5KH9A

Crystal structure of a low occupancy fragment candidate (5-[(4-isopropylphenyl)amino]-6-methyl-1,2,4-triazin-3(2h)-one) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone deacetylase 6
publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 30
structure length 100
sequence length 100
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh9A00
4GNGA 1JOCA 2K1JA 5TDRA 4TKPB 1FBVA 2LXPC 3DQVR 2KR4A 5G04B 2VP7A 4QF2A 5B79A 2YYRA 3RPGB 3VK6A 2UZGA 2LQ6A 4LADB 2FUIA 1VD4A 2KGGA 2C2VS 2LGVA 4AUQB 1WENA 4YABA 3M99A 2F42A 5TDWA 1WGMA 2PUYA 3ZPVE 4C9ZA 5C11A 5B77A 5H1UA 5B75A 5H1TA 1JM7B 2C2LA 4YBMA 4R8PK 4YC9A 4IC2A 3T6RA 4YBTA 5KH9A 3ZNIA 3U5NA 3U5MA 1N87A 2CT2A 2RI7A 4GNFA 2MIQA 2LN0A 2F6NA 1MM3A 3N9NA 2YHOA 1F62A 2M1RA 2G6QA 3NG2A 1WEMA 4FO9A 3HCUA 3O37A 2L0BA 1Z6UA 2YW8A 5B76A 2CKLB 3N9PA 2L43A 3C6WA 4FK5A 2JRJA 4NN2A 4MSXA 2E6SA 4LK9A 1LDJB 3SOXA 3FL2A 4A4CA 2MT5A 2YT5A 5LKZA 1RMDA 3T7LA 5KH3A 4A4BA 5LKTA 3MHSA 5H1VA 4V3KC 4ZUXU 3L1ZB 4WZ3B 2JMIA 2KFTA 4QF3A 5DKAA 4R7EA 3EB6A 2CSZA 2DX8A 2IDAA 3O33A 3O35A 1WEUA 2LGLA 2VJFB 2MD7B 2G43A 3N9LA 1DVPA 4YADA 2ZETC 2D8SA 1LDKC 2PNXA 1WFKA 2YU4A 3KV5A 2ECIA 1WEOA 5D1LB 3I2DA 5G0FA 2MA6A 1WEQA 5JG6A 5B8DA 1JM7A 3RPGC 3ZPV1 4AYCB 2LRIC 2XB1A 2VPGA 2NAAA 1HYIA 2M6MA 2L80A 1IYMA 5LKUA 2VPEA 3LQHA 1FP0A 4PTBA 3L1XA 5H9MA 2L5UA 2QIZA 2VJEB 4LLBA 2YHNA 3KV6A 2CKLA 3O7AA 2BAYA 2MA5A 4MVTA 4AP4A 3M62A 3EB5A 3SOWA 2K4DA 4N3WA 2Y1NA 2FSAA 1HYJA 3O34A 3RTRB 5D1KB 4AVXA 2KE1A 2VNFA 3KQIA 2LGGA 2AN6A 4S3OB 1X4JA 5DINA 4GB0A 2KREA 2KU3A 4B7YC 3ZVZB 1G25A 4I7DA 5EYAF 2OXQC 2VJFA 2KWOA 3N9QA 1WEWA 4B86C 3SHBA 1Z60A 3N9MA 1X4UA 3QZVA 2FUUA 3PHDA 2I50A 2KWKA 3DPLR 1WEEA 3LQIA 2RSDA 4UP5A 2HDPA 4YATA 1K2FA 5C13A 1WILA 3HCSA 4AYCA 4W4UA 3GL6A 2HYED 2H0DB 5FB1A 2LXHC 2Y43A 2KWJA 1VYXA 2JMDA 1V87A 3LRQA 2MD8C 2YQLA 4BBQA 2KGIA 1WIMA 2VJEA 1T1HA 4XI1A 4WZ2A 2KIZA 2YSMA 4CCGX 3LQJA 2ECVA 3HCTA 4BHWA 4R2YA 3M63A 4L58A 4A0CD 2EODA 4WZ0A 3GV4A 4CA1A 3U5OA 2LGKA 2G45A 2VPDA 3ZYQA 2MNZA 3PUQA 2JMJA 2M85A 2YSJA 3ZTGA 5I3LA 5G05B 5B78A 4Q6FA 4FIPA 5FB0A 1WE9A 3IHPA 2KYUA 4PPEA 5AIUA 2EGPA 1MM2A 3ZVYA 2ECWA 1WEVA 2M3HA 4LKAA 1XWHA 5J3XA 2F6JA 5FEYA 3MHHA 5TRBA 2K17A 4YAXA 2L75A 2LDRA 3PURA 2XEUA 1E4UA 5AITA 3SOUA 4S3OC 5LKXA 4GNDA 5TBNA 4WA6A 2H0DA 4O64A 4V3LC 4N4FA 2VPBA 1X4IA 2QJ0A 2EA6A 3V43A 4IC3A 4A49A 5FERA 1BORA 2ECGA 1U6GB 2YUCA 4P5OB 2YURA 1Z2QA 2KWNA 3O36A 2ECNA 1CHCA 2E6RA 4FJCA 3HTKC 3U5PA 3L11A 4I7CA 3C5KA 1ZBDB 4LJNA 2QICA 4F52B 4L7XA 4UI9B 1WESA 3KNVA 4ZQLA 2YREA 3O70A 2ECJA 1WEPA 2YQMA 5LCWB 5KH7A 2CSYA 2MUMA 1VFYA 2LV9A 4UP0A 5D1MB 3N9OA 4YBSA 4X3GA 2ECTA 4I7BA 2K16A 2MNYA 2Y1MA 4ZDTA 4GNEA 5TABA 3ASLA
chains in the Genus database with same CATH superfamily
4GNGA 1JOCA 2XOCA 2K1JA 5TDRA 4TKPB 1FBVA 2LXPC 3DQVR 2KR4A 5G04B 2VP7A 4QF2A 5B79A 2YYRA 3RPGB 3VK6A 2UZGA 2LQ6A 4LADB 2FUIA 3DWDA 1VD4A 2KGGA 3LJUX 2C2VS 2LGVA 4AUQB 2MKEA 1WENA 4YABA 3M99A 2F42A 5TDWA 1WGMA 2PUYA 3ZPVE 4C9ZA 5C11A 5B77A 5H1UA 5B75A 5H1TA 1JM7B 2C2LA 4YBMA 4R8PK 4YC9A 4IC2A 2B0OE 3T6RA 2CRRA 4YBTA 5KH9A 3ZNIA 3U5NA 3U5MA 1N87A 5SVIA 2CT2A 2RI7A 4GNFA 2D8UA 2MIQA 2LN0A 2F6NA 1MM3A 3N9NA 2YHOA 1F62A 2M1RA 2G6QA 3NG2A 1WEMA 3FANA 4FO9A 2M13A 3HCUA 3O37A 2L0BA 4H9DA 1Z6UA 2YW8A 5B76A 2CKLB 3N9PA 2L43A 3C6WA 4FK5A 2JRJA 4NN2A 4MSXA 2E6SA 4LK9A 1LDJB 3FL2A 3SOXA 4A4CA 2MT5A 2YT5A 5LKZA 1RMDA 3T7LA 5KH3A 4A4BA 5LKTA 3MHSA 5H1VA 4V3KC 4ZUXU 3L1ZB 4WZ3B 2JMIA 2KFTA 4QF3A 5DKAA 3EB6A 2CSZA 2DX8A 2IDAA 3O33A 3O35A 5SVYA 1WEUA 2LGLA 2VJFB 2MD7B 2G43A 2JUNA 3N9LA 1DVPA 2RR4A 4YADA 2ZETC 2D8SA 1LDKC 3MDBC 2PNXA 1WFKA 2YU4A 3KV5A 2ECIA 1WEOA 5D1LB 3I2DA 5G0FA 2MA6A 2LAUA 1WEQA 5JG6A 5B8DA 1JM7A 4Z0RA 3RPGC 3ZPV1 4AYCB 4QQ4A 2LRIC 2XB1A 2VPGA 2NAAA 1HYIA 2M6MA 2L80A 1IYMA 5LKUA 2VPEA 3KDEC 4F1PA 3LQHA 2KKYA 1FP0A 4PTBA 3L1XA 5H9MA 2L5UA 2QIZA 2VJEB 4LLBA 2YHNA 3KV6A 2CKLA 3O7AA 2BAYA 2MA5A 4MVTA 3E2DA 4AP4A 3M62A 3EB5A 3SOWA 2K4DA 2CONA 4O62A 2EXUA 4N3WA 2Y1NA 2FSAA 1HYJA 3O34A 3RTRB 5D1KB 4AVXA 2KE1A 3LDYA 2VNFA 3KQIA 2LGGA 2AN6A 4S3OB 1X4JA 5DINA 4GB0A 2KREA 2KU3A 4B7YC 3ZVZB 1G25A 4I7DA 5EYAF 2OXQC 2VJFA 2KWOA 5TABA 3N9QA 1WEWA 3LVRE 4B86C 3SHBA 1Z60A 3N9MA 1X4UA 3QZVA 2FUUA 3PHDA 2I50A 1DCQA 2KWKA 2XOZA 3DPLR 1WEEA 2DSMA 3LQIA 2RSDA 5SVXA 3SUBA 4UP5A 2HDPA 4YATA 1K2FA 5C13A 1WILA 3HCSA 4AYCA 4W4UA 3GL6A 2HYED 3FEHA 2H0DB 5FB1A 2LXHC 2Y43A 2KWJA 1VYXA 2DJAA 2JMDA 1V87A 3LRQA 2MD8C 2YQLA 4BBQA 2KGIA 1WIMA 2EGMA 2VJEA 1T1HA 2CRWA 4XI1A 2CSVA 2FFWA 4WZ2A 2KIZA 2YSMA 3PLWA 4CCGX 3LQJA 2ECVA 2XP0A 3HCTA 4BHWA 4R2YA 3M63A 4L58A 4A0CD 2EODA 4WZ0A 3GV4A 4CA1A 2JM3A 3U5OA 2LGKA 2G45A 2VPDA 2P57A 3ZYQA 2MNZA 2OWAA 3PUQA 2JMJA 2M85A 2YSJA 3LVQE 4Z0OA 3ZTGA 5I3LA 5G05B 5B78A 4OGCA 4Q6FA 3H7HA 4FIPA 5FB0A 1WE9A 2E61A 3IHPA 2KYUA 4PPEA 5AIUA 2EGPA 1MM2A 3ZVYA 2ECWA 3M7KA 1WEVA 3FJUB 2M3HA 4LKAA 1XWHA 5J3XA 2F6JA 5FEYA 3MHHA 5TRBA 2K17A 2XOYA 4YAXA 2L75A 2IQJA 2LDRA 3PURA 2XEUA 1E4UA 5AITA 3SOUA 4S3OC 3FM8C 2L7PA 4OGEA 5LKXA 4GNDA 5TBNA 4WA6A 2H0DA 4O64A 2KKXA 3JUEA 4V3LC 4N4FA 2VPBA 1X4IA 2QJ0A 2EA6A 3V43A 4IC3A 4A49A 2FD4A 5FERA 1BORA 2ECGA 1U6GB 2YUCA 4P5OB 2YURA 1Z2QA 2KWNA 3O36A 2ECNA 1CHCA 4FJCA 2E6RA 3HTKC 3U5PA 3L11A 4I7CA 3C5KA 1ZBDB 4LJNA 2QICA 3O47A 4F52B 4L7XA 4UI9B 1WESA 5SVIB 3KNVA 4ZQLA 2YREA 3O70A 2ECJA 1WEPA 3Q1DA 2YQMA 5LCWB 5KH7A 2CSYA 2MUMA 1VFYA 2LV9A 4UP0A 3DDTA 2YVRA 5D1MB 3N9OA 4YBSA 4X3GA 3T9KA 3FAOA 2ECTA 4I7BA 2K16A 2MNYA 2Y1MA 5K3QA 4ZDTA 1MBMA 4GNEA 4R7EA 3ASLA
chains in the Genus database with same CATH topology
4GNGA 1JOCA 2K1JA 5TDRA 4TKPB 1FBVA 2LXPC 3DQVR 2KR4A 5G04B 2VP7A 4QF2A 5B79A 2YYRA 3RPGB 3VK6A 2UZGA 2LQ6A 4LADB 2FUIA 1VD4A 2KGGA 2C2VS 2LGVA 4AUQB 1WENA 4YABA 3M99A 2F42A 5TDWA 1WGMA 2PUYA 3ZPVE 4C9ZA 5C11A 5B77A 5H1UA 5B75A 5H1TA 1JM7B 2C2LA 4YBMA 4R8PK 4YC9A 4IC2A 3T6RA 4YBTA 5KH9A 3ZNIA 3U5NA 3U5MA 1N87A 2CT2A 2RI7A 4GNFA 2MIQA 2LN0A 2F6NA 1MM3A 3N9NA 2YHOA 1F62A 2M1RA 2G6QA 3NG2A 1WEMA 4FO9A 3HCUA 3O37A 2L0BA 1Z6UA 2YW8A 5B76A 2CKLB 3N9PA 2L43A 3C6WA 4FK5A 2JRJA 4NN2A 4MSXA 2E6SA 4LK9A 1LDJB 3SOXA 3FL2A 4A4CA 2MT5A 2YT5A 5LKZA 1RMDA 3T7LA 5KH3A 4A4BA 5LKTA 3MHSA 5H1VA 4V3KC 4ZUXU 3L1ZB 4WZ3B 2JMIA 2KFTA 4QF3A 5DKAA 4R7EA 3EB6A 2CSZA 2DX8A 2IDAA 3O33A 3O35A 1WEUA 2LGLA 2VJFB 2MD7B 2G43A 3N9LA 1DVPA 4YADA 2ZETC 2D8SA 1LDKC 2PNXA 1WFKA 2YU4A 3KV5A 2ECIA 1WEOA 5D1LB 3I2DA 5G0FA 2MA6A 1WEQA 5JG6A 5B8DA 1JM7A 3RPGC 3ZPV1 4AYCB 2LRIC 2XB1A 2VPGA 2NAAA 1HYIA 2M6MA 2L80A 1IYMA 5LKUA 2VPEA 3LQHA 1FP0A 4PTBA 3L1XA 5H9MA 2L5UA 2QIZA 2VJEB 4LLBA 2YHNA 3KV6A 2CKLA 3O7AA 2BAYA 2MA5A 4MVTA 4AP4A 3M62A 3EB5A 3SOWA 2K4DA 4N3WA 2Y1NA 2FSAA 1HYJA 3O34A 3RTRB 5D1KB 4AVXA 2KE1A 2VNFA 3KQIA 2LGGA 2AN6A 4S3OB 1X4JA 5DINA 4GB0A 2KREA 2KU3A 4B7YC 3ZVZB 1G25A 4I7DA 5EYAF 2OXQC 2VJFA 2KWOA 3N9QA 1WEWA 4B86C 3SHBA 1Z60A 3N9MA 1X4UA 3QZVA 2FUUA 3PHDA 2I50A 2KWKA 3DPLR 1WEEA 3LQIA 2RSDA 4UP5A 2HDPA 4YATA 1K2FA 5C13A 1WILA 3HCSA 4AYCA 4W4UA 3GL6A 2HYED 2H0DB 5FB1A 2LXHC 2Y43A 2KWJA 1VYXA 2JMDA 1V87A 3LRQA 2MD8C 2YQLA 4BBQA 2KGIA 1WIMA 2VJEA 1T1HA 4XI1A 4WZ2A 2KIZA 2YSMA 4CCGX 3LQJA 2ECVA 3HCTA 4BHWA 4R2YA 3M63A 4L58A 4A0CD 2EODA 4WZ0A 3GV4A 4CA1A 3U5OA 2LGKA 2G45A 2VPDA 3ZYQA 2MNZA 3PUQA 2JMJA 2M85A 2YSJA 3ZTGA 5I3LA 5G05B 5B78A 4Q6FA 4FIPA 5FB0A 1WE9A 3IHPA 2KYUA 4PPEA 5AIUA 2EGPA 1MM2A 3ZVYA 2ECWA 1WEVA 2M3HA 4LKAA 1XWHA 5J3XA 2F6JA 5FEYA 3MHHA 5TRBA 2K17A 4YAXA 2L75A 2LDRA 3PURA 2XEUA 1E4UA 5AITA 3SOUA 4S3OC 5LKXA 4GNDA 5TBNA 4WA6A 2H0DA 4O64A 4V3LC 4N4FA 2VPBA 1X4IA 2QJ0A 2EA6A 3V43A 4IC3A 4A49A 5FERA 1BORA 2ECGA 1U6GB 2YUCA 4P5OB 2YURA 1Z2QA 2KWNA 3O36A 2ECNA 1CHCA 2E6RA 4FJCA 3HTKC 3U5PA 3L11A 4I7CA 3C5KA 1ZBDB 4LJNA 2QICA 4F52B 4L7XA 4UI9B 1WESA 3KNVA 4ZQLA 2YREA 3O70A 2ECJA 1WEPA 2YQMA 5LCWB 5KH7A 2CSYA 2MUMA 1VFYA 2LV9A 4UP0A 5D1MB 3N9OA 4YBSA 4X3GA 2ECTA 4I7BA 2K16A 2MNYA 2Y1MA 4ZDTA 4GNEA 5TABA 3ASLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNG A;  1JOC A;  2K1J A;  5TDR A;  4TKP B;  1FBV A;  2LXP C;  3DQV R;  2KR4 A;  5G04 B;  2VP7 A;  4QF2 A;  5B79 A;  2YYR A;  3RPG B;  3VK6 A;  2UZG A;  2LQ6 A;  4LAD B;  2FUI A;  1VD4 A;  2KGG A;  2C2V S;  2LGV A;  4AUQ B;  1WEN A;  4YAB A;  3M99 A;  2F42 A;  5TDW A;  1WGM A;  2PUY A;  3ZPV E;  4C9Z A;  5C11 A;  5B77 A;  5H1U A;  5B75 A;  5H1T A;  1JM7 B;  2C2L A;  4YBM A;  4R8P K;  4YC9 A;  4IC2 A;  3T6R A;  4YBT A;  5KH9 A;  3ZNI A;  3U5N A;  3U5M A;  1N87 A;  2CT2 A;  2RI7 A;  4GNF A;  2MIQ A;  2LN0 A;  2F6N A;  1MM3 A;  3N9N A;  2YHO A;  1F62 A;  2M1R A;  2G6Q A;  3NG2 A;  1WEM A;  4FO9 A;  3HCU A;  3O37 A;  2L0B A;  1Z6U A;  2YW8 A;  5B76 A;  2CKL B;  3N9P A;  2L43 A;  3C6W A;  4FK5 A;  2JRJ A;  4NN2 A;  4MSX A;  2E6S A;  4LK9 A;  1LDJ B;  3SOX A;  3FL2 A;  4A4C A;  2MT5 A;  2YT5 A;  5LKZ A;  1RMD A;  3T7L A;  5KH3 A;  4A4B A;  5LKT A;  3MHS A;  5H1V A;  4V3K C;  4ZUX U;  3L1Z B;  4WZ3 B;  2JMI A;  2KFT A;  4QF3 A;  5DKA A;  4R7E A;  3EB6 A;  2CSZ A;  2DX8 A;  2IDA A;  3O33 A;  3O35 A;  1WEU A;  2LGL A;  2VJF B;  2MD7 B;  2G43 A;  3N9L A;  1DVP A;  4YAD A;  2ZET C;  2D8S A;  1LDK C;  2PNX A;  1WFK A;  2YU4 A;  3KV5 A;  2ECI A;  1WEO A;  5D1L B;  3I2D A;  5G0F A;  2MA6 A;  1WEQ A;  5JG6 A;  5B8D A;  1JM7 A;  3RPG C;  3ZPV 1;  4AYC B;  2LRI C;  2XB1 A;  2VPG A;  2NAA A;  1HYI A;  2M6M A;  2L80 A;  1IYM A;  5LKU A;  2VPE A;  3LQH A;  1FP0 A;  4PTB A;  3L1X A;  5H9M A;  2L5U A;  2QIZ A;  2VJE B;  4LLB A;  2YHN A;  3KV6 A;  2CKL A;  3O7A A;  2BAY A;  2MA5 A;  4MVT A;  4AP4 A;  3M62 A;  3EB5 A;  3SOW A;  2K4D A;  4N3W A;  2Y1N A;  2FSA A;  1HYJ A;  3O34 A;  3RTR B;  5D1K B;  4AVX A;  2KE1 A;  2VNF A;  3KQI A;  2LGG A;  2AN6 A;  4S3O B;  1X4J A;  5DIN A;  4GB0 A;  2KRE A;  2KU3 A;  4B7Y C;  3ZVZ B;  1G25 A;  4I7D A;  5EYA F;  2OXQ C;  2VJF A;  2KWO A;  3N9Q A;  1WEW A;  4B86 C;  3SHB A;  1Z60 A;  3N9M A;  1X4U A;  3QZV A;  2FUU A;  3PHD A;  2I50 A;  2KWK A;  3DPL R;  1WEE A;  3LQI A;  2RSD A;  4UP5 A;  2HDP A;  4YAT A;  1K2F A;  5C13 A;  1WIL A;  3HCS A;  4AYC A;  4W4U A;  3GL6 A;  2HYE D;  2H0D B;  5FB1 A;  2LXH C;  2Y43 A;  2KWJ A;  1VYX A;  2JMD A;  1V87 A;  3LRQ A;  2MD8 C;  2YQL A;  4BBQ A;  2KGI A;  1WIM A;  2VJE A;  1T1H A;  4XI1 A;  4WZ2 A;  2KIZ A;  2YSM A;  4CCG X;  3LQJ A;  2ECV A;  3HCT A;  4BHW A;  4R2Y A;  3M63 A;  4L58 A;  4A0C D;  2EOD A;  4WZ0 A;  3GV4 A;  4CA1 A;  3U5O A;  2LGK A;  2G45 A;  2VPD A;  3ZYQ A;  2MNZ A;  3PUQ A;  2JMJ A;  2M85 A;  2YSJ A;  3ZTG A;  5I3L A;  5G05 B;  5B78 A;  4Q6F A;  4FIP A;  5FB0 A;  1WE9 A;  3IHP A;  2KYU A;  4PPE A;  5AIU A;  2EGP A;  1MM2 A;  3ZVY A;  2ECW A;  1WEV A;  2M3H A;  4LKA A;  1XWH A;  5J3X A;  2F6J A;  5FEY A;  3MHH A;  5TRB A;  2K17 A;  4YAX A;  2L75 A;  2LDR A;  3PUR A;  2XEU A;  1E4U A;  5AIT A;  3SOU A;  4S3O C;  5LKX A;  4GND A;  5TBN A;  4WA6 A;  2H0D A;  4O64 A;  4V3L C;  4N4F A;  2VPB A;  1X4I A;  2QJ0 A;  2EA6 A;  3V43 A;  4IC3 A;  4A49 A;  5FER A;  1BOR A;  2ECG A;  1U6G B;  2YUC A;  4P5O B;  2YUR A;  1Z2Q A;  2KWN A;  3O36 A;  2ECN A;  1CHC A;  2E6R A;  4FJC A;  3HTK C;  3U5P A;  3L11 A;  4I7C A;  3C5K A;  1ZBD B;  4LJN A;  2QIC A;  4F52 B;  4L7X A;  4UI9 B;  1WES A;  3KNV A;  4ZQL A;  2YRE A;  3O70 A;  2ECJ A;  1WEP A;  2YQM A;  5LCW B;  5KH7 A;  2CSY A;  2MUM A;  1VFY A;  2LV9 A;  4UP0 A;  5D1M B;  3N9O A;  4YBS A;  4X3G A;  2ECT A;  4I7B A;  2K16 A;  2MNY A;  2Y1M A;  4ZDT A;  4GNE A;  5TAB A;  3ASL A; 
#chains in the Genus database with same CATH topology
 4GNG A;  1JOC A;  2XOC A;  2K1J A;  5TDR A;  4TKP B;  1FBV A;  2LXP C;  3DQV R;  2KR4 A;  5G04 B;  2VP7 A;  4QF2 A;  5B79 A;  2YYR A;  3RPG B;  3VK6 A;  2UZG A;  2LQ6 A;  4LAD B;  2FUI A;  3DWD A;  1VD4 A;  2KGG A;  3LJU X;  2C2V S;  2LGV A;  4AUQ B;  2MKE A;  1WEN A;  4YAB A;  3M99 A;  2F42 A;  5TDW A;  1WGM A;  2PUY A;  3ZPV E;  4C9Z A;  5C11 A;  5B77 A;  5H1U A;  5B75 A;  5H1T A;  1JM7 B;  2C2L A;  4YBM A;  4R8P K;  4YC9 A;  4IC2 A;  2B0O E;  3T6R A;  2CRR A;  4YBT A;  5KH9 A;  3ZNI A;  3U5N A;  3U5M A;  1N87 A;  5SVI A;  2CT2 A;  2RI7 A;  4GNF A;  2D8U A;  2MIQ A;  2LN0 A;  2F6N A;  1MM3 A;  3N9N A;  2YHO A;  1F62 A;  2M1R A;  2G6Q A;  3NG2 A;  1WEM A;  3FAN A;  4FO9 A;  2M13 A;  3HCU A;  3O37 A;  2L0B A;  4H9D A;  1Z6U A;  2YW8 A;  5B76 A;  2CKL B;  3N9P A;  2L43 A;  3C6W A;  4FK5 A;  2JRJ A;  4NN2 A;  4MSX A;  2E6S A;  4LK9 A;  1LDJ B;  3FL2 A;  3SOX A;  4A4C A;  2MT5 A;  2YT5 A;  5LKZ A;  1RMD A;  3T7L A;  5KH3 A;  4A4B A;  5LKT A;  3MHS A;  5H1V A;  4V3K C;  4ZUX U;  3L1Z B;  4WZ3 B;  2JMI A;  2KFT A;  4QF3 A;  5DKA A;  3EB6 A;  2CSZ A;  2DX8 A;  2IDA A;  3O33 A;  3O35 A;  5SVY A;  1WEU A;  2LGL A;  2VJF B;  2MD7 B;  2G43 A;  2JUN A;  3N9L A;  1DVP A;  2RR4 A;  4YAD A;  2ZET C;  2D8S A;  1LDK C;  3MDB C;  2PNX A;  1WFK A;  2YU4 A;  3KV5 A;  2ECI A;  1WEO A;  5D1L B;  3I2D A;  5G0F A;  2MA6 A;  2LAU A;  1WEQ A;  5JG6 A;  5B8D A;  1JM7 A;  4Z0R A;  3RPG C;  3ZPV 1;  4AYC B;  4QQ4 A;  2LRI C;  2XB1 A;  2VPG A;  2NAA A;  1HYI A;  2M6M A;  2L80 A;  1IYM A;  5LKU A;  2VPE A;  3KDE C;  4F1P A;  3LQH A;  2KKY A;  1FP0 A;  4PTB A;  3L1X A;  5H9M A;  2L5U A;  2QIZ A;  2VJE B;  4LLB A;  2YHN A;  3KV6 A;  2CKL A;  3O7A A;  2BAY A;  2MA5 A;  4MVT A;  3E2D A;  4AP4 A;  3M62 A;  3EB5 A;  3SOW A;  2K4D A;  2CON A;  4O62 A;  2EXU A;  4N3W A;  2Y1N A;  2FSA A;  1HYJ A;  3O34 A;  3RTR B;  5D1K B;  4AVX A;  2KE1 A;  3LDY A;  2VNF A;  3KQI A;  2LGG A;  2AN6 A;  4S3O B;  1X4J A;  5DIN A;  4GB0 A;  2KRE A;  2KU3 A;  4B7Y C;  3ZVZ B;  1G25 A;  4I7D A;  5EYA F;  2OXQ C;  2VJF A;  2KWO A;  5TAB A;  3N9Q A;  1WEW A;  3LVR E;  4B86 C;  3SHB A;  1Z60 A;  3N9M A;  1X4U A;  3QZV A;  2FUU A;  3PHD A;  2I50 A;  1DCQ A;  2KWK A;  2XOZ A;  3DPL R;  1WEE A;  2DSM A;  3LQI A;  2RSD A;  5SVX A;  3SUB A;  4UP5 A;  2HDP A;  4YAT A;  1K2F A;  5C13 A;  1WIL A;  3HCS A;  4AYC A;  4W4U A;  3GL6 A;  2HYE D;  3FEH A;  2H0D B;  5FB1 A;  2LXH C;  2Y43 A;  2KWJ A;  1VYX A;  2DJA A;  2JMD A;  1V87 A;  3LRQ A;  2MD8 C;  2YQL A;  4BBQ A;  2KGI A;  1WIM A;  2EGM A;  2VJE A;  1T1H A;  2CRW A;  4XI1 A;  2CSV A;  2FFW A;  4WZ2 A;  2KIZ A;  2YSM A;  3PLW A;  4CCG X;  3LQJ A;  2ECV A;  2XP0 A;  3HCT A;  4BHW A;  4R2Y A;  3M63 A;  4L58 A;  4A0C D;  2EOD A;  4WZ0 A;  3GV4 A;  4CA1 A;  2JM3 A;  3U5O A;  2LGK A;  2G45 A;  2VPD A;  2P57 A;  3ZYQ A;  2MNZ A;  2OWA A;  3PUQ A;  2JMJ A;  2M85 A;  2YSJ A;  3LVQ E;  4Z0O A;  3ZTG A;  5I3L A;  5G05 B;  5B78 A;  4OGC A;  4Q6F A;  3H7H A;  4FIP A;  5FB0 A;  1WE9 A;  2E61 A;  3IHP A;  2KYU A;  4PPE A;  5AIU A;  2EGP A;  1MM2 A;  3ZVY A;  2ECW A;  3M7K A;  1WEV A;  3FJU B;  2M3H A;  4LKA A;  1XWH A;  5J3X A;  2F6J A;  5FEY A;  3MHH A;  5TRB A;  2K17 A;  2XOY A;  4YAX A;  2L75 A;  2IQJ A;  2LDR A;  3PUR A;  2XEU A;  1E4U A;  5AIT A;  3SOU A;  4S3O C;  3FM8 C;  2L7P A;  4OGE A;  5LKX A;  4GND A;  5TBN A;  4WA6 A;  2H0D A;  4O64 A;  2KKX A;  3JUE A;  4V3L C;  4N4F A;  2VPB A;  1X4I A;  2QJ0 A;  2EA6 A;  3V43 A;  4IC3 A;  4A49 A;  2FD4 A;  5FER A;  1BOR A;  2ECG A;  1U6G B;  2YUC A;  4P5O B;  2YUR A;  1Z2Q A;  2KWN A;  3O36 A;  2ECN A;  1CHC A;  4FJC A;  2E6R A;  3HTK C;  3U5P A;  3L11 A;  4I7C A;  3C5K A;  1ZBD B;  4LJN A;  2QIC A;  3O47 A;  4F52 B;  4L7X A;  4UI9 B;  1WES A;  5SVI B;  3KNV A;  4ZQL A;  2YRE A;  3O70 A;  2ECJ A;  1WEP A;  3Q1D A;  2YQM A;  5LCW B;  5KH7 A;  2CSY A;  2MUM A;  1VFY A;  2LV9 A;  4UP0 A;  3DDT A;  2YVR A;  5D1M B;  3N9O A;  4YBS A;  4X3G A;  3T9K A;  3FAO A;  2ECT A;  4I7B A;  2K16 A;  2MNY A;  2Y1M A;  5K3Q A;  4ZDT A;  1MBM A;  4GNE A;  4R7E A;  3ASL A; 
#chains in the Genus database with same CATH homology
 4GNG A;  1JOC A;  2K1J A;  5TDR A;  4TKP B;  1FBV A;  2LXP C;  3DQV R;  2KR4 A;  5G04 B;  2VP7 A;  4QF2 A;  5B79 A;  2YYR A;  3RPG B;  3VK6 A;  2UZG A;  2LQ6 A;  4LAD B;  2FUI A;  1VD4 A;  2KGG A;  2C2V S;  2LGV A;  4AUQ B;  1WEN A;  4YAB A;  3M99 A;  2F42 A;  5TDW A;  1WGM A;  2PUY A;  3ZPV E;  4C9Z A;  5C11 A;  5B77 A;  5H1U A;  5B75 A;  5H1T A;  1JM7 B;  2C2L A;  4YBM A;  4R8P K;  4YC9 A;  4IC2 A;  3T6R A;  4YBT A;  5KH9 A;  3ZNI A;  3U5N A;  3U5M A;  1N87 A;  2CT2 A;  2RI7 A;  4GNF A;  2MIQ A;  2LN0 A;  2F6N A;  1MM3 A;  3N9N A;  2YHO A;  1F62 A;  2M1R A;  2G6Q A;  3NG2 A;  1WEM A;  4FO9 A;  3HCU A;  3O37 A;  2L0B A;  1Z6U A;  2YW8 A;  5B76 A;  2CKL B;  3N9P A;  2L43 A;  3C6W A;  4FK5 A;  2JRJ A;  4NN2 A;  4MSX A;  2E6S A;  4LK9 A;  1LDJ B;  3SOX A;  3FL2 A;  4A4C A;  2MT5 A;  2YT5 A;  5LKZ A;  1RMD A;  3T7L A;  5KH3 A;  4A4B A;  5LKT A;  3MHS A;  5H1V A;  4V3K C;  4ZUX U;  3L1Z B;  4WZ3 B;  2JMI A;  2KFT A;  4QF3 A;  5DKA A;  4R7E A;  3EB6 A;  2CSZ A;  2DX8 A;  2IDA A;  3O33 A;  3O35 A;  1WEU A;  2LGL A;  2VJF B;  2MD7 B;  2G43 A;  3N9L A;  1DVP A;  4YAD A;  2ZET C;  2D8S A;  1LDK C;  2PNX A;  1WFK A;  2YU4 A;  3KV5 A;  2ECI A;  1WEO A;  5D1L B;  3I2D A;  5G0F A;  2MA6 A;  1WEQ A;  5JG6 A;  5B8D A;  1JM7 A;  3RPG C;  3ZPV 1;  4AYC B;  2LRI C;  2XB1 A;  2VPG A;  2NAA A;  1HYI A;  2M6M A;  2L80 A;  1IYM A;  5LKU A;  2VPE A;  3LQH A;  1FP0 A;  4PTB A;  3L1X A;  5H9M A;  2L5U A;  2QIZ A;  2VJE B;  4LLB A;  2YHN A;  3KV6 A;  2CKL A;  3O7A A;  2BAY A;  2MA5 A;  4MVT A;  4AP4 A;  3M62 A;  3EB5 A;  3SOW A;  2K4D A;  4N3W A;  2Y1N A;  2FSA A;  1HYJ A;  3O34 A;  3RTR B;  5D1K B;  4AVX A;  2KE1 A;  2VNF A;  3KQI A;  2LGG A;  2AN6 A;  4S3O B;  1X4J A;  5DIN A;  4GB0 A;  2KRE A;  2KU3 A;  4B7Y C;  3ZVZ B;  1G25 A;  4I7D A;  5EYA F;  2OXQ C;  2VJF A;  2KWO A;  3N9Q A;  1WEW A;  4B86 C;  3SHB A;  1Z60 A;  3N9M A;  1X4U A;  3QZV A;  2FUU A;  3PHD A;  2I50 A;  2KWK A;  3DPL R;  1WEE A;  3LQI A;  2RSD A;  4UP5 A;  2HDP A;  4YAT A;  1K2F A;  5C13 A;  1WIL A;  3HCS A;  4AYC A;  4W4U A;  3GL6 A;  2HYE D;  2H0D B;  5FB1 A;  2LXH C;  2Y43 A;  2KWJ A;  1VYX A;  2JMD A;  1V87 A;  3LRQ A;  2MD8 C;  2YQL A;  4BBQ A;  2KGI A;  1WIM A;  2VJE A;  1T1H A;  4XI1 A;  4WZ2 A;  2KIZ A;  2YSM A;  4CCG X;  3LQJ A;  2ECV A;  3HCT A;  4BHW A;  4R2Y A;  3M63 A;  4L58 A;  4A0C D;  2EOD A;  4WZ0 A;  3GV4 A;  4CA1 A;  3U5O A;  2LGK A;  2G45 A;  2VPD A;  3ZYQ A;  2MNZ A;  3PUQ A;  2JMJ A;  2M85 A;  2YSJ A;  3ZTG A;  5I3L A;  5G05 B;  5B78 A;  4Q6F A;  4FIP A;  5FB0 A;  1WE9 A;  3IHP A;  2KYU A;  4PPE A;  5AIU A;  2EGP A;  1MM2 A;  3ZVY A;  2ECW A;  1WEV A;  2M3H A;  4LKA A;  1XWH A;  5J3X A;  2F6J A;  5FEY A;  3MHH A;  5TRB A;  2K17 A;  4YAX A;  2L75 A;  2LDR A;  3PUR A;  2XEU A;  1E4U A;  5AIT A;  3SOU A;  4S3O C;  5LKX A;  4GND A;  5TBN A;  4WA6 A;  2H0D A;  4O64 A;  4V3L C;  4N4F A;  2VPB A;  1X4I A;  2QJ0 A;  2EA6 A;  3V43 A;  4IC3 A;  4A49 A;  5FER A;  1BOR A;  2ECG A;  1U6G B;  2YUC A;  4P5O B;  2YUR A;  1Z2Q A;  2KWN A;  3O36 A;  2ECN A;  1CHC A;  2E6R A;  4FJC A;  3HTK C;  3U5P A;  3L11 A;  4I7C A;  3C5K A;  1ZBD B;  4LJN A;  2QIC A;  4F52 B;  4L7X A;  4UI9 B;  1WES A;  3KNV A;  4ZQL A;  2YRE A;  3O70 A;  2ECJ A;  1WEP A;  2YQM A;  5LCW B;  5KH7 A;  2CSY A;  2MUM A;  1VFY A;  2LV9 A;  4UP0 A;  5D1M B;  3N9O A;  4YBS A;  4X3G A;  2ECT A;  4I7B A;  2K16 A;  2MNY A;  2Y1M A;  4ZDT A;  4GNE A;  5TAB A;  3ASL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...