2KKXA

Solution structure of c-terminal domain of reduced nleg2-3 (residues 90-191) from pathogenic e. coli o157:h7. northeast structural genomics consortium and midwest center for structural genomics target et109a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
SQESIQNKISQCKFSVCPERLQCPLEAIQCPITLEQPEKGIFVKNSDGSDVCTLFDAAAFSRLVGEGLPHPLTREPITASIIVKHEECIYDDTRGNFIIKGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ECs2156
publication title NleG Type 3 effectors from enterohaemorrhagic Escherichia coli are U-Box E3 ubiquitin ligases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.80 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2kkxA00
2KKYA 2KKXA
chains in the Genus database with same CATH superfamily
2JMIA 2YSJA 2NAAA 2YQMA 1Z60A 2ECTA 4W4UA 4YATA 2KGGA 2ECWA 2FD4A 1CHCA 1LDKC 4FO9A 1RMDA 1WEUA 3ZPV1 2KWJA 2CRWA 5D1MB 1ZBDB 2YHOA 5LKXA 3L11A 2E61A 2L80A 4S3OC 3HCUA 5TDRA 5J3XA 2YYRA 2KGIA 2Y1NA 2L0BA 2QJ0A 2YQLA 2FUIA 5TBNA 3M62A 2MNYA 4GNDA 3DDTA 2OXQC 2RR4A 2M13A 3M7KA 4GNGA 3GL6A 2MNZA 5K3QA 5FB0A 2ECIA 2G43A 1DVPA 4F52B 2LQ6A 5LCWB 5TDWA 3FL2A 5B78A 2PNXA 2L43A 2YSMA 2ECJA 1BORA 4NN2A 2LGVA 2L75A 2FFWA 4LJNA 3T7LA 2XB1A 5KH7A 2D8SA 1HYIA 2KU3A 3L1ZB 4R2YA 5H1VA 3T9KA 2CRRA 3MHHA 3PUQA 5LKZA 2VP7A 1XWHA 2VNFA 2M6MA 4ZDTA 1WILA 3O37A 2JMJA 1WFKA 2KWKA 3ZVYA 5H1TA 2LRIC 5EYAF 3M63A 4IC3A 2VPEA 2ZETC 2DJAA 3I2DA 2H0DB 2M3HA 2VJEB 3FEHA 1VD4A 4AYCB 2AN6A 4R8PK 4H9DA 4WZ3B 5TABA 2LGGA 2MA5A 2K1JA 2K17A 3N9QA 4UP5A 3N9OA 3DQVR 5B76A 1X4IA 2BAYA 2QICA 1Z2QA 2Y43A 2D8UA 3ZYQA 1FP0A 2MA6A 2PUYA 3HCTA 4N4FA 4P5OB 1DCQA 4WZ2A 2YU4A 2JM3A 1U6GB 5FB1A 5B77A 4PPEA 3SUBA 1F62A 5KH9A 2CT2A 4X3GA 1JM7B 3RPGB 2K4DA 2YHNA 5TRBA 4I7CA 5C11A 5SVXA 2M1RA 3FANA 2EGPA 3DPLR 2L5UA 2XOYA 2CKLA 4YBMA 5H1UA 2MT5A 4LK9A 3LQHA 1MBMA 1E4UA 4A4CA 2CSYA 1MM3A 2F42A 2I50A 3FJUB 2YW8A 2E6SA 2VJFB 3QZVA 5DINA 4BBQA 4UI9B 3RTRB 1WE9A 3N9NA 2XOZA 3LRQA 5AIUA 2LXPC 1Z6UA 2UZGA 4GNFA 2DSMA 3LVRE 2B0OE 4ZQLA 3U5OA 4O62A 2YT5A 4WZ0A 2MUMA 3U5PA 3GV4A 4CCGX 5KH3A 3EB6A 4V3LC 1V87A 2ECVA 5AITA 2LAUA 1WIMA 3Q1DA 1WEEA 3PHDA 4YAXA 4I7DA 4O64A 2YUCA 2FSAA 2IQJA 4S3OB 1G25A 4Z0RA 2LN0A 3EB5A 4C9ZA 2VPDA 4Z0OA 3E2DA 1WEWA 3KV5A 5SVIB 3HCSA 2LGLA 4LKAA 2VPBA 3LQIA 5LKTA 2K16A 1X4UA 2KKYA 2ECGA 5JG6A 4CA1A 3ZTGA 2Y1MA 2F6NA 2E6RA 2MD8C 3O35A 3O7AA 1WEQA 4L58A 1IYMA 3KV6A 5G05B 4UP0A 4BHWA 2RI7A 4AUQB 4V3KC 3KQIA 4AVXA 5DKAA 2JUNA 5B79A 2HYED 4ZUXU 4B86C 3JUEA 4XI1A 5I3LA 4LLBA 2KE1A 4GNEA 4L7XA 1MM2A 2KWOA 2KWNA 3HTKC 3M99A 4YADA 2JRJA 3N9PA 2LXHC 4N3WA 2QIZA 3C6WA 4A49A 1WEPA 2KREA 4OGCA 4A4BA 4TKPB 4GB0A 2KFTA 3LJUX 2KIZA 2DX8A 4A0CD 1VYXA 3VK6A 3LDYA 3DWDA 2H0DA 2XP0A 2VJEA 2M85A 4AYCA 2EGMA 2F6JA 3O70A 3U5MA 3PURA 5LKUA 1K2FA 4R7EA 3KNVA 4QF2A 5G04B 3SOXA 2EA6A 5FEYA 5B75A 3H7HA 1T1HA 2KKXA 2KYUA 2JMDA 3O36A 2XEUA 4LADB 4WA6A 5D1LB 3V43A 3SHBA 1JOCA 3ZNIA 2CSVA 2IDAA 2KR4A 1VFYA 1WEMA 3ZVZB 3T6RA 2YVRA 3MHSA 4F1PA 4FK5A 2OWAA 4QF3A 1WEOA 3LQJA 1FBVA 1WGMA 4FJCA 3O34A 1JM7A 4YC9A 1WESA 5B8DA 2G6QA 2FUUA 2ECNA 2G45A 3U5NA 2RSDA 3MDBC 2C2LA 3N9LA 2LV9A 4IC2A 1HYJA 2EXUA 3ZPVE 1WENA 2C2VS 5FERA 4MSXA 4OGEA 3N9MA 3KDEC 2YREA 4QQ4A 3O33A 2HDPA 3O47A 5C13A 2LDRA 3SOWA 3C5KA 3FAOA 2VJFA 2VPGA 5H9MA 3FM8C 3SOUA 3LVQE 3ASLA 3RPGC 2YURA 1WEVA 2CKLB 2CSZA 2LGKA 3NG2A 1LDJB 4B7YC 3L1XA 5D1KB 4I7BA 3IHPA 4YABA 2MD7B 3PLWA 5SVYA 4FIPA 5G0FA 2P57A 2L7PA 4MVTA 2CONA 4YBTA 2MKEA 2XOCA 4YBSA 4PTBA 1X4JA 1N87A 2MIQA 5SVIA 2EODA 4AP4A 4Q6FA
chains in the Genus database with same CATH topology
3SUBA 3PLWA 3DWDA 5SVYA 3MDBC 3FM8C 4Z0RA 3LVRE 2B0OE 2XP0A 4O62A 2EXUA 3LVQE 4Z0OA 3E2DA 2P57A 2EGMA 2FD4A 2L7PA 3FJUB 5SVIB 2CSVA 2D8UA 2FFWA 2JUNA 2CONA 4OGEA 2DJAA 2KKYA 3DDTA 2YVRA 2MKEA 5SVXA 3T9KA 2XOCA 3KDEC 1DCQA 2CRWA 2CRRA 4OGCA 2RR4A 3FEHA 2M13A 3JUEA 2JM3A 2YREA 2LAUA 2XOZA 4F1PA 4QQ4A 3H7HA 3Q1DA 3M7KA 2OWAA 5SVIA 2KKXA 3LJUX 3O47A 2XOYA 4H9DA 2E61A 5K3QA 2IQJA 3LDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKY A;  2KKX A; 
#chains in the Genus database with same CATH topology
 2JMI A;  2YSJ A;  2NAA A;  2YQM A;  1Z60 A;  2ECT A;  4W4U A;  4YAT A;  2KGG A;  2ECW A;  2FD4 A;  1CHC A;  1LDK C;  4FO9 A;  1RMD A;  1WEU A;  3ZPV 1;  2KWJ A;  2CRW A;  5D1M B;  1ZBD B;  2YHO A;  5LKX A;  3L11 A;  2E61 A;  2L80 A;  4S3O C;  3HCU A;  5TDR A;  5J3X A;  2YYR A;  2KGI A;  2Y1N A;  2L0B A;  2QJ0 A;  2YQL A;  2FUI A;  5TBN A;  3M62 A;  2MNY A;  4GND A;  3DDT A;  2OXQ C;  2RR4 A;  2M13 A;  3M7K A;  4GNG A;  3GL6 A;  2MNZ A;  5K3Q A;  5FB0 A;  2ECI A;  2G43 A;  1DVP A;  4F52 B;  2LQ6 A;  5LCW B;  5TDW A;  3FL2 A;  5B78 A;  2PNX A;  2L43 A;  2YSM A;  2ECJ A;  1BOR A;  4NN2 A;  2LGV A;  2L75 A;  2FFW A;  4LJN A;  3T7L A;  2XB1 A;  5KH7 A;  2D8S A;  1HYI A;  2KU3 A;  3L1Z B;  4R2Y A;  5H1V A;  3T9K A;  2CRR A;  3MHH A;  3PUQ A;  5LKZ A;  2VP7 A;  1XWH A;  2VNF A;  2M6M A;  4ZDT A;  1WIL A;  3O37 A;  2JMJ A;  1WFK A;  2KWK A;  3ZVY A;  5H1T A;  2LRI C;  5EYA F;  3M63 A;  4IC3 A;  2VPE A;  2ZET C;  2DJA A;  3I2D A;  2H0D B;  2M3H A;  2VJE B;  3FEH A;  1VD4 A;  4AYC B;  2AN6 A;  4R8P K;  4H9D A;  4WZ3 B;  5TAB A;  2LGG A;  2MA5 A;  2K1J A;  2K17 A;  3N9Q A;  4UP5 A;  3N9O A;  3DQV R;  5B76 A;  1X4I A;  2BAY A;  2QIC A;  1Z2Q A;  2Y43 A;  2D8U A;  3ZYQ A;  1FP0 A;  2MA6 A;  2PUY A;  3HCT A;  4N4F A;  4P5O B;  1DCQ A;  4WZ2 A;  2YU4 A;  2JM3 A;  1U6G B;  5FB1 A;  5B77 A;  4PPE A;  3SUB A;  1F62 A;  5KH9 A;  2CT2 A;  4X3G A;  1JM7 B;  3RPG B;  2K4D A;  2YHN A;  5TRB A;  4I7C A;  5C11 A;  5SVX A;  2M1R A;  3FAN A;  2EGP A;  3DPL R;  2L5U A;  2XOY A;  2CKL A;  4YBM A;  5H1U A;  2MT5 A;  4LK9 A;  3LQH A;  1MBM A;  1E4U A;  4A4C A;  2CSY A;  1MM3 A;  2F42 A;  2I50 A;  3FJU B;  2YW8 A;  2E6S A;  2VJF B;  3QZV A;  5DIN A;  4BBQ A;  4UI9 B;  3RTR B;  1WE9 A;  3N9N A;  2XOZ A;  3LRQ A;  5AIU A;  2LXP C;  1Z6U A;  2UZG A;  4GNF A;  2DSM A;  3LVR E;  2B0O E;  4ZQL A;  3U5O A;  4O62 A;  2YT5 A;  4WZ0 A;  2MUM A;  3U5P A;  3GV4 A;  4CCG X;  5KH3 A;  3EB6 A;  4V3L C;  1V87 A;  2ECV A;  5AIT A;  2LAU A;  1WIM A;  3Q1D A;  1WEE A;  3PHD A;  4YAX A;  4I7D A;  4O64 A;  2YUC A;  2FSA A;  2IQJ A;  4S3O B;  1G25 A;  4Z0R A;  2LN0 A;  3EB5 A;  4C9Z A;  2VPD A;  4Z0O A;  3E2D A;  1WEW A;  3KV5 A;  5SVI B;  3HCS A;  2LGL A;  4LKA A;  2VPB A;  3LQI A;  5LKT A;  2K16 A;  1X4U A;  2KKY A;  2ECG A;  5JG6 A;  4CA1 A;  3ZTG A;  2Y1M A;  2F6N A;  2E6R A;  2MD8 C;  3O35 A;  3O7A A;  1WEQ A;  4L58 A;  1IYM A;  3KV6 A;  5G05 B;  4UP0 A;  4BHW A;  2RI7 A;  4AUQ B;  4V3K C;  3KQI A;  4AVX A;  5DKA A;  2JUN A;  5B79 A;  2HYE D;  4ZUX U;  4B86 C;  3JUE A;  4XI1 A;  5I3L A;  4LLB A;  2KE1 A;  4GNE A;  4L7X A;  1MM2 A;  2KWO A;  2KWN A;  3HTK C;  3M99 A;  4YAD A;  2JRJ A;  3N9P A;  2LXH C;  4N3W A;  2QIZ A;  3C6W A;  4A49 A;  1WEP A;  2KRE A;  4OGC A;  4A4B A;  4TKP B;  4GB0 A;  2KFT A;  3LJU X;  2KIZ A;  2DX8 A;  4A0C D;  1VYX A;  3VK6 A;  3LDY A;  3DWD A;  2H0D A;  2XP0 A;  2VJE A;  2M85 A;  4AYC A;  2EGM A;  2F6J A;  3O70 A;  3U5M A;  3PUR A;  5LKU A;  1K2F A;  4R7E A;  3KNV A;  4QF2 A;  5G04 B;  3SOX A;  2EA6 A;  5FEY A;  5B75 A;  3H7H A;  1T1H A;  2KKX A;  2KYU A;  2JMD A;  3O36 A;  2XEU A;  4LAD B;  4WA6 A;  5D1L B;  3V43 A;  3SHB A;  1JOC A;  3ZNI A;  2CSV A;  2IDA A;  2KR4 A;  1VFY A;  1WEM A;  3ZVZ B;  3T6R A;  2YVR A;  3MHS A;  4F1P A;  4FK5 A;  2OWA A;  4QF3 A;  1WEO A;  3LQJ A;  1FBV A;  1WGM A;  4FJC A;  3O34 A;  1JM7 A;  4YC9 A;  1WES A;  5B8D A;  2G6Q A;  2FUU A;  2ECN A;  2G45 A;  3U5N A;  2RSD A;  3MDB C;  2C2L A;  3N9L A;  2LV9 A;  4IC2 A;  1HYJ A;  2EXU A;  3ZPV E;  1WEN A;  2C2V S;  5FER A;  4MSX A;  4OGE A;  3N9M A;  3KDE C;  2YRE A;  4QQ4 A;  3O33 A;  2HDP A;  3O47 A;  5C13 A;  2LDR A;  3SOW A;  3C5K A;  3FAO A;  2VJF A;  2VPG A;  5H9M A;  3FM8 C;  3SOU A;  3LVQ E;  3ASL A;  3RPG C;  2YUR A;  1WEV A;  2CKL B;  2CSZ A;  2LGK A;  3NG2 A;  1LDJ B;  4B7Y C;  3L1X A;  5D1K B;  4I7B A;  3IHP A;  4YAB A;  2MD7 B;  3PLW A;  5SVY A;  4FIP A;  5G0F A;  2P57 A;  2L7P A;  4MVT A;  2CON A;  4YBT A;  2MKE A;  2XOC A;  4YBS A;  4PTB A;  1X4J A;  1N87 A;  2MIQ A;  5SVI A;  2EOD A;  4AP4 A;  4Q6F A; 
#chains in the Genus database with same CATH homology
 3SUB A;  3PLW A;  3DWD A;  5SVY A;  3MDB C;  3FM8 C;  4Z0R A;  3LVR E;  2B0O E;  2XP0 A;  4O62 A;  2EXU A;  3LVQ E;  4Z0O A;  3E2D A;  2P57 A;  2EGM A;  2FD4 A;  2L7P A;  3FJU B;  5SVI B;  2CSV A;  2D8U A;  2FFW A;  2JUN A;  2CON A;  4OGE A;  2DJA A;  2KKY A;  3DDT A;  2YVR A;  2MKE A;  5SVX A;  3T9K A;  2XOC A;  3KDE C;  1DCQ A;  2CRW A;  2CRR A;  4OGC A;  2RR4 A;  3FEH A;  2M13 A;  3JUE A;  2JM3 A;  2YRE A;  2LAU A;  2XOZ A;  4F1P A;  4QQ4 A;  3H7H A;  3Q1D A;  3M7K A;  2OWA A;  5SVI A;  2KKX A;  3LJU X;  3O47 A;  2XOY A;  4H9D A;  2E61 A;  5K3Q A;  2IQJ A;  3LDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...