNA 2FUIA 3LQJA 3GL6A 1V87A 4YBSA 4FO9A 4X3GA 2YHNA 1WEQA 4TKPB 2L5UA 2Y1MA 2E6RA 4AYCB 3V43A 4GNGA 2F6JA 3ZTGA 4I7BA 3U5PA 2C2LA 2VJEB 4L7XA 5LCWB 4XI1A 4LKAA 3DQVR 3DPLR 2MUMA 3ZYQA 2BAYA 4A4BA 2JMIA 5D1KB 5FB0A 4P5OB 2K1JA 3L11A 2FSAA 1MM3A 1IYMA 4C9ZA 2LV9A 3LQIA 1WEMA 1WESA 4LLBA 4QF3A 2CT2A 2HDPA 2JMJA 2K4DA 2K16A 3QZVA 2KWKA 2YHOA 3MHSA 3LQHA 1XWHA 2KU3A 5B8DA 1VYXA 1G25A 3HCTA 2KREA 3O33A 3L1XA 1WEUA 4UP5A 4YAXA 1E4UA 2L80A 1FP0A 2VP7A 2LGKA 3U5MA 2ECVA 3ASLA 3N9PA 2YQLA 3U5OA 2KIZA 1BORA 4O64A 3IHPA 2LN0A 2IDAA 2LXPC 2PUYA 1VFYA 4WA6A 2VJFA 2YT5A 5H1TA 4GNEA 4R8PK 2M3HA 4LJNA 2YUCA 4F52B 4MSXA 2CKLA 2E6SA 4LADB 4ZUXU 2I50A 3N9NA 3ZVYA 5JG6A 3PHDA 3HCUA 5I3LA 4GNDA 2ECIA 2YYRA 2ECGA 3LRQA 2CSYA 3RTRB 1ZBDB 2VNFA 2VPGA 5LKXA 4AVXA 1X4UA 1Z60A 2G43A 4YBTA 1WENA 3PURA 2F42A 4I7DA 5D1LB 3ZPV1 4B7YC 5TDRA 3L1ZB 5H9MA 3O70A 5G04B 3T6RA 1DVPA 2EODA 5TDWA 3T7LA 5B78A 2ECJA 2RSDA 3C5KA 2LQ6A 4YC9A 1CHCA 5TBNA 5C11A 4AYCA 3KV6A 2YU4A 3HCSA 5FB1A 2VJEA 1WGMA 2F6NA 4R7EA 4ZQLA 3ZNIA 4A4CA 4A0CD 4Q6FA 2KR4A 2KWJA 2VPDA 3KV5A 5FERA 2M85A 1WEOA 3C6WA 3M62A 1HYJA 2HYED 5FEYA 4S3OC 2XEUA 3NG2A 3SOWA 1LDJB 5EYAF 1WFKA 3O36A 1Z2QA 4B86C 5KH9A 1Z6UA 4YADA 5AIUA 5KH3A 4YATA 3N9QA 1WEVA 2JMDA 5LKTA 2H0DB 5TRBA 2VPEA 4AP4A 4YBMA 1JM7B 3N9MA 5DINA 2MNYA 4PTBA 2ZETC 2KFTA 4PPEA 2KGIA 1K2FA 2C2VS 3EB5A 2XB1A 3EB6A 3I2DA 3O34A 4FK5A 3SHBA 2RI7A 3RPGB 2YSJA 2NAAA 1VD4A 2YW8A 2LGGA 2QJ0A 2MA5A 1WIMA 1FBVA 1WEEA 3MHHA 4LK9A 1LDKC 3SOXA 3U5NA 3N9OA 2YQMA 4IC2A 5B77A 5LKZA 2JRJA 1WILA 5B75A 2KE1A 2UZGA 1U6GB 1MM2A
chains in the Genus database with same CATH superfamily
4AUQB 2EGPA 4FIPA 5C13A 2KYUA 4V3LC 5J3XA 3FAOA 3O7AA 2LGVA 4YABA 4WZ0A 2YURA 2Y43A 4UP0A 5AITA 5SVIB 5D1MB 3FL2A 3VK6A 2LRIC 2YSMA 4V3KC 3O47A 4I7CA 2MT5A 2FD4A 2LDRA 5B79A 3O35A 1WEPA 2D8SA 2M6MA 4NN2A 2FFWA 5H1UA 2ECTA 2DSMA 4IC3A 3HTKC 2ECWA 2L0BA 4GB0A 1X4JA 3LVQE 2L75A 3KNVA 4N3WA 4S3OB 5G05B 2G6QA 2DX8A 4QQ4A 5DKAA 2IQJA 3GV4A 2XP0A 2K17A 1HYIA 4WZ2A 2YREA 2CSZA 3O37A 4W4UA 2MD7B 4BHWA 1WEWA 2FUUA 3ZVZB 1JOCA 5G0FA 4GNFA 4WZ3B 1RMDA 2EA6A 2MNZA 2L7PA 2OXQC 2VJFB 2M13A 2XOCA 1T1HA 4ZDTA 2KWOA 2LXHC 1N87A 5KH7A 2MIQA 3KQIA 1F62A 2CKLB 2YVRA 2L43A 1X4IA 4L58A 2Y1NA 2AN6A 5H1VA 3N9LA 4QF2A 2H0DA 4FJCA 2MD8C 2PNXA 2EGMA 1JM7A 2E61A 3RPGC 2LGLA 3PLWA 4CA1A 3FEHA 2MA6A 3M7KA 2DJAA 4R2YA 2G45A 2QIZA 1WE9A 3SOUA 3FJUB 4N4FA 5TABA 2M1RA 5LKUA 3ZPVE 4UI9B 4MVTA 2VPBA 4CCGX 3M99A 3M63A 4A49A 2ECNA 2KGGA 3PUQA 2QICA 4BBQA 5B76A 2KWNA 2FUIA 3LQJA 3GL6A 1V87A 3LDYA 4YBSA 4FO9A 2OWAA 3KDEC 4X3GA 2YHNA 1WEQA 2MKEA 4TKPB 2D8UA 2L5UA 2Y1MA 2E6RA 4AYCB 3V43A 4GNGA 2F6JA 3ZTGA 4I7BA 3DWDA 3H7HA 3U5PA 2C2LA 2VJEB 4L7XA 2KKYA 5LCWB 4Z0RA 4XI1A 4LKAA 3DQVR 3DPLR 2MUMA 3ZYQA 2BAYA 4A4BA 2JMIA 5D1KB 2LAUA 5FB0A 4P5OB 2K1JA 3L11A 2FSAA 1MM3A 1IYMA 4C9ZA 2LV9A 3LQIA 1WEMA 1WESA 4LLBA 4Z0OA 5SVIA 4QF3A 2CT2A 2HDPA 2JMJA 2K4DA 2K16A 3QZVA 2KWKA 2YHOA 3MHSA 3LQHA 1XWHA 3MDBC 2KU3A 5B8DA 1VYXA 1G25A 3HCTA 2KREA 3O33A 3L1XA 1WEUA 4UP5A 4YAXA 1E4UA 2L80A 1FP0A 3DDTA 2CSVA 2VP7A 2LGKA 3U5MA 2ECVA 3ASLA 3N9PA 2YQLA 3U5OA 2JUNA 2KIZA 1BORA 4O64A 3IHPA 2LN0A 2IDAA 2LXPC 5K3QA 2PUYA 1VFYA 4WA6A 5SVYA 2VJFA 2YT5A 5H1TA 4GNEA 4R8PK 2M3HA 4LJNA 2YUCA 4F52B 4MSXA 2CKLA 2E6SA 4LADB 4ZUXU 2I50A 2JM3A 3N9NA 3ZVYA 5JG6A 3PHDA 3HCUA 5I3LA 4GNDA 2ECIA 1MBMA 2YYRA 2ECGA 3LRQA 3Q1DA 2CSYA 3RTRB 1ZBDB 2VNFA 2CRRA 2VPGA 2EXUA 5LKXA 4AVXA 1X4UA 4OGCA 1Z60A 4OGEA 2G43A 4YBTA 1WENA 3PURA 2F42A 3E2DA 4I7DA 5D1LB 3ZPV1 2B0OE 4B7YC 5TDRA 3L1ZB 5H9MA 3O70A 5G04B 3T6RA 1DVPA 2EODA 3LJUX 5TDWA 3T7LA 5B78A 2ECJA 2RSDA 3C5KA 4H9DA 2LQ6A 3T9KA 4YC9A 2XOYA 1CHCA 5TBNA 5C11A 4AYCA 3KV6A 2YU4A 3HCSA 5FB1A 2VJEA 1WGMA 2F6NA 4R7EA 4ZQLA 3FM8C 3ZNIA 4A4CA 4A0CD 4Q6FA 2KR4A 2KWJA 2VPDA 3KV5A 5FERA 2M85A 1WEOA 3C6WA 3M62A 1HYJA 2HYED 5FEYA 4S3OC 2XEUA 3NG2A 2XOZA 3SOWA 1LDJB 5EYAF 1WFKA 3O36A 1Z2QA 4B86C 5KH9A 1Z6UA 4YADA 5AIUA 5KH3A 2CRWA 4YATA 3N9QA 1WEVA 2JMDA 5SVXA 5LKTA 2H0DB 5TRBA 2VPEA 2RR4A 4AP4A 3JUEA 4YBMA 4O62A 1JM7B 3N9MA 2P57A 5DINA 2MNYA 4PTBA 2ZETC 2KFTA 4PPEA 2KGIA 3LVRE 1K2FA 2C2VS 3EB5A 2XB1A 3EB6A 3I2DA 3O34A 4FK5A 3SHBA 2RI7A 3RPGB 1DCQA 2YSJA 2NAAA 1VD4A 2YW8A 2LGGA 2QJ0A 2MA5A 3SUBA 1WIMA 1FBVA 1WEEA 3MHHA 4LK9A 2KKXA 1LDKC 3SOXA 3U5NA 3N9OA 2YQMA 4IC2A 5B77A 5LKZA 2JRJA 1WILA 3FANA 2CONA 5B75A 2KE1A 2UZGA 1U6GB 1MM2A 4F1PA
chains in the Genus database with same CATH topology
4AUQB 2EGPA 4FIPA 5C13A 2KYUA 4V3LC 5J3XA 3O7AA 2LGVA 4YABA 4WZ0A 2YURA 2Y43A 4UP0A 5AITA 5D1MB 3FL2A 3VK6A 2LRIC 2YSMA 4V3KC 4I7CA 2MT5A 2LDRA 5B79A 3O35A 1WEPA 2D8SA 2M6MA 4NN2A 5H1UA 2ECTA 4IC3A 3HTKC 2ECWA 2L0BA 4GB0A 1X4JA 2L75A 3KNVA 4N3WA 4S3OB 5G05B 2G6QA 2DX8A 5DKAA 3GV4A 2K17A 1HYIA 4WZ2A 2YREA 2CSZA 3O37A 4W4UA 2MD7B 4BHWA 1WEWA 2FUUA 3ZVZB 1JOCA 5G0FA 4GNFA 4WZ3B 1RMDA 2EA6A 2MNZA 2OXQC 2VJFB 1T1HA 4ZDTA 2KWOA 2LXHC 1N87A 5KH7A 2MIQA 3KQIA 1F62A 2CKLB 2L43A 1X4IA 4L58A 2Y1NA 2AN6A 5H1VA 3N9LA 4QF2A 2H0DA 4FJCA 2MD8C 2PNXA 1JM7A 3RPGC 2LGLA 4CA1A 2MA6A 4R2YA 2G45A 2QIZA 1WE9A 3SOUA 4N4FA 5TABA 2M1RA 5LKUA 3ZPVE 4UI9B 4MVTA 2VPBA 4CCGX 3M99A 3M63A 4A49A 2ECNA 2KGGA 3PUQA 2QICA 4BBQA 5B76A 2KWNA 2FUIA 3LQJA 3GL6A 1V87A 4YBSA 4FO9A 4X3GA 2YHNA 1WEQA 4TKPB 2L5UA 2Y1MA 2E6RA 4AYCB 3V43A 4GNGA 2F6JA 3ZTGA 4I7BA 3U5PA 2C2LA 2VJEB 4L7XA 5LCWB 4XI1A 4LKAA 3DQVR 3DPLR 2MUMA 3ZYQA 2BAYA 4A4BA 2JMIA 5D1KB 5FB0A 4P5OB 2K1JA 3L11A 2FSAA 1MM3A 1IYMA 4C9ZA 2LV9A 3LQIA 1WEMA 1WESA 4LLBA 4QF3A 2CT2A 2HDPA 2JMJA 2K4DA 2K16A 3QZVA 2KWKA 2YHOA 3MHSA 3LQHA 1XWHA 2KU3A 5B8DA 1VYXA 1G25A 3HCTA 2KREA 3O33A 3L1XA 1WEUA 4UP5A 4YAXA 1E4UA 2L80A 1FP0A 2VP7A 2LGKA 3U5MA 2ECVA 3ASLA 3N9PA 2YQLA 3U5OA 2KIZA 1BORA 4O64A 3IHPA 2LN0A 2IDAA 2LXPC 2PUYA 1VFYA 4WA6A 2VJFA 2YT5A 5H1TA 4GNEA 4R8PK 2M3HA 4LJNA 2YUCA 4F52B 4MSXA 2CKLA 2E6SA 4LADB 4ZUXU 2I50A 3N9NA 3ZVYA 5JG6A 3PHDA 3HCUA 5I3LA 4GNDA 2ECIA 2YYRA 2ECGA 3LRQA 2CSYA 3RTRB 1ZBDB 2VNFA 2VPGA 5LKXA 4AVXA 1X4UA 1Z60A 2G43A 4YBTA 1WENA 3PURA 2F42A 4I7DA 5D1LB 3ZPV1 4B7YC 5TDRA 3L1ZB 5H9MA 3O70A 5G04B 3T6RA 1DVPA 2EODA 5TDWA 3T7LA 5B78A 2ECJA 2RSDA 3C5KA 2LQ6A 4YC9A 1CHCA 5TBNA 5C11A 4AYCA 3KV6A 2YU4A 3HCSA 5FB1A 2VJEA 1WGMA 2F6NA 4R7EA 4ZQLA 3ZNIA 4A4CA 4A0CD 4Q6FA 2KR4A 2KWJA 2VPDA 3KV5A 5FERA 2M85A 1WEOA 3C6WA 3M62A 1HYJA 2HYED 5FEYA 4S3OC 2XEUA 3NG2A 3SOWA 1LDJB 5EYAF 1WFKA 3O36A 1Z2QA 4B86C 5KH9A 1Z6UA 4YADA 5AIUA 5KH3A 4YATA 3N9QA 1WEVA 2JMDA 5LKTA 2H0DB 5TRBA 2VPEA 4AP4A 4YBMA 1JM7B 3N9MA 5DINA 2MNYA 4PTBA 2ZETC 2KFTA 4PPEA 2KGIA 1K2FA 2C2VS 3EB5A 2XB1A 3EB6A 3I2DA 3O34A 4FK5A 3SHBA 2RI7A 3RPGB 2YSJA 2NAAA 1VD4A 2YW8A 2LGGA 2QJ0A 2MA5A 1WIMA 1FBVA 1WEEA 3MHHA 4LK9A 1LDKC 3SOXA 3U5NA 3N9OA 2YQMA 4IC2A 5B77A 5LKZA 2JRJA 1WILA 5B75A 2KE1A 2UZGA 1U6GB 1MM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUQ B;  2EGP A;  4FIP A;  5C13 A;  2KYU A;  4V3L C;  5J3X A;  3O7A A;  2LGV A;  4YAB A;  4WZ0 A;  2YUR A;  2Y43 A;  4UP0 A;  5AIT A;  5D1M B;  3FL2 A;  3VK6 A;  2LRI C;  2YSM A;  4V3K C;  4I7C A;  2MT5 A;  2LDR A;  5B79 A;  3O35 A;  1WEP A;  2D8S A;  2M6M A;  4NN2 A;  5H1U A;  2ECT A;  4IC3 A;  3HTK C;  2ECW A;  2L0B A;  4GB0 A;  1X4J A;  2L75 A;  3KNV A;  4N3W A;  4S3O B;  5G05 B;  2G6Q A;  2DX8 A;  5DKA A;  3GV4 A;  2K17 A;  1HYI A;  4WZ2 A;  2YRE A;  2CSZ A;  3O37 A;  4W4U A;  2MD7 B;  4BHW A;  1WEW A;  2FUU A;  3ZVZ B;  1JOC A;  5G0F A;  4GNF A;  4WZ3 B;  1RMD A;  2EA6 A;  2MNZ A;  2OXQ C;  2VJF B;  1T1H A;  4ZDT A;  2KWO A;  2LXH C;  1N87 A;  5KH7 A;  2MIQ A;  3KQI A;  1F62 A;  2CKL B;  2L43 A;  1X4I A;  4L58 A;  2Y1N A;  2AN6 A;  5H1V A;  3N9L A;  4QF2 A;  2H0D A;  4FJC A;  2MD8 C;  2PNX A;  1JM7 A;  3RPG C;  2LGL A;  4CA1 A;  2MA6 A;  4R2Y A;  2G45 A;  2QIZ A;  1WE9 A;  3SOU A;  4N4F A;  5TAB A;  2M1R A;  5LKU A;  3ZPV E;  4UI9 B;  4MVT A;  2VPB A;  4CCG X;  3M99 A;  3M63 A;  4A49 A;  2ECN A;  2KGG A;  3PUQ A;  2QIC A;  4BBQ A;  5B76 A;  2KWN A;  2FUI A;  3LQJ A;  3GL6 A;  1V87 A;  4YBS A;  4FO9 A;  4X3G A;  2YHN A;  1WEQ A;  4TKP B;  2L5U A;  2Y1M A;  2E6R A;  4AYC B;  3V43 A;  4GNG A;  2F6J A;  3ZTG A;  4I7B A;  3U5P A;  2C2L A;  2VJE B;  4L7X A;  5LCW B;  4XI1 A;  4LKA A;  3DQV R;  3DPL R;  2MUM A;  3ZYQ A;  2BAY A;  4A4B A;  2JMI A;  5D1K B;  5FB0 A;  4P5O B;  2K1J A;  3L11 A;  2FSA A;  1MM3 A;  1IYM A;  4C9Z A;  2LV9 A;  3LQI A;  1WEM A;  1WES A;  4LLB A;  4QF3 A;  2CT2 A;  2HDP A;  2JMJ A;  2K4D A;  2K16 A;  3QZV A;  2KWK A;  2YHO A;  3MHS A;  3LQH A;  1XWH A;  2KU3 A;  5B8D A;  1VYX A;  1G25 A;  3HCT A;  2KRE A;  3O33 A;  3L1X A;  1WEU A;  4UP5 A;  4YAX A;  1E4U A;  2L80 A;  1FP0 A;  2VP7 A;  2LGK A;  3U5M A;  2ECV A;  3ASL A;  3N9P A;  2YQL A;  3U5O A;  2KIZ A;  1BOR A;  4O64 A;  3IHP A;  2LN0 A;  2IDA A;  2LXP C;  2PUY A;  1VFY A;  4WA6 A;  2VJF A;  2YT5 A;  5H1T A;  4GNE A;  4R8P K;  2M3H A;  4LJN A;  2YUC A;  4F52 B;  4MSX A;  2CKL A;  2E6S A;  4LAD B;  4ZUX U;  2I50 A;  3N9N A;  3ZVY A;  5JG6 A;  3PHD A;  3HCU A;  5I3L A;  4GND A;  2ECI A;  2YYR A;  2ECG A;  3LRQ A;  2CSY A;  3RTR B;  1ZBD B;  2VNF A;  2VPG A;  5LKX A;  4AVX A;  1X4U A;  1Z60 A;  2G43 A;  4YBT A;  1WEN A;  3PUR A;  2F42 A;  4I7D A;  5D1L B;  3ZPV 1;  4B7Y C;  5TDR A;  3L1Z B;  5H9M A;  3O70 A;  5G04 B;  3T6R A;  1DVP A;  2EOD A;  5TDW A;  3T7L A;  5B78 A;  2ECJ A;  2RSD A;  3C5K A;  2LQ6 A;  4YC9 A;  1CHC A;  5TBN A;  5C11 A;  4AYC A;  3KV6 A;  2YU4 A;  3HCS A;  5FB1 A;  2VJE A;  1WGM A;  2F6N A;  4R7E A;  4ZQL A;  3ZNI A;  4A4C A;  4A0C D;  4Q6F A;  2KR4 A;  2KWJ A;  2VPD A;  3KV5 A;  5FER A;  2M85 A;  1WEO A;  3C6W A;  3M62 A;  1HYJ A;  2HYE D;  5FEY A;  4S3O C;  2XEU A;  3NG2 A;  3SOW A;  1LDJ B;  5EYA F;  1WFK A;  3O36 A;  1Z2Q A;  4B86 C;  5KH9 A;  1Z6U A;  4YAD A;  5AIU A;  5KH3 A;  4YAT A;  3N9Q A;  1WEV A;  2JMD A;  5LKT A;  2H0D B;  5TRB A;  2VPE A;  4AP4 A;  4YBM A;  1JM7 B;  3N9M A;  5DIN A;  2MNY A;  4PTB A;  2ZET C;  2KFT A;  4PPE A;  2KGI A;  1K2F A;  2C2V S;  3EB5 A;  2XB1 A;  3EB6 A;  3I2D A;  3O34 A;  4FK5 A;  3SHB A;  2RI7 A;  3RPG B;  2YSJ A;  2NAA A;  1VD4 A;  2YW8 A;  2LGG A;  2QJ0 A;  2MA5 A;  1WIM A;  1FBV A;  1WEE A;  3MHH A;  4LK9 A;  1LDK C;  3SOX A;  3U5N A;  3N9O A;  2YQM A;  4IC2 A;  5B77 A;  5LKZ A;  2JRJ A;  1WIL A;  5B75 A;  2KE1 A;  2UZG A;  1U6G B;  1MM2 A; 
#chains in the Genus database with same CATH topology
 4AUQ B;  2EGP A;  4FIP A;  5C13 A;  2KYU A;  4V3L C;  5J3X A;  3FAO A;  3O7A A;  2LGV A;  4YAB A;  4WZ0 A;  2YUR A;  2Y43 A;  4UP0 A;  5AIT A;  5SVI B;  5D1M B;  3FL2 A;  3VK6 A;  2LRI C;  2YSM A;  4V3K C;  3O47 A;  4I7C A;  2MT5 A;  2FD4 A;  2LDR A;  5B79 A;  3O35 A;  1WEP A;  2D8S A;  2M6M A;  4NN2 A;  2FFW A;  5H1U A;  2ECT A;  2DSM A;  4IC3 A;  3HTK C;  2ECW A;  2L0B A;  4GB0 A;  1X4J A;  3LVQ E;  2L75 A;  3KNV A;  4N3W A;  4S3O B;  5G05 B;  2G6Q A;  2DX8 A;  4QQ4 A;  5DKA A;  2IQJ A;  3GV4 A;  2XP0 A;  2K17 A;  1HYI A;  4WZ2 A;  2YRE A;  2CSZ A;  3O37 A;  4W4U A;  2MD7 B;  4BHW A;  1WEW A;  2FUU A;  3ZVZ B;  1JOC A;  5G0F A;  4GNF A;  4WZ3 B;  1RMD A;  2EA6 A;  2MNZ A;  2L7P A;  2OXQ C;  2VJF B;  2M13 A;  2XOC A;  1T1H A;  4ZDT A;  2KWO A;  2LXH C;  1N87 A;  5KH7 A;  2MIQ A;  3KQI A;  1F62 A;  2CKL B;  2YVR A;  2L43 A;  1X4I A;  4L58 A;  2Y1N A;  2AN6 A;  5H1V A;  3N9L A;  4QF2 A;  2H0D A;  4FJC A;  2MD8 C;  2PNX A;  2EGM A;  1JM7 A;  2E61 A;  3RPG C;  2LGL A;  3PLW A;  4CA1 A;  3FEH A;  2MA6 A;  3M7K A;  2DJA A;  4R2Y A;  2G45 A;  2QIZ A;  1WE9 A;  3SOU A;  3FJU B;  4N4F A;  5TAB A;  2M1R A;  5LKU A;  3ZPV E;  4UI9 B;  4MVT A;  2VPB A;  4CCG X;  3M99 A;  3M63 A;  4A49 A;  2ECN A;  2KGG A;  3PUQ A;  2QIC A;  4BBQ A;  5B76 A;  2KWN A;  2FUI A;  3LQJ A;  3GL6 A;  1V87 A;  3LDY A;  4YBS A;  4FO9 A;  2OWA A;  3KDE C;  4X3G A;  2YHN A;  1WEQ A;  2MKE A;  4TKP B;  2D8U A;  2L5U A;  2Y1M A;  2E6R A;  4AYC B;  3V43 A;  4GNG A;  2F6J A;  3ZTG A;  4I7B A;  3DWD A;  3H7H A;  3U5P A;  2C2L A;  2VJE B;  4L7X A;  2KKY A;  5LCW B;  4Z0R A;  4XI1 A;  4LKA A;  3DQV R;  3DPL R;  2MUM A;  3ZYQ A;  2BAY A;  4A4B A;  2JMI A;  5D1K B;  2LAU A;  5FB0 A;  4P5O B;  2K1J A;  3L11 A;  2FSA A;  1MM3 A;  1IYM A;  4C9Z A;  2LV9 A;  3LQI A;  1WEM A;  1WES A;  4LLB A;  4Z0O A;  5SVI A;  4QF3 A;  2CT2 A;  2HDP A;  2JMJ A;  2K4D A;  2K16 A;  3QZV A;  2KWK A;  2YHO A;  3MHS A;  3LQH A;  1XWH A;  3MDB C;  2KU3 A;  5B8D A;  1VYX A;  1G25 A;  3HCT A;  2KRE A;  3O33 A;  3L1X A;  1WEU A;  4UP5 A;  4YAX A;  1E4U A;  2L80 A;  1FP0 A;  3DDT A;  2CSV A;  2VP7 A;  2LGK A;  3U5M A;  2ECV A;  3ASL A;  3N9P A;  2YQL A;  3U5O A;  2JUN A;  2KIZ A;  1BOR A;  4O64 A;  3IHP A;  2LN0 A;  2IDA A;  2LXP C;  5K3Q A;  2PUY A;  1VFY A;  4WA6 A;  5SVY A;  2VJF A;  2YT5 A;  5H1T A;  4GNE A;  4R8P K;  2M3H A;  4LJN A;  2YUC A;  4F52 B;  4MSX A;  2CKL A;  2E6S A;  4LAD B;  4ZUX U;  2I50 A;  2JM3 A;  3N9N A;  3ZVY A;  5JG6 A;  3PHD A;  3HCU A;  5I3L A;  4GND A;  2ECI A;  1MBM A;  2YYR A;  2ECG A;  3LRQ A;  3Q1D A;  2CSY A;  3RTR B;  1ZBD B;  2VNF A;  2CRR A;  2VPG A;  2EXU A;  5LKX A;  4AVX A;  1X4U A;  4OGC A;  1Z60 A;  4OGE A;  2G43 A;  4YBT A;  1WEN A;  3PUR A;  2F42 A;  3E2D A;  4I7D A;  5D1L B;  3ZPV 1;  2B0O E;  4B7Y C;  5TDR A;  3L1Z B;  5H9M A;  3O70 A;  5G04 B;  3T6R A;  1DVP A;  2EOD A;  3LJU X;  5TDW A;  3T7L A;  5B78 A;  2ECJ A;  2RSD A;  3C5K A;  4H9D A;  2LQ6 A;  3T9K A;  4YC9 A;  2XOY A;  1CHC A;  5TBN A;  5C11 A;  4AYC A;  3KV6 A;  2YU4 A;  3HCS A;  5FB1 A;  2VJE A;  1WGM A;  2F6N A;  4R7E A;  4ZQL A;  3FM8 C;  3ZNI A;  4A4C A;  4A0C D;  4Q6F A;  2KR4 A;  2KWJ A;  2VPD A;  3KV5 A;  5FER A;  2M85 A;  1WEO A;  3C6W A;  3M62 A;  1HYJ A;  2HYE D;  5FEY A;  4S3O C;  2XEU A;  3NG2 A;  2XOZ A;  3SOW A;  1LDJ B;  5EYA F;  1WFK A;  3O36 A;  1Z2Q A;  4B86 C;  5KH9 A;  1Z6U A;  4YAD A;  5AIU A;  5KH3 A;  2CRW A;  4YAT A;  3N9Q A;  1WEV A;  2JMD A;  5SVX A;  5LKT A;  2H0D B;  5TRB A;  2VPE A;  2RR4 A;  4AP4 A;  3JUE A;  4YBM A;  4O62 A;  1JM7 B;  3N9M A;  2P57 A;  5DIN A;  2MNY A;  4PTB A;  2ZET C;  2KFT A;  4PPE A;  2KGI A;  3LVR E;  1K2F A;  2C2V S;  3EB5 A;  2XB1 A;  3EB6 A;  3I2D A;  3O34 A;  4FK5 A;  3SHB A;  2RI7 A;  3RPG B;  1DCQ A;  2YSJ A;  2NAA A;  1VD4 A;  2YW8 A;  2LGG A;  2QJ0 A;  2MA5 A;  3SUB A;  1WIM A;  1FBV A;  1WEE A;  3MHH A;  4LK9 A;  2KKX A;  1LDK C;  3SOX A;  3U5N A;  3N9O A;  2YQM A;  4IC2 A;  5B77 A;  5LKZ A;  2JRJ A;  1WIL A;  3FAN A;  2CON A;  5B75 A;  2KE1 A;  2UZG A;  1U6G B;  1MM2 A;  4F1P A; 
#chains in the Genus database with same CATH homology
 4AUQ B;  2EGP A;  4FIP A;  5C13 A;  2KYU A;  4V3L C;  5J3X A;  3O7A A;  2LGV A;  4YAB A;  4WZ0 A;  2YUR A;  2Y43 A;  4UP0 A;  5AIT A;  5D1M B;  3FL2 A;  3VK6 A;  2LRI C;  2YSM A;  4V3K C;  4I7C A;  2MT5 A;  2LDR A;  5B79 A;  3O35 A;  1WEP A;  2D8S A;  2M6M A;  4NN2 A;  5H1U A;  2ECT A;  4IC3 A;  3HTK C;  2ECW A;  2L0B A;  4GB0 A;  1X4J A;  2L75 A;  3KNV A;  4N3W A;  4S3O B;  5G05 B;  2G6Q A;  2DX8 A;  5DKA A;  3GV4 A;  2K17 A;  1HYI A;  4WZ2 A;  2YRE A;  2CSZ A;  3O37 A;  4W4U A;  2MD7 B;  4BHW A;  1WEW A;  2FUU A;  3ZVZ B;  1JOC A;  5G0F A;  4GNF A;  4WZ3 B;  1RMD A;  2EA6 A;  2MNZ A;  2OXQ C;  2VJF B;  1T1H A;  4ZDT A;  2KWO A;  2LXH C;  1N87 A;  5KH7 A;  2MIQ A;  3KQI A;  1F62 A;  2CKL B;  2L43 A;  1X4I A;  4L58 A;  2Y1N A;  2AN6 A;  5H1V A;  3N9L A;  4QF2 A;  2H0D A;  4FJC A;  2MD8 C;  2PNX A;  1JM7 A;  3RPG C;  2LGL A;  4CA1 A;  2MA6 A;  4R2Y A;  2G45 A;  2QIZ A;  1WE9 A;  3SOU A;  4N4F A;  5TAB A;  2M1R A;  5LKU A;  3ZPV E;  4UI9 B;  4MVT A;  2VPB A;  4CCG X;  3M99 A;  3M63 A;  4A49 A;  2ECN A;  2KGG A;  3PUQ A;  2QIC A;  4BBQ A;  5B76 A;  2KWN A;  2FUI A;  3LQJ A;  3GL6 A;  1V87 A;  4YBS A;  4FO9 A;  4X3G A;  2YHN A;  1WEQ A;  4TKP B;  2L5U A;  2Y1M A;  2E6R A;  4AYC B;  3V43 A;  4GNG A;  2F6J A;  3ZTG A;  4I7B A;  3U5P A;  2C2L A;  2VJE B;  4L7X A;  5LCW B;  4XI1 A;  4LKA A;  3DQV R;  3DPL R;  2MUM A;  3ZYQ A;  2BAY A;  4A4B A;  2JMI A;  5D1K B;  5FB0 A;  4P5O B;  2K1J A;  3L11 A;  2FSA A;  1MM3 A;  1IYM A;  4C9Z A;  2LV9 A;  3LQI A;  1WEM A;  1WES A;  4LLB A;  4QF3 A;  2CT2 A;  2HDP A;  2JMJ A;  2K4D A;  2K16 A;  3QZV A;  2KWK A;  2YHO A;  3MHS A;  3LQH A;  1XWH A;  2KU3 A;  5B8D A;  1VYX A;  1G25 A;  3HCT A;  2KRE A;  3O33 A;  3L1X A;  1WEU A;  4UP5 A;  4YAX A;  1E4U A;  2L80 A;  1FP0 A;  2VP7 A;  2LGK A;  3U5M A;  2ECV A;  3ASL A;  3N9P A;  2YQL A;  3U5O A;  2KIZ A;  1BOR A;  4O64 A;  3IHP A;  2LN0 A;  2IDA A;  2LXP C;  2PUY A;  1VFY A;  4WA6 A;  2VJF A;  2YT5 A;  5H1T A;  4GNE A;  4R8P K;  2M3H A;  4LJN A;  2YUC A;  4F52 B;  4MSX A;  2CKL A;  2E6S A;  4LAD B;  4ZUX U;  2I50 A;  3N9N A;  3ZVY A;  5JG6 A;  3PHD A;  3HCU A;  5I3L A;  4GND A;  2ECI A;  2YYR A;  2ECG A;  3LRQ A;  2CSY A;  3RTR B;  1ZBD B;  2VNF A;  2VPG A;  5LKX A;  4AVX A;  1X4U A;  1Z60 A;  2G43 A;  4YBT A;  1WEN A;  3PUR A;  2F42 A;  4I7D A;  5D1L B;  3ZPV 1;  4B7Y C;  5TDR A;  3L1Z B;  5H9M A;  3O70 A;  5G04 B;  3T6R A;  1DVP A;  2EOD A;  5TDW A;  3T7L A;  5B78 A;  2ECJ A;  2RSD A;  3C5K A;  2LQ6 A;  4YC9 A;  1CHC A;  5TBN A;  5C11 A;  4AYC A;  3KV6 A;  2YU4 A;  3HCS A;  5FB1 A;  2VJE A;  1WGM A;  2F6N A;  4R7E A;  4ZQL A;  3ZNI A;  4A4C A;  4A0C D;  4Q6F A;  2KR4 A;  2KWJ A;  2VPD A;  3KV5 A;  5FER A;  2M85 A;  1WEO A;  3C6W A;  3M62 A;  1HYJ A;  2HYE D;  5FEY A;  4S3O C;  2XEU A;  3NG2 A;  3SOW A;  1LDJ B;  5EYA F;  1WFK A;  3O36 A;  1Z2Q A;  4B86 C;  5KH9 A;  1Z6U A;  4YAD A;  5AIU A;  5KH3 A;  4YAT A;  3N9Q A;  1WEV A;  2JMD A;  5LKT A;  2H0D B;  5TRB A;  2VPE A;  4AP4 A;  4YBM A;  1JM7 B;  3N9M A;  5DIN A;  2MNY A;  4PTB A;  2ZET C;  2KFT A;  4PPE A;  2KGI A;  1K2F A;  2C2V S;  3EB5 A;  2XB1 A;  3EB6 A;  3I2D A;  3O34 A;  4FK5 A;  3SHB A;  2RI7 A;  3RPG B;  2YSJ A;  2NAA A;  1VD4 A;  2YW8 A;  2LGG A;  2QJ0 A;  2MA5 A;  1WIM A;  1FBV A;  1WEE A;  3MHH A;  4LK9 A;  1LDK C;  3SOX A;  3U5N A;  3N9O A;  2YQM A;  4IC2 A;  5B77 A;  5LKZ A;  2JRJ A;  1WIL A;  5B75 A;  2KE1 A;  2UZG A;  1U6G B;  1MM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...