5KH9A

Crystal structure of a low occupancy fragment candidate (5-[(4-isopropylphenyl)amino]-6-methyl-1,2,4-triazin-3(2h)-one) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Histone deacetylase 6
publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 100
sequence length 100
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh9A00
3MHSA 4WZ0A 3NG2A 2L5UA 2ECVA 3KV6A 4AUQB 3O33A 4L58A 5I3LA 4C9ZA 4YABA 1Z60A 2L75A 2VJFA 1T1HA 4CA1A 3KV5A 3V43A 4XI1A 3PUQA 2E6SA 2YQLA 2YW8A 2KWOA 2K16A 2QICA 4UP0A 4GB0A 4GNDA 2CSZA 4B7YC 4GNFA 1JM7B 2KFTA 2KREA 2VPGA 4WZ3B 3HCTA 1K2FA 3SOXA 1V87A 3DPLR 2VPDA 2LXPC 4IC2A 3SHBA 5TRBA 2H0DA 1HYJA 3U5OA 2ECNA 4R7EA 1BORA 4FO9A 3HCUA 2VP7A 2XB1A 3N9PA 3EB6A 5D1MB 2ZETC 2QIZA 2ECGA 3L1XA 2OXQC 2K17A 2HDPA 1LDKC 2QJ0A 2L0BA 5FB0A 3T6RA 5H1UA 2C2VS 4ZUXU 2G45A 1WEMA 1WEQA 4FK5A 2E6RA 2CT2A 5C11A 5G04B 3ZYQA 3L11A 3N9QA 2F42A 5KH3A 5B79A 3ZPV1 5G05B 2CSYA 2CKLB 5FEYA 4S3OB 1WEVA 1WENA 4GNEA 2HYED 4LK9A 4YBTA 4AP4A 2MUMA 3KQIA 3M99A 4GNGA 3U5MA 3GL6A 4A0CD 5TDWA 5B78A 2NAAA 4YAXA 4QF3A 3PURA 3ZVYA 1WILA 2Y43A 4NN2A 4PTBA 5EYAF 5LKUA 2ECIA 3ASLA 4S3OC 5B8DA 2JMIA 5JG6A 2KWKA 5H9MA 4LKAA 1FP0A 4LLBA 2LGGA 4YBSA 2YHOA 2Y1NA 2G43A 3C5KA 2L80A 2EGPA 4IC3A 4UI9B 4AYCB 4LJNA 4F52B 2PUYA 1X4UA 5D1LB 2KWJA 2G6QA 3KNVA 2FSAA 2XEUA 1F62A 2KWNA 1DVPA 2Y1MA 2VJFB 3ZPVE 2YU4A 5KH7A 2L43A 4YBMA 5TBNA 4YC9A 2MT5A 5KH9A 2K1JA 3N9LA 2FUIA 3DQVR 3M62A 1HYIA 1IYMA 2LRIC 4L7XA 4YATA 3N9MA 1U6GB 3U5NA 4MSXA 5TDRA 4B86C 2LGLA 2H0DB 2MA5A 3ZTGA 1VYXA 2CKLA 1G25A 4BHWA 3U5PA 2DX8A 1CHCA 4V3KC 5D1KB 2MD8C 1WESA 2VJEA 4X3GA 2RSDA 2JMDA 2LDRA 3PHDA 2YQMA 1WEUA 5LKTA 5B75A 2MA6A 2IDAA 2M6MA 2LQ6A 2F6NA 2KR4A 3M63A 1WE9A 1RMDA 2LN0A 2ECWA 1WEPA 4I7CA 2YREA 1JOCA 2JMJA 2KGGA 2EODA 4R2YA 3N9NA 2YYRA 5B76A 4UP5A 1Z2QA 2MNYA 1N87A 2KYUA 4WA6A 4AYCA 1WEWA 1JM7A 3SOWA 5AITA 2D8SA 5B77A 2KIZA 1X4IA 4WZ2A 5H1VA 3L1ZB 5DKAA 1WIMA 4AVXA 5LKZA 5FB1A 1WGMA 3LQJA 4FIPA 3RTRB 3HTKC 2UZGA 3I2DA 3O36A 4O64A 3GV4A 4MVTA 2MNZA 4FJCA 3N9OA 3LQIA 1VFYA 3VK6A 3IHPA 4I7BA 2PNXA 2C2LA 1FBVA 2VNFA 4CCGX 2YT5A 1WEEA 2YUCA 1E4UA 2LXHC 2YHNA 2LGKA 3O37A 2MIQA 4A4CA 2RI7A 4P5OB 5DINA 2K4DA 2LGVA 5LKXA 2AN6A 4I7DA 1WFKA 5LCWB 3ZVZB 2YSMA 4QF2A 3O34A 2JRJA 1X4JA 3LQHA 4A4BA 1LDJB 2KGIA 3LRQA 2I50A 4Q6FA 1VD4A 2KE1A 4A49A 4TKPB 2M3HA 3C6WA 1XWHA 2LV9A 3SOUA 5J3XA 2M85A 4YADA 2ECTA 2MD7B 5TABA 4N3WA 4V3LC 5FERA 1MM3A 4ZDTA 3RPGB 3QZVA 5C13A 2YSJA 1Z6UA 2YURA 5H1TA 5AIUA 1WEOA 2VPBA 1ZBDB 2EA6A 3O7AA 2FUUA 5G0FA 3O35A 2VPEA 3O70A 2F6JA 4LADB 3ZNIA 2BAYA 2ECJA 2VJEB 4BBQA 1MM2A 4N4FA 4R8PK 2M1RA 4W4UA 2KU3A 3EB5A 3MHHA 4PPEA 3RPGC 3T7LA 3HCSA 4ZQLA 3FL2A
chains in the Genus database with same CATH superfamily
3MHSA 4OGEA 4WZ0A 3NG2A 2L5UA 2ECVA 3KV6A 4AUQB 3O33A 5SVYA 4L58A 5I3LA 4C9ZA 4YABA 1Z60A 2L75A 2VJFA 1T1HA 4CA1A 3E2DA 3KV5A 3V43A 4XI1A 3PUQA 2E6SA 2YQLA 2YW8A 2LAUA 2KWOA 2K16A 2QICA 4UP0A 4OGCA 4GB0A 4GNDA 2CSZA 4B7YC 4GNFA 1JM7B 2YVRA 3LDYA 2KFTA 4QQ4A 2KREA 2VPGA 4WZ3B 4O62A 3HCTA 1K2FA 3SOXA 1V87A 3DPLR 2VPDA 2LXPC 4IC2A 3SHBA 5TRBA 2H0DA 3FANA 1HYJA 3U5OA 2ECNA 3JUEA 4R7EA 1BORA 4FO9A 2D8UA 3HCUA 5SVIB 2VP7A 2XB1A 3N9PA 3EB6A 2E61A 5D1MB 2CSVA 2ZETC 3SUBA 2QIZA 2ECGA 3L1XA 2OXQC 3LJUX 2K17A 2HDPA 1LDKC 3FEHA 2QJ0A 2L0BA 5FB0A 3T6RA 5H1UA 2C2VS 4ZUXU 2KKYA 2G45A 1WEMA 1WEQA 4FK5A 2E6RA 2CT2A 5C11A 5G04B 3ZYQA 3L11A 3M7KA 2L7PA 3N9QA 2F42A 5KH3A 5B79A 3ZPV1 5G05B 1DCQA 4Z0RA 2CSYA 2CKLB 5FEYA 2EGMA 4S3OB 1WEVA 1WENA 4GNEA 2HYED 4LK9A 2M13A 2XOZA 4YBTA 4AP4A 2MUMA 3KQIA 3M99A 4GNGA 3U5MA 3GL6A 4A0CD 5TDWA 5B78A 2NAAA 4YAXA 4QF3A 3PURA 3ZVYA 1WILA 2Y43A 4NN2A 4PTBA 5EYAF 5LKUA 2ECIA 3ASLA 4S3OC 5B8DA 2JMIA 5JG6A 2KWKA 5H9MA 4LKAA 1FP0A 4LLBA 2LGGA 4YBSA 2YHOA 2Y1NA 2G43A 3T9KA 3C5KA 2L80A 3DWDA 2EGPA 4IC3A 4UI9B 4AYCB 4LJNA 4F52B 2PUYA 1X4UA 3H7HA 2DSMA 4Z0OA 4F1PA 5D1LB 2KWJA 2G6QA 3KNVA 2FSAA 2XEUA 1F62A 2KWNA 1DVPA 3PLWA 2Y1MA 2VJFB 3ZPVE 2YU4A 5KH7A 2L43A 2EXUA 2XOCA 4YBMA 5TBNA 4YC9A 2MT5A 3MDBC 5KH9A 2K1JA 3N9LA 2B0OE 2FUIA 4H9DA 3DQVR 3M62A 1HYIA 1IYMA 2LRIC 4L7XA 4YATA 3N9MA 1U6GB 3O47A 3DDTA 3U5NA 4MSXA 5TDRA 4B86C 2LGLA 2H0DB 2MA5A 2CRWA 3ZTGA 1VYXA 2CKLA 1G25A 4BHWA 3U5PA 2DX8A 1CHCA 4V3KC 5D1KB 2MD8C 1WESA 2VJEA 4X3GA 2RSDA 2JMDA 2LDRA 3PHDA 2YQMA 2FD4A 1WEUA 2MKEA 5LKTA 5B75A 2MA6A 2IDAA 2M6MA 2LQ6A 2DJAA 2F6NA 2KR4A 2CONA 3M63A 1WE9A 1RMDA 2IQJA 2LN0A 2ECWA 1WEPA 4I7CA 2YREA 1JOCA 2JMJA 2KGGA 3LVQE 2EODA 5SVXA 4R2YA 3N9NA 2YYRA 5B76A 4UP5A 1Z2QA 2MNYA 1N87A 2KYUA 4WA6A 2OWAA 4AYCA 1WEWA 1JM7A 2FFWA 3SOWA 5AITA 2D8SA 5B77A 2KIZA 1X4IA 4WZ2A 5H1VA 3L1ZB 5DKAA 1WIMA 4AVXA 5LKZA 5FB1A 1WGMA 3FAOA 3LQJA 4FIPA 3RTRB 3HTKC 5SVIA 2UZGA 3I2DA 3O36A 3KDEC 4O64A 3GV4A 4MVTA 2MNZA 4FJCA 3N9OA 3LQIA 1VFYA 3VK6A 3IHPA 4I7BA 2PNXA 2C2LA 1FBVA 2VNFA 4CCGX 2YT5A 1WEEA 2YUCA 1E4UA 2LXHC 2YHNA 2LGKA 3O37A 2MIQA 4A4CA 2RI7A 4P5OB 5DINA 2K4DA 2RR4A 2LGVA 5LKXA 2AN6A 4I7DA 2JUNA 1WFKA 5LCWB 3ZVZB 3Q1DA 2YSMA 4QF2A 3O34A 2JRJA 2XP0A 1X4JA 3LQHA 4A4BA 1LDJB 2KGIA 3LRQA 2I50A 4Q6FA 1VD4A 2KE1A 4A49A 4TKPB 2M3HA 3C6WA 1XWHA 2XOYA 2LV9A 2P57A 3FJUB 3SOUA 5J3XA 5K3QA 2M85A 4YADA 2ECTA 2MD7B 5TABA 4N3WA 4V3LC 5FERA 1MM3A 4ZDTA 3RPGB 3QZVA 5C13A 2KKXA 2YSJA 1Z6UA 2YURA 5H1TA 5AIUA 1WEOA 2VPBA 1ZBDB 2EA6A 3O7AA 2FUUA 5G0FA 2CRRA 3O35A 2VPEA 3O70A 3FM8C 3LVRE 2F6JA 4LADB 3ZNIA 2BAYA 2ECJA 2JM3A 2VJEB 4BBQA 1MBMA 1MM2A 4N4FA 4R8PK 2M1RA 4W4UA 2KU3A 3EB5A 3MHHA 4PPEA 3RPGC 3T7LA 3HCSA 4ZQLA 3FL2A
chains in the Genus database with same CATH topology
3MHSA 4WZ0A 3NG2A 2L5UA 2ECVA 3KV6A 4AUQB 3O33A 4L58A 5I3LA 4C9ZA 4YABA 1Z60A 2L75A 2VJFA 1T1HA 4CA1A 3KV5A 3V43A 4XI1A 3PUQA 2E6SA 2YQLA 2YW8A 2KWOA 2K16A 2QICA 4UP0A 4GB0A 4GNDA 2CSZA 4B7YC 4GNFA 1JM7B 2KFTA 2KREA 2VPGA 4WZ3B 3HCTA 1K2FA 3SOXA 1V87A 3DPLR 2VPDA 2LXPC 4IC2A 3SHBA 5TRBA 2H0DA 1HYJA 3U5OA 2ECNA 4R7EA 1BORA 4FO9A 3HCUA 2VP7A 2XB1A 3N9PA 3EB6A 5D1MB 2ZETC 2QIZA 2ECGA 3L1XA 2OXQC 2K17A 2HDPA 1LDKC 2QJ0A 2L0BA 5FB0A 3T6RA 5H1UA 2C2VS 4ZUXU 2G45A 1WEMA 1WEQA 4FK5A 2E6RA 2CT2A 5C11A 5G04B 3ZYQA 3L11A 3N9QA 2F42A 5KH3A 5B79A 3ZPV1 5G05B 2CSYA 2CKLB 5FEYA 4S3OB 1WEVA 1WENA 4GNEA 2HYED 4LK9A 4YBTA 4AP4A 2MUMA 3KQIA 3M99A 4GNGA 3U5MA 3GL6A 4A0CD 5TDWA 5B78A 2NAAA 4YAXA 4QF3A 3PURA 3ZVYA 1WILA 2Y43A 4NN2A 4PTBA 5EYAF 5LKUA 2ECIA 3ASLA 4S3OC 5B8DA 2JMIA 5JG6A 2KWKA 5H9MA 4LKAA 1FP0A 4LLBA 2LGGA 4YBSA 2YHOA 2Y1NA 2G43A 3C5KA 2L80A 2EGPA 4IC3A 4UI9B 4AYCB 4LJNA 4F52B 2PUYA 1X4UA 5D1LB 2KWJA 2G6QA 3KNVA 2FSAA 2XEUA 1F62A 2KWNA 1DVPA 2Y1MA 2VJFB 3ZPVE 2YU4A 5KH7A 2L43A 4YBMA 5TBNA 4YC9A 2MT5A 5KH9A 2K1JA 3N9LA 2FUIA 3DQVR 3M62A 1HYIA 1IYMA 2LRIC 4L7XA 4YATA 3N9MA 1U6GB 3U5NA 4MSXA 5TDRA 4B86C 2LGLA 2H0DB 2MA5A 3ZTGA 1VYXA 2CKLA 1G25A 4BHWA 3U5PA 2DX8A 1CHCA 4V3KC 5D1KB 2MD8C 1WESA 2VJEA 4X3GA 2RSDA 2JMDA 2LDRA 3PHDA 2YQMA 1WEUA 5LKTA 5B75A 2MA6A 2IDAA 2M6MA 2LQ6A 2F6NA 2KR4A 3M63A 1WE9A 1RMDA 2LN0A 2ECWA 1WEPA 4I7CA 2YREA 1JOCA 2JMJA 2KGGA 2EODA 4R2YA 3N9NA 2YYRA 5B76A 4UP5A 1Z2QA 2MNYA 1N87A 2KYUA 4WA6A 4AYCA 1WEWA 1JM7A 3SOWA 5AITA 2D8SA 5B77A 2KIZA 1X4IA 4WZ2A 5H1VA 3L1ZB 5DKAA 1WIMA 4AVXA 5LKZA 5FB1A 1WGMA 3LQJA 4FIPA 3RTRB 3HTKC 2UZGA 3I2DA 3O36A 4O64A 3GV4A 4MVTA 2MNZA 4FJCA 3N9OA 3LQIA 1VFYA 3VK6A 3IHPA 4I7BA 2PNXA 2C2LA 1FBVA 2VNFA 4CCGX 2YT5A 1WEEA 2YUCA 1E4UA 2LXHC 2YHNA 2LGKA 3O37A 2MIQA 4A4CA 2RI7A 4P5OB 5DINA 2K4DA 2LGVA 5LKXA 2AN6A 4I7DA 1WFKA 5LCWB 3ZVZB 2YSMA 4QF2A 3O34A 2JRJA 1X4JA 3LQHA 4A4BA 1LDJB 2KGIA 3LRQA 2I50A 4Q6FA 1VD4A 2KE1A 4A49A 4TKPB 2M3HA 3C6WA 1XWHA 2LV9A 3SOUA 5J3XA 2M85A 4YADA 2ECTA 2MD7B 5TABA 4N3WA 4V3LC 5FERA 1MM3A 4ZDTA 3RPGB 3QZVA 5C13A 2YSJA 1Z6UA 2YURA 5H1TA 5AIUA 1WEOA 2VPBA 1ZBDB 2EA6A 3O7AA 2FUUA 5G0FA 3O35A 2VPEA 3O70A 2F6JA 4LADB 3ZNIA 2BAYA 2ECJA 2VJEB 4BBQA 1MM2A 4N4FA 4R8PK 2M1RA 4W4UA 2KU3A 3EB5A 3MHHA 4PPEA 3RPGC 3T7LA 3HCSA 4ZQLA 3FL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS A;  4WZ0 A;  3NG2 A;  2L5U A;  2ECV A;  3KV6 A;  4AUQ B;  3O33 A;  4L58 A;  5I3L A;  4C9Z A;  4YAB A;  1Z60 A;  2L75 A;  2VJF A;  1T1H A;  4CA1 A;  3KV5 A;  3V43 A;  4XI1 A;  3PUQ A;  2E6S A;  2YQL A;  2YW8 A;  2KWO A;  2K16 A;  2QIC A;  4UP0 A;  4GB0 A;  4GND A;  2CSZ A;  4B7Y C;  4GNF A;  1JM7 B;  2KFT A;  2KRE A;  2VPG A;  4WZ3 B;  3HCT A;  1K2F A;  3SOX A;  1V87 A;  3DPL R;  2VPD A;  2LXP C;  4IC2 A;  3SHB A;  5TRB A;  2H0D A;  1HYJ A;  3U5O A;  2ECN A;  4R7E A;  1BOR A;  4FO9 A;  3HCU A;  2VP7 A;  2XB1 A;  3N9P A;  3EB6 A;  5D1M B;  2ZET C;  2QIZ A;  2ECG A;  3L1X A;  2OXQ C;  2K17 A;  2HDP A;  1LDK C;  2QJ0 A;  2L0B A;  5FB0 A;  3T6R A;  5H1U A;  2C2V S;  4ZUX U;  2G45 A;  1WEM A;  1WEQ A;  4FK5 A;  2E6R A;  2CT2 A;  5C11 A;  5G04 B;  3ZYQ A;  3L11 A;  3N9Q A;  2F42 A;  5KH3 A;  5B79 A;  3ZPV 1;  5G05 B;  2CSY A;  2CKL B;  5FEY A;  4S3O B;  1WEV A;  1WEN A;  4GNE A;  2HYE D;  4LK9 A;  4YBT A;  4AP4 A;  2MUM A;  3KQI A;  3M99 A;  4GNG A;  3U5M A;  3GL6 A;  4A0C D;  5TDW A;  5B78 A;  2NAA A;  4YAX A;  4QF3 A;  3PUR A;  3ZVY A;  1WIL A;  2Y43 A;  4NN2 A;  4PTB A;  5EYA F;  5LKU A;  2ECI A;  3ASL A;  4S3O C;  5B8D A;  2JMI A;  5JG6 A;  2KWK A;  5H9M A;  4LKA A;  1FP0 A;  4LLB A;  2LGG A;  4YBS A;  2YHO A;  2Y1N A;  2G43 A;  3C5K A;  2L80 A;  2EGP A;  4IC3 A;  4UI9 B;  4AYC B;  4LJN A;  4F52 B;  2PUY A;  1X4U A;  5D1L B;  2KWJ A;  2G6Q A;  3KNV A;  2FSA A;  2XEU A;  1F62 A;  2KWN A;  1DVP A;  2Y1M A;  2VJF B;  3ZPV E;  2YU4 A;  5KH7 A;  2L43 A;  4YBM A;  5TBN A;  4YC9 A;  2MT5 A;  5KH9 A;  2K1J A;  3N9L A;  2FUI A;  3DQV R;  3M62 A;  1HYI A;  1IYM A;  2LRI C;  4L7X A;  4YAT A;  3N9M A;  1U6G B;  3U5N A;  4MSX A;  5TDR A;  4B86 C;  2LGL A;  2H0D B;  2MA5 A;  3ZTG A;  1VYX A;  2CKL A;  1G25 A;  4BHW A;  3U5P A;  2DX8 A;  1CHC A;  4V3K C;  5D1K B;  2MD8 C;  1WES A;  2VJE A;  4X3G A;  2RSD A;  2JMD A;  2LDR A;  3PHD A;  2YQM A;  1WEU A;  5LKT A;  5B75 A;  2MA6 A;  2IDA A;  2M6M A;  2LQ6 A;  2F6N A;  2KR4 A;  3M63 A;  1WE9 A;  1RMD A;  2LN0 A;  2ECW A;  1WEP A;  4I7C A;  2YRE A;  1JOC A;  2JMJ A;  2KGG A;  2EOD A;  4R2Y A;  3N9N A;  2YYR A;  5B76 A;  4UP5 A;  1Z2Q A;  2MNY A;  1N87 A;  2KYU A;  4WA6 A;  4AYC A;  1WEW A;  1JM7 A;  3SOW A;  5AIT A;  2D8S A;  5B77 A;  2KIZ A;  1X4I A;  4WZ2 A;  5H1V A;  3L1Z B;  5DKA A;  1WIM A;  4AVX A;  5LKZ A;  5FB1 A;  1WGM A;  3LQJ A;  4FIP A;  3RTR B;  3HTK C;  2UZG A;  3I2D A;  3O36 A;  4O64 A;  3GV4 A;  4MVT A;  2MNZ A;  4FJC A;  3N9O A;  3LQI A;  1VFY A;  3VK6 A;  3IHP A;  4I7B A;  2PNX A;  2C2L A;  1FBV A;  2VNF A;  4CCG X;  2YT5 A;  1WEE A;  2YUC A;  1E4U A;  2LXH C;  2YHN A;  2LGK A;  3O37 A;  2MIQ A;  4A4C A;  2RI7 A;  4P5O B;  5DIN A;  2K4D A;  2LGV A;  5LKX A;  2AN6 A;  4I7D A;  1WFK A;  5LCW B;  3ZVZ B;  2YSM A;  4QF2 A;  3O34 A;  2JRJ A;  1X4J A;  3LQH A;  4A4B A;  1LDJ B;  2KGI A;  3LRQ A;  2I50 A;  4Q6F A;  1VD4 A;  2KE1 A;  4A49 A;  4TKP B;  2M3H A;  3C6W A;  1XWH A;  2LV9 A;  3SOU A;  5J3X A;  2M85 A;  4YAD A;  2ECT A;  2MD7 B;  5TAB A;  4N3W A;  4V3L C;  5FER A;  1MM3 A;  4ZDT A;  3RPG B;  3QZV A;  5C13 A;  2YSJ A;  1Z6U A;  2YUR A;  5H1T A;  5AIU A;  1WEO A;  2VPB A;  1ZBD B;  2EA6 A;  3O7A A;  2FUU A;  5G0F A;  3O35 A;  2VPE A;  3O70 A;  2F6J A;  4LAD B;  3ZNI A;  2BAY A;  2ECJ A;  2VJE B;  4BBQ A;  1MM2 A;  4N4F A;  4R8P K;  2M1R A;  4W4U A;  2KU3 A;  3EB5 A;  3MHH A;  4PPE A;  3RPG C;  3T7L A;  3HCS A;  4ZQL A;  3FL2 A; 
#chains in the Genus database with same CATH topology
 3MHS A;  4OGE A;  4WZ0 A;  3NG2 A;  2L5U A;  2ECV A;  3KV6 A;  4AUQ B;  3O33 A;  5SVY A;  4L58 A;  5I3L A;  4C9Z A;  4YAB A;  1Z60 A;  2L75 A;  2VJF A;  1T1H A;  4CA1 A;  3E2D A;  3KV5 A;  3V43 A;  4XI1 A;  3PUQ A;  2E6S A;  2YQL A;  2YW8 A;  2LAU A;  2KWO A;  2K16 A;  2QIC A;  4UP0 A;  4OGC A;  4GB0 A;  4GND A;  2CSZ A;  4B7Y C;  4GNF A;  1JM7 B;  2YVR A;  3LDY A;  2KFT A;  4QQ4 A;  2KRE A;  2VPG A;  4WZ3 B;  4O62 A;  3HCT A;  1K2F A;  3SOX A;  1V87 A;  3DPL R;  2VPD A;  2LXP C;  4IC2 A;  3SHB A;  5TRB A;  2H0D A;  3FAN A;  1HYJ A;  3U5O A;  2ECN A;  3JUE A;  4R7E A;  1BOR A;  4FO9 A;  2D8U A;  3HCU A;  5SVI B;  2VP7 A;  2XB1 A;  3N9P A;  3EB6 A;  2E61 A;  5D1M B;  2CSV A;  2ZET C;  3SUB A;  2QIZ A;  2ECG A;  3L1X A;  2OXQ C;  3LJU X;  2K17 A;  2HDP A;  1LDK C;  3FEH A;  2QJ0 A;  2L0B A;  5FB0 A;  3T6R A;  5H1U A;  2C2V S;  4ZUX U;  2KKY A;  2G45 A;  1WEM A;  1WEQ A;  4FK5 A;  2E6R A;  2CT2 A;  5C11 A;  5G04 B;  3ZYQ A;  3L11 A;  3M7K A;  2L7P A;  3N9Q A;  2F42 A;  5KH3 A;  5B79 A;  3ZPV 1;  5G05 B;  1DCQ A;  4Z0R A;  2CSY A;  2CKL B;  5FEY A;  2EGM A;  4S3O B;  1WEV A;  1WEN A;  4GNE A;  2HYE D;  4LK9 A;  2M13 A;  2XOZ A;  4YBT A;  4AP4 A;  2MUM A;  3KQI A;  3M99 A;  4GNG A;  3U5M A;  3GL6 A;  4A0C D;  5TDW A;  5B78 A;  2NAA A;  4YAX A;  4QF3 A;  3PUR A;  3ZVY A;  1WIL A;  2Y43 A;  4NN2 A;  4PTB A;  5EYA F;  5LKU A;  2ECI A;  3ASL A;  4S3O C;  5B8D A;  2JMI A;  5JG6 A;  2KWK A;  5H9M A;  4LKA A;  1FP0 A;  4LLB A;  2LGG A;  4YBS A;  2YHO A;  2Y1N A;  2G43 A;  3T9K A;  3C5K A;  2L80 A;  3DWD A;  2EGP A;  4IC3 A;  4UI9 B;  4AYC B;  4LJN A;  4F52 B;  2PUY A;  1X4U A;  3H7H A;  2DSM A;  4Z0O A;  4F1P A;  5D1L B;  2KWJ A;  2G6Q A;  3KNV A;  2FSA A;  2XEU A;  1F62 A;  2KWN A;  1DVP A;  3PLW A;  2Y1M A;  2VJF B;  3ZPV E;  2YU4 A;  5KH7 A;  2L43 A;  2EXU A;  2XOC A;  4YBM A;  5TBN A;  4YC9 A;  2MT5 A;  3MDB C;  5KH9 A;  2K1J A;  3N9L A;  2B0O E;  2FUI A;  4H9D A;  3DQV R;  3M62 A;  1HYI A;  1IYM A;  2LRI C;  4L7X A;  4YAT A;  3N9M A;  1U6G B;  3O47 A;  3DDT A;  3U5N A;  4MSX A;  5TDR A;  4B86 C;  2LGL A;  2H0D B;  2MA5 A;  2CRW A;  3ZTG A;  1VYX A;  2CKL A;  1G25 A;  4BHW A;  3U5P A;  2DX8 A;  1CHC A;  4V3K C;  5D1K B;  2MD8 C;  1WES A;  2VJE A;  4X3G A;  2RSD A;  2JMD A;  2LDR A;  3PHD A;  2YQM A;  2FD4 A;  1WEU A;  2MKE A;  5LKT A;  5B75 A;  2MA6 A;  2IDA A;  2M6M A;  2LQ6 A;  2DJA A;  2F6N A;  2KR4 A;  2CON A;  3M63 A;  1WE9 A;  1RMD A;  2IQJ A;  2LN0 A;  2ECW A;  1WEP A;  4I7C A;  2YRE A;  1JOC A;  2JMJ A;  2KGG A;  3LVQ E;  2EOD A;  5SVX A;  4R2Y A;  3N9N A;  2YYR A;  5B76 A;  4UP5 A;  1Z2Q A;  2MNY A;  1N87 A;  2KYU A;  4WA6 A;  2OWA A;  4AYC A;  1WEW A;  1JM7 A;  2FFW A;  3SOW A;  5AIT A;  2D8S A;  5B77 A;  2KIZ A;  1X4I A;  4WZ2 A;  5H1V A;  3L1Z B;  5DKA A;  1WIM A;  4AVX A;  5LKZ A;  5FB1 A;  1WGM A;  3FAO A;  3LQJ A;  4FIP A;  3RTR B;  3HTK C;  5SVI A;  2UZG A;  3I2D A;  3O36 A;  3KDE C;  4O64 A;  3GV4 A;  4MVT A;  2MNZ A;  4FJC A;  3N9O A;  3LQI A;  1VFY A;  3VK6 A;  3IHP A;  4I7B A;  2PNX A;  2C2L A;  1FBV A;  2VNF A;  4CCG X;  2YT5 A;  1WEE A;  2YUC A;  1E4U A;  2LXH C;  2YHN A;  2LGK A;  3O37 A;  2MIQ A;  4A4C A;  2RI7 A;  4P5O B;  5DIN A;  2K4D A;  2RR4 A;  2LGV A;  5LKX A;  2AN6 A;  4I7D A;  2JUN A;  1WFK A;  5LCW B;  3ZVZ B;  3Q1D A;  2YSM A;  4QF2 A;  3O34 A;  2JRJ A;  2XP0 A;  1X4J A;  3LQH A;  4A4B A;  1LDJ B;  2KGI A;  3LRQ A;  2I50 A;  4Q6F A;  1VD4 A;  2KE1 A;  4A49 A;  4TKP B;  2M3H A;  3C6W A;  1XWH A;  2XOY A;  2LV9 A;  2P57 A;  3FJU B;  3SOU A;  5J3X A;  5K3Q A;  2M85 A;  4YAD A;  2ECT A;  2MD7 B;  5TAB A;  4N3W A;  4V3L C;  5FER A;  1MM3 A;  4ZDT A;  3RPG B;  3QZV A;  5C13 A;  2KKX A;  2YSJ A;  1Z6U A;  2YUR A;  5H1T A;  5AIU A;  1WEO A;  2VPB A;  1ZBD B;  2EA6 A;  3O7A A;  2FUU A;  5G0F A;  2CRR A;  3O35 A;  2VPE A;  3O70 A;  3FM8 C;  3LVR E;  2F6J A;  4LAD B;  3ZNI A;  2BAY A;  2ECJ A;  2JM3 A;  2VJE B;  4BBQ A;  1MBM A;  1MM2 A;  4N4F A;  4R8P K;  2M1R A;  4W4U A;  2KU3 A;  3EB5 A;  3MHH A;  4PPE A;  3RPG C;  3T7L A;  3HCS A;  4ZQL A;  3FL2 A; 
#chains in the Genus database with same CATH homology
 3MHS A;  4WZ0 A;  3NG2 A;  2L5U A;  2ECV A;  3KV6 A;  4AUQ B;  3O33 A;  4L58 A;  5I3L A;  4C9Z A;  4YAB A;  1Z60 A;  2L75 A;  2VJF A;  1T1H A;  4CA1 A;  3KV5 A;  3V43 A;  4XI1 A;  3PUQ A;  2E6S A;  2YQL A;  2YW8 A;  2KWO A;  2K16 A;  2QIC A;  4UP0 A;  4GB0 A;  4GND A;  2CSZ A;  4B7Y C;  4GNF A;  1JM7 B;  2KFT A;  2KRE A;  2VPG A;  4WZ3 B;  3HCT A;  1K2F A;  3SOX A;  1V87 A;  3DPL R;  2VPD A;  2LXP C;  4IC2 A;  3SHB A;  5TRB A;  2H0D A;  1HYJ A;  3U5O A;  2ECN A;  4R7E A;  1BOR A;  4FO9 A;  3HCU A;  2VP7 A;  2XB1 A;  3N9P A;  3EB6 A;  5D1M B;  2ZET C;  2QIZ A;  2ECG A;  3L1X A;  2OXQ C;  2K17 A;  2HDP A;  1LDK C;  2QJ0 A;  2L0B A;  5FB0 A;  3T6R A;  5H1U A;  2C2V S;  4ZUX U;  2G45 A;  1WEM A;  1WEQ A;  4FK5 A;  2E6R A;  2CT2 A;  5C11 A;  5G04 B;  3ZYQ A;  3L11 A;  3N9Q A;  2F42 A;  5KH3 A;  5B79 A;  3ZPV 1;  5G05 B;  2CSY A;  2CKL B;  5FEY A;  4S3O B;  1WEV A;  1WEN A;  4GNE A;  2HYE D;  4LK9 A;  4YBT A;  4AP4 A;  2MUM A;  3KQI A;  3M99 A;  4GNG A;  3U5M A;  3GL6 A;  4A0C D;  5TDW A;  5B78 A;  2NAA A;  4YAX A;  4QF3 A;  3PUR A;  3ZVY A;  1WIL A;  2Y43 A;  4NN2 A;  4PTB A;  5EYA F;  5LKU A;  2ECI A;  3ASL A;  4S3O C;  5B8D A;  2JMI A;  5JG6 A;  2KWK A;  5H9M A;  4LKA A;  1FP0 A;  4LLB A;  2LGG A;  4YBS A;  2YHO A;  2Y1N A;  2G43 A;  3C5K A;  2L80 A;  2EGP A;  4IC3 A;  4UI9 B;  4AYC B;  4LJN A;  4F52 B;  2PUY A;  1X4U A;  5D1L B;  2KWJ A;  2G6Q A;  3KNV A;  2FSA A;  2XEU A;  1F62 A;  2KWN A;  1DVP A;  2Y1M A;  2VJF B;  3ZPV E;  2YU4 A;  5KH7 A;  2L43 A;  4YBM A;  5TBN A;  4YC9 A;  2MT5 A;  5KH9 A;  2K1J A;  3N9L A;  2FUI A;  3DQV R;  3M62 A;  1HYI A;  1IYM A;  2LRI C;  4L7X A;  4YAT A;  3N9M A;  1U6G B;  3U5N A;  4MSX A;  5TDR A;  4B86 C;  2LGL A;  2H0D B;  2MA5 A;  3ZTG A;  1VYX A;  2CKL A;  1G25 A;  4BHW A;  3U5P A;  2DX8 A;  1CHC A;  4V3K C;  5D1K B;  2MD8 C;  1WES A;  2VJE A;  4X3G A;  2RSD A;  2JMD A;  2LDR A;  3PHD A;  2YQM A;  1WEU A;  5LKT A;  5B75 A;  2MA6 A;  2IDA A;  2M6M A;  2LQ6 A;  2F6N A;  2KR4 A;  3M63 A;  1WE9 A;  1RMD A;  2LN0 A;  2ECW A;  1WEP A;  4I7C A;  2YRE A;  1JOC A;  2JMJ A;  2KGG A;  2EOD A;  4R2Y A;  3N9N A;  2YYR A;  5B76 A;  4UP5 A;  1Z2Q A;  2MNY A;  1N87 A;  2KYU A;  4WA6 A;  4AYC A;  1WEW A;  1JM7 A;  3SOW A;  5AIT A;  2D8S A;  5B77 A;  2KIZ A;  1X4I A;  4WZ2 A;  5H1V A;  3L1Z B;  5DKA A;  1WIM A;  4AVX A;  5LKZ A;  5FB1 A;  1WGM A;  3LQJ A;  4FIP A;  3RTR B;  3HTK C;  2UZG A;  3I2D A;  3O36 A;  4O64 A;  3GV4 A;  4MVT A;  2MNZ A;  4FJC A;  3N9O A;  3LQI A;  1VFY A;  3VK6 A;  3IHP A;  4I7B A;  2PNX A;  2C2L A;  1FBV A;  2VNF A;  4CCG X;  2YT5 A;  1WEE A;  2YUC A;  1E4U A;  2LXH C;  2YHN A;  2LGK A;  3O37 A;  2MIQ A;  4A4C A;  2RI7 A;  4P5O B;  5DIN A;  2K4D A;  2LGV A;  5LKX A;  2AN6 A;  4I7D A;  1WFK A;  5LCW B;  3ZVZ B;  2YSM A;  4QF2 A;  3O34 A;  2JRJ A;  1X4J A;  3LQH A;  4A4B A;  1LDJ B;  2KGI A;  3LRQ A;  2I50 A;  4Q6F A;  1VD4 A;  2KE1 A;  4A49 A;  4TKP B;  2M3H A;  3C6W A;  1XWH A;  2LV9 A;  3SOU A;  5J3X A;  2M85 A;  4YAD A;  2ECT A;  2MD7 B;  5TAB A;  4N3W A;  4V3L C;  5FER A;  1MM3 A;  4ZDT A;  3RPG B;  3QZV A;  5C13 A;  2YSJ A;  1Z6U A;  2YUR A;  5H1T A;  5AIU A;  1WEO A;  2VPB A;  1ZBD B;  2EA6 A;  3O7A A;  2FUU A;  5G0F A;  3O35 A;  2VPE A;  3O70 A;  2F6J A;  4LAD B;  3ZNI A;  2BAY A;  2ECJ A;  2VJE B;  4BBQ A;  1MM2 A;  4N4F A;  4R8P K;  2M1R A;  4W4U A;  2KU3 A;  3EB5 A;  3MHH A;  4PPE A;  3RPG C;  3T7L A;  3HCS A;  4ZQL A;  3FL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...