2KKXA

Solution structure of c-terminal domain of reduced nleg2-3 (residues 90-191) from pathogenic e. coli o157:h7. northeast structural genomics consortium and midwest center for structural genomics target et109a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
b'SQESIQNKISQCKFSVCPERLQCPLEAIQCPITLEQPEKGIFVKNSDGSDVCTLFDAAAFSRLVGEGLPHPLTREPITASIIVKHEECIYDDTRGNFIIKGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ECs2156
publication title NleG Type 3 effectors from enterohaemorrhagic Escherichia coli are U-Box E3 ubiquitin ligases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.80 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2kkxA00
2KKXA 2KKYA
chains in the Genus database with same CATH superfamily
3PUQA 4YABA 2LXHC 3KV6A 2YW8A 5C11A 2KE1A 5G0FA 5I3LA 5DKAA 1FBVA 2KYUA 4OGEA 1DVPA 5K3QA 2RI7A 2JMJA 2YREA 2D8UA 4S3OC 5D1KB 2G6QA 3GV4A 1LDKC 2JMDA 1WEUA 4R2YA 1FP0A 3MHHA 3Q1DA 2KU3A 2EA6A 5KH9A 3JUEA 1IYMA 1WE9A 2CONA 3RPGC 2CSZA 1WEWA 4R7EA 2CT2A 4I7DA 4C9ZA 4L7XA 4OGCA 2YHNA 2CSYA 3SOWA 4FIPA 2L5UA 2YYRA 2Y1MA 3FANA 4GNFA 3E2DA 1WEOA 5FB0A 5LKXA 2I50A 5FEYA 2ZETC 2L43A 2LGGA 4TKPB 5H9MA 1JM7A 3PLWA 5DINA 2ECWA 2VJFA 5C13A 4AYCB 4PTBA 4ZQLA 3N9OA 4S3OB 3KV5A 2KFTA 1MM2A 1X4UA 2HYED 4Q6FA 4F52B 2L7PA 2YU4A 1CHCA 1Z2QA 4B86C 5B76A 3FAOA 4WZ2A 2E6RA 2Y43A 4B7YC 2KKYA 3RPGB 3O37A 4QF3A 1VD4A 2FSAA 1WEEA 4UP0A 4YBSA 3ZYQA 2LDRA 3MDBC 1HYIA 3EB5A 4AUQB 3T7LA 2KREA 2OXQC 2G43A 1X4JA 2M13A 4N4FA 4V3LC 2H0DA 2MIQA 1WIMA 4UI9B 2M85A 4QF2A 3FEHA 1E4UA 3O70A 5LCWB 2MD8C 3O36A 1LDJB 4LK9A 2MKEA 4ZDTA 1WFKA 2L80A 4FO9A 2L75A 3N9MA 4A4BA 1WEMA 2IQJA 2MA5A 3N9LA 3IHPA 4GNDA 1WGMA 2FUIA 5KH3A 2B0OE 2FD4A 5KH7A 4YATA 1WEPA 2HDPA 4QQ4A 3O34A 2MA6A 2K1JA 2ECJA 4A4CA 5H1UA 2IDAA 2K17A 5D1LB 4WZ0A 3KDEC 2XEUA 4FJCA 5AITA 5JG6A 4V3KC 2CKLA 2LAUA 3V43A 3LVRE 1V87A 2MNYA 4FK5A 4LJNA 4BBQA 4P5OB 2DX8A 4GB0A 3ZNIA 3HCTA 3N9QA 3SUBA 2KWOA 3ZVZB 4XI1A 4AP4A 3N9PA 3ZVYA 2FFWA 3M63A 2VPBA 4IC2A 2BAYA 3LRQA 2YQMA 1F62A 2VPEA 1JM7B 1X4IA 2VP7A 5TBNA 2DSMA 2UZGA 3SOXA 2KWKA 2JM3A 5TABA 3C5KA 3PURA 4F1PA 3RTRB 5H1VA 3U5MA 4I7CA 2LQ6A 2XOZA 2YHOA 3LQHA 2OWAA 3U5PA 2YSJA 3DWDA 5LKTA 1G25A 3VK6A 4YC9A 2L0BA 3GL6A 2ECTA 3LQJA 2JMIA 2LGVA 5LKZA 1BORA 3DPLR 2JRJA 3L1ZB 3HCUA 2F6JA 5G04B 3L11A 4R8PK 2FUUA 2EGMA 2PNXA 1VFYA 2KGIA 4H9DA 4Z0OA 2C2LA 4O62A 2VPGA 1HYJA 2ECGA 4LKAA 3HCSA 4UP5A 2RSDA 4GNGA 2VJEA 4X3GA 2H0DB 2KWNA 2NAAA 5TDRA 2AN6A 3I2DA 2M1RA 4CA1A 4ZUXU 2LN0A 3FM8C 4L58A 2EGPA 4WZ3B 1Z60A 4YAXA 3ZPV1 2EODA 3QZVA 4N3WA 2QJ0A 5SVIA 2YT5A 3U5OA 2ECNA 4W4UA 5AIUA 2XP0A 2RR4A 1T1HA 2QICA 3SHBA 2DJAA 1MM3A 3LJUX 2M6MA 4MVTA 4LADB 3ASLA 2LV9A 4LLBA 2D8SA 5FB1A 3M7KA 3ZTGA 2KWJA 3SOUA 5SVXA 2JUNA 3O33A 1DCQA 2CKLB 5B79A 2ECIA 4I7BA 3N9NA 2K4DA 3U5NA 5LKUA 1K2FA 3M62A 1U6GB 3M99A 2YUCA 1VYXA 2F42A 1RMDA 4YBTA 3LVQE 2MNZA 4MSXA 2XOYA 2LGLA 2CRRA 2M3HA 5TDWA 1WEQA 1ZBDB 2VJFB 2KIZA 2YQLA 3EB6A 5D1MB 5B78A 1JOCA 3LDYA 2MT5A 4GNEA 3T9KA 3H7HA 3DDTA 5B77A 2F6NA 2PUYA 4IC3A 2Y1NA 5G05B 1MBMA 5EYAF 1Z6UA 3T6RA 2K16A 4AYCA 4WA6A 4NN2A 4CCGX 1WEVA 4Z0RA 3LQIA 4YBMA 3ZPVE 3FJUB 5B75A 2VJEB 3DQVR 2CRWA 2P57A 2VPDA 2E61A 2XOCA 3O35A 2E6SA 2MD7B 2EXUA 3MHSA 3KQIA 3O7AA 5SVYA 4YADA 4PPEA 3PHDA 2LRIC 5TRBA 3C6WA 3L1XA 1WILA 2QIZA 4A49A 2ECVA 2YSMA 5SVIB 1WENA 3NG2A 1XWHA 2G45A 3KNVA 2LXPC 4BHWA 2YURA 2C2VS 1N87A 2LGKA 4O64A 1WESA 2KGGA 5H1TA 4AVXA 3HTKC 5B8DA 3FL2A 5FERA 2XB1A 2KR4A 2MUMA 2VNFA 2KKXA 5J3XA 4A0CD 2YVRA 3O47A 2CSVA
chains in the Genus database with same CATH topology
2FFWA 2MKEA 3E2DA 4Z0RA 5SVIA 3KDEC 2JUNA 5SVIB 3T9KA 3Q1DA 3LVQE 4H9DA 2XOZA 3MDBC 4Z0OA 3H7HA 4O62A 1DCQA 2L7PA 3FJUB 2OWAA 2XP0A 3DDTA 3JUEA 2CRWA 2P57A 3DWDA 2RR4A 2IQJA 2LAUA 2XOYA 2DJAA 3LVRE 2E61A 2XOCA 2CONA 2CRRA 2M13A 3LJUX 2EXUA 3PLWA 2KKYA 4OGEA 5SVYA 5K3QA 2B0OE 2FD4A 3FEHA 3FM8C 2JM3A 4OGCA 2YREA 4QQ4A 2D8UA 3SUBA 3M7KA 2KKXA 4F1PA 3LDYA 2YVRA 5SVXA 3O47A 2EGMA 2CSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKX A;  2KKY A; 
#chains in the Genus database with same CATH topology
 3PUQ A;  4YAB A;  2LXH C;  3KV6 A;  2YW8 A;  5C11 A;  2KE1 A;  5G0F A;  5I3L A;  5DKA A;  1FBV A;  2KYU A;  4OGE A;  1DVP A;  5K3Q A;  2RI7 A;  2JMJ A;  2YRE A;  2D8U A;  4S3O C;  5D1K B;  2G6Q A;  3GV4 A;  1LDK C;  2JMD A;  1WEU A;  4R2Y A;  1FP0 A;  3MHH A;  3Q1D A;  2KU3 A;  2EA6 A;  5KH9 A;  3JUE A;  1IYM A;  1WE9 A;  2CON A;  3RPG C;  2CSZ A;  1WEW A;  4R7E A;  2CT2 A;  4I7D A;  4C9Z A;  4L7X A;  4OGC A;  2YHN A;  2CSY A;  3SOW A;  4FIP A;  2L5U A;  2YYR A;  2Y1M A;  3FAN A;  4GNF A;  3E2D A;  1WEO A;  5FB0 A;  5LKX A;  2I50 A;  5FEY A;  2ZET C;  2L43 A;  2LGG A;  4TKP B;  5H9M A;  1JM7 A;  3PLW A;  5DIN A;  2ECW A;  2VJF A;  5C13 A;  4AYC B;  4PTB A;  4ZQL A;  3N9O A;  4S3O B;  3KV5 A;  2KFT A;  1MM2 A;  1X4U A;  2HYE D;  4Q6F A;  4F52 B;  2L7P A;  2YU4 A;  1CHC A;  1Z2Q A;  4B86 C;  5B76 A;  3FAO A;  4WZ2 A;  2E6R A;  2Y43 A;  4B7Y C;  2KKY A;  3RPG B;  3O37 A;  4QF3 A;  1VD4 A;  2FSA A;  1WEE A;  4UP0 A;  4YBS A;  3ZYQ A;  2LDR A;  3MDB C;  1HYI A;  3EB5 A;  4AUQ B;  3T7L A;  2KRE A;  2OXQ C;  2G43 A;  1X4J A;  2M13 A;  4N4F A;  4V3L C;  2H0D A;  2MIQ A;  1WIM A;  4UI9 B;  2M85 A;  4QF2 A;  3FEH A;  1E4U A;  3O70 A;  5LCW B;  2MD8 C;  3O36 A;  1LDJ B;  4LK9 A;  2MKE A;  4ZDT A;  1WFK A;  2L80 A;  4FO9 A;  2L75 A;  3N9M A;  4A4B A;  1WEM A;  2IQJ A;  2MA5 A;  3N9L A;  3IHP A;  4GND A;  1WGM A;  2FUI A;  5KH3 A;  2B0O E;  2FD4 A;  5KH7 A;  4YAT A;  1WEP A;  2HDP A;  4QQ4 A;  3O34 A;  2MA6 A;  2K1J A;  2ECJ A;  4A4C A;  5H1U A;  2IDA A;  2K17 A;  5D1L B;  4WZ0 A;  3KDE C;  2XEU A;  4FJC A;  5AIT A;  5JG6 A;  4V3K C;  2CKL A;  2LAU A;  3V43 A;  3LVR E;  1V87 A;  2MNY A;  4FK5 A;  4LJN A;  4BBQ A;  4P5O B;  2DX8 A;  4GB0 A;  3ZNI A;  3HCT A;  3N9Q A;  3SUB A;  2KWO A;  3ZVZ B;  4XI1 A;  4AP4 A;  3N9P A;  3ZVY A;  2FFW A;  3M63 A;  2VPB A;  4IC2 A;  2BAY A;  3LRQ A;  2YQM A;  1F62 A;  2VPE A;  1JM7 B;  1X4I A;  2VP7 A;  5TBN A;  2DSM A;  2UZG A;  3SOX A;  2KWK A;  2JM3 A;  5TAB A;  3C5K A;  3PUR A;  4F1P A;  3RTR B;  5H1V A;  3U5M A;  4I7C A;  2LQ6 A;  2XOZ A;  2YHO A;  3LQH A;  2OWA A;  3U5P A;  2YSJ A;  3DWD A;  5LKT A;  1G25 A;  3VK6 A;  4YC9 A;  2L0B A;  3GL6 A;  2ECT A;  3LQJ A;  2JMI A;  2LGV A;  5LKZ A;  1BOR A;  3DPL R;  2JRJ A;  3L1Z B;  3HCU A;  2F6J A;  5G04 B;  3L11 A;  4R8P K;  2FUU A;  2EGM A;  2PNX A;  1VFY A;  2KGI A;  4H9D A;  4Z0O A;  2C2L A;  4O62 A;  2VPG A;  1HYJ A;  2ECG A;  4LKA A;  3HCS A;  4UP5 A;  2RSD A;  4GNG A;  2VJE A;  4X3G A;  2H0D B;  2KWN A;  2NAA A;  5TDR A;  2AN6 A;  3I2D A;  2M1R A;  4CA1 A;  4ZUX U;  2LN0 A;  3FM8 C;  4L58 A;  2EGP A;  4WZ3 B;  1Z60 A;  4YAX A;  3ZPV 1;  2EOD A;  3QZV A;  4N3W A;  2QJ0 A;  5SVI A;  2YT5 A;  3U5O A;  2ECN A;  4W4U A;  5AIU A;  2XP0 A;  2RR4 A;  1T1H A;  2QIC A;  3SHB A;  2DJA A;  1MM3 A;  3LJU X;  2M6M A;  4MVT A;  4LAD B;  3ASL A;  2LV9 A;  4LLB A;  2D8S A;  5FB1 A;  3M7K A;  3ZTG A;  2KWJ A;  3SOU A;  5SVX A;  2JUN A;  3O33 A;  1DCQ A;  2CKL B;  5B79 A;  2ECI A;  4I7B A;  3N9N A;  2K4D A;  3U5N A;  5LKU A;  1K2F A;  3M62 A;  1U6G B;  3M99 A;  2YUC A;  1VYX A;  2F42 A;  1RMD A;  4YBT A;  3LVQ E;  2MNZ A;  4MSX A;  2XOY A;  2LGL A;  2CRR A;  2M3H A;  5TDW A;  1WEQ A;  1ZBD B;  2VJF B;  2KIZ A;  2YQL A;  3EB6 A;  5D1M B;  5B78 A;  1JOC A;  3LDY A;  2MT5 A;  4GNE A;  3T9K A;  3H7H A;  3DDT A;  5B77 A;  2F6N A;  2PUY A;  4IC3 A;  2Y1N A;  5G05 B;  1MBM A;  5EYA F;  1Z6U A;  3T6R A;  2K16 A;  4AYC A;  4WA6 A;  4NN2 A;  4CCG X;  1WEV A;  4Z0R A;  3LQI A;  4YBM A;  3ZPV E;  3FJU B;  5B75 A;  2VJE B;  3DQV R;  2CRW A;  2P57 A;  2VPD A;  2E61 A;  2XOC A;  3O35 A;  2E6S A;  2MD7 B;  2EXU A;  3MHS A;  3KQI A;  3O7A A;  5SVY A;  4YAD A;  4PPE A;  3PHD A;  2LRI C;  5TRB A;  3C6W A;  3L1X A;  1WIL A;  2QIZ A;  4A49 A;  2ECV A;  2YSM A;  5SVI B;  1WEN A;  3NG2 A;  1XWH A;  2G45 A;  3KNV A;  2LXP C;  4BHW A;  2YUR A;  2C2V S;  1N87 A;  2LGK A;  4O64 A;  1WES A;  2KGG A;  5H1T A;  4AVX A;  3HTK C;  5B8D A;  3FL2 A;  5FER A;  2XB1 A;  2KR4 A;  2MUM A;  2VNF A;  2KKX A;  5J3X A;  4A0C D;  2YVR A;  3O47 A;  2CSV A; 
#chains in the Genus database with same CATH homology
 2FFW A;  2MKE A;  3E2D A;  4Z0R A;  5SVI A;  3KDE C;  2JUN A;  5SVI B;  3T9K A;  3Q1D A;  3LVQ E;  4H9D A;  2XOZ A;  3MDB C;  4Z0O A;  3H7H A;  4O62 A;  1DCQ A;  2L7P A;  3FJU B;  2OWA A;  2XP0 A;  3DDT A;  3JUE A;  2CRW A;  2P57 A;  3DWD A;  2RR4 A;  2IQJ A;  2LAU A;  2XOY A;  2DJA A;  3LVR E;  2E61 A;  2XOC A;  2CON A;  2CRR A;  2M13 A;  3LJU X;  2EXU A;  3PLW A;  2KKY A;  4OGE A;  5SVY A;  5K3Q A;  2B0O E;  2FD4 A;  3FEH A;  3FM8 C;  2JM3 A;  4OGC A;  2YRE A;  4QQ4 A;  2D8U A;  3SUB A;  3M7K A;  2KKX A;  4F1P A;  3LDY A;  2YVR A;  5SVX A;  3O47 A;  2EGM A;  2CSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...