4YATA

Crystal structure of trim24 phd-bromodomain complexed with n-(1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl)-4-methoxybenzene-1-sulfonamide (5b)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
173
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 173
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yatA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yatA01
4A4BA 2VPEA 3IU6A 1FP0A 2YURA 4LYSA 1XWHA 4TT2A 3NXBA 4QNSA 2N9GA 5TDWA 2RNXA 5EGUA 5E9LA 5J0DA 4YYGA 5C87A 4BW1A 5G4RA 4NYVA 4L7XA 4GNGA 1G25A 4BW4A 5D3PA 4TS8A 4MSXA 4QR5A 5I40A 2KWNA 5E73A 2OXQC 5FFVA 4QEUA 5A85A 2KTBB 5F3AA 5DLZA 5E9VA 5ACYA 3GL6A 4QSTA 4NR5A 3LJWA 5EWDA 5FDZA 5A81A 2CT2A 2E6RA 2YELA 3SOWA 4KV1A 4V3LC 2DVSA 4CUUA 5D3JA 3Q2FA 1LDKC 5G0FA 3G0LA 5CQ8A 2HDPA 3K2JA 3UW9A 1U6GB 4LLBA 5FE5A 5C4QA 4ALGA 3MB3A 4Q6FA 2VJFB 4WIVA 3MHSA 2MA5A 4O7BA 5LKUA 5I7YA 2VJFA 5KTUA 3ZTGA 2R0VA 2KREA 4C9ZA 4O75A 5CUDA 3N9MA 5CS8A 4ZC9A 2YYNA 5E3DA 5D3HA 4QSQA 1X0JA 4PCIA 5F5ZA 4NRAA 5ENGA 5H1VA 3O7AA 5TBNA 2NAAA 5A5QA 2CKLB 5I89A 4ZW1A 4UYFB 4YBSA 3DQVR 5A5NA 5HJCA 1VFYA 2CKLA 5LUUA 1Z6UA 4IOQA 4Z1QA 4NYXA 1WILA 5FE4A 2G45A 4AYCB 5B8DA 4R8PK 2VPGA 5TDRA 4ZUXU 2LXPC 2ECGA 4AYCA 1T1HA 3SHBA 5F63A 4MENA 2F6NA 5LCWB 5IGKA 3U5OA 4N4FA 3HTKC 2YW5A 3L1XA 2PNXA 2MNZA 5CQ3A 4X3GA 3SOUA 5ENFA 4FJCA 5IIDA 4QR3A 3FL2A 5EU1A 5H9MA 3T6RA 4TU4A 5B78A 5D3RA 2D82A 5A5PA 4NRBA 4NS5A 4BBQA 4IR3A 2KWOA 4UYHA 3ONIA 2YW8A 4FK5A 5FE0A 5CFWA 4N3WA 4HXLA 4O77A 5I86A 3KQIA 4WZ3B 4Z1SA 3SOXA 5B76A 1WEUA 5CUBA 4LYWA 4HXRA 2AN6A 5AD2A 1WESA 4A9KA 3AADA 5D25A 2OSSA 3EB6A 4HXPA 4QC1A 1BORA 3N9QA 5HM0A 4AP4A 5DX4A 5DBMA 1WEEA 4A9NA 5EPRA 5DYXA 3PHDA 4QYLA 4CLBA 5KH3A 3UV5A 1WFKA 5CGPA 3HCTA 5D3LA 4Z6HA 1Z2QA 4UYDA 2CSYA 4FIPA 3JVKA 5L96A 4BJXA 5E9MA 2DVVA 5COIA 5CRMA 3UV2A 4O72A 3M99A 2K16A 4B7YC 3LQHA 3U5MA 4C66A 5D24A 2MD7B 4KV4A 3N9PA 5FE8A 4TYLA 5CU8A 2ECTA 5LKZA 2LGGA 4XI1A 4A9MA 1WENA 4GNFA 3T7LA 1WUGA 5EVAA 5HFRA 4HBWA 4LJNA 3L11A 4J0SA 3P1DA 5AMEA 3RCWA 4LZ2A 4TKPB 5FBXA 5HQ5A 3S92A 2LV9A 4A9IA 2R10A 3P1CA 4A9OA 4N4HA 5CQ7A 2F6JA 5L99A 3U5PA 3MUKA 4PCEA 2L43A 3U5LA 2MNYA 2FUUA 2XEUA 2YT5A 4UYEA 5D1LB 2XB1A 4GNEA 3JVMA 2LGLA 5JI8A 4V3KC 5I80A 4QEVA 3UVYA 4YYMA 2YEKA 4YAXA 2QJ0A 2D9EA 2M6MA 3AQAA 2MUMA 3DPLR 1JOCA 4TZ2A 2JMIA 2LQ6A 5C13A 1FBVA 5ETDA 1MM3A 1HYIA 2ECVA 5DKAA 2YQDA 2KYUA 4YATA 3UV4A 3N9NA 4IOOA 2I8NA 4LDFA 4A0CD 5IG6A 2VP7A 2L5UA 2YU4A 3EB5A 4MR5A 1LDJB 4PPEA 4YY6A 5K29A 2JMJA 1X4UA 5DY7A 3U5JA 4KCXA 4NYWA 2G4AA 4HBXA 4UIXA 4Q0NA 5F1HA 5AD3A 5LJ2A 4XUBA 4LZRA 2DKWA 4O64A 5E9IA 4A9LA 5A83A 4GPJA 4E96A 4IC3A 5EP7A 5DKHA 4NR7A 5FE3A 5H1UA 3I2DA 3ZNIA 1WUMA 4YYHA 2I50A 3GG3A 5G05B 5FH7A 2L85A 2H60A 4HXSA 4TQNA 5FE1A 5AMFA 1Z60A 1X4JA 5E74A 3MB4A 4O74A 2YYRA 5DINA 3ASLA 2YEMA 2CSZA 4OGJA 2WP1A 1V87A 3VK6A 5EV9A 3I3JA 5D1MB 5E3GA 4YH3A 5EQ1A 3SVFA 5LKTA 1ZBDB 4WZ0A 2K4DA 3P1FA 4QR4A 5DFBA 5A5OA 2KR4A 2LGKA 5FH6A 5TRBA 4QF2A 3MXFA 5EA1A 4QSUA 4ALHA 4P5OB 5E9KA 3PURA 5CTLA 3FKMX 2DWWA 4I7BA 5EYAF 5HFQA 2YREA 2DX8A 4FO9A 3HMHA 4YADA 1DVPA 4UP0A 2NXBA 4LZSA 4QSRA 3ZYUA 3KV5A 2MD8C 4S3OB 4QSVA 2LDRA 4LR6A 5FG6A 3ZVYA 2M3HA 3QZSA 2KU3A 3QZVA 4W4UA 2OUOA 2YHNA 3ZPVE 4AKNA 5DKCA 2H0DB 4UIVA 5EK9A 5H85A 4NXJA 5HLSA 5FH8A 2KIZA 4YABA 5LKXA 3HMFA 5E0RA 5F61A 5HRVA 1WEPA 5IGMA 5EPBA 5EM3A 4UI9B 3GV4A 5F62A 5FE2A 4ZDTA 4LADB 1ZS5A 4YYIA 2JRJA 5IGNA 5LJ1A 4YBMA 2HYED 4CUTA 2C2LA 5LVQA 2Y1MA 4QSWA 4I7CA 4MR6A 2YUCA 5II1A 5HQ7A 1WE9A 4A9JA 5EWWA 4MR4A 4TZ8A 2K1JA 1N87A 5BT4A 5CY9A 2M85A 4A9EA 5CUGA 5C7NA 5C89A 2KWKA 5DLXA 4LRGA 2KE1A 4TU6A 2KWJA 5CUEA 5I88A 2Y43A 4NUCA 2L84A 4MR3A 4O70A 5A82A 4R2YA 4IR4A 5FG5A 5AIUA 3LRQA 2H0DA 2ZETC 5B79A 3C6WA 5B77A 3O37A 3P5OA 3ZPV1 2BAYA 2RSDA 2DVRA 5II2A 5DFDA 5HQ6A 4YC9A 3UVWA 4O7FA 4NR6A 2YQMA 4MVTA 5CZGA 4A9HA 3L1ZB 1K2FA 4LK9A 5CQ6A 5L8TA 1JM7A 1WEMA 4I7DA 2M1RA 5EWVA 3O33A 2FUIA 5G04B 3ZVZB 4YYDA 5KH7A 5CRZA 2LSPB 3IU5A 5CQAA 2RI7A 3RTRB 2L80A 4PTBA 2ECJA 2L0BA 4WHWA 1IYMA 4QEWA 5LVRA 2LN0A 5B75A 5J3XA 3QZTA 5FERA 5FE9A 5DKDA 5KU3A 2KGGA 2VJEB 2DVQA 5A7CA 5D7XA 3HMEA 4YYKA 4QBMA 2E7OA 2MJVB 2E7NA 3SVGA 4CUQA 5TCMA 4O7AA 4YYNA 3U5NA 5DW1A 4O76A 4TTEA 5JG6A 4UP5A 4Q0OA 4F3IA 1WEVA 2KFTA 4PS5A 5C8GA 2LRIC 2E3KA 3NG2A 4J1PA 4QSXA 5DW2A 1WEQA 3KNVA 4NQNA 4NQMA 4ZQLA 1RMDA 4O71A 4PY6A 5ENHA 2DATA 5F2PA 5CPEA 4YY4A 4QY4A 4Y03A 4XUAA 1VYXA 2QICA 5FE6A 4MEOA 3PUQA 3O36A 4RVRA 5KHMA 4QF3A 4QUUA 5L8UA 5G4SA 2OO1A 5I83A 2G43A 4HBVA 2UZGA 4XY8A 3DAIA 5JWMA 3HCUA 5CP5A 2IDAA 3P1EA 5DFCA 2VPDA 3UVDA 5D0CA 1F68A 4NN2A 4DONA 2MT5A 2VNFA 5I3LA 3S91A 4O7CA 5ETBA 1F62A 5EICA 4A4CA 4LC2A 4QB3A 1VD4A 5H1TA 4IC2A 3O70A 3UVXA 1EQFA 5I7XA 2GRCA 2RNWA 5A5RA 5D3NA 4IR5A 4QSSA 2L5EA 2I7KA 5KTWA 5EWCA 4YH4A 3KV6A 4MEPA 3V43A 4R7EA 1X4IA 2ECIA 4A49A 4IR6A 5FFYA 4OUFA 2YSJA 2R0YA 2RFJA 5DYUA 4UITA 5DYAA 3MQMA 3G0JA 2EA6A 5EPSA 1JM4B 5TABA 3DWYA 4CFLA 4HXOA 3MULA 5F60A 4NR8A 4QZSA 2YHOA 5C11A 5HCLA 4CFKA 5LJ0A 3O34A 5HRWA 4QSPA 5I1QA 4QYDA 4GNDA 1N72A 5EI4A 4CURA 5KTXA 5D3TA 1JM7B 5F25A 4UIUA 2MIQA 4Z93A 4CA1A 5CUCA 4LYIA 2EGPA 4MEQA 4NUEA 5TB6A 5CUAA 3TLPA 5FG4A 5HEMA 4CUPA 4CUSA 1WIMA 2L75A 4NUDA 5C85A 5IBNA 3N9LA 2PUYA 4AVXA 4TT4A 5CQ4A 4PKLA 5ENEA 3LXJA 4N4IA 4UIWA 2VJEA 4AUQB 4O7EA 2JMDA 4X2IA 5I29A 5D1KB 4UYGA 4HXMA 4UIZA 5IGLA 4BHWA 3MHHA 4J3IA 5D3SA 1WEWA 3C5KA 4XY9A 2KGIA 5F1LA 4YBTA 5L97A 3M62A 4XYAA 2YDWA 2RS9B 4IORA 4UIYA 4BW3A 4Z6IA 2C2VS 2LGVA 1E4UA 3IHPA 3SVHA 2F42A 3LQJA 5ENBA 2QIZA 3M63A 4S3OC 1JSPB 5L98A 3JVJA 5FEYA 2E6SA 4L58A 5A5SA 2MA6A 4YYJA 4O78A 4BW2A 2RNYA 5ENIA 2VPBA 4UYFA 5EWHA 4QUTA 3HCSA 5DYCA 4TT6A 5FB1A 2YQLA 4C67A 2YSMA 2Y1NA 5FE7A 4N4GA 1E6IA 4HXNA 5BT5A 4CL9A 4NR4A 4NRCA 5CQTA 2ECWA 5FFWA 1MM2A 5E7DA 5HENA 5BT3A 4B86C 1WEOA 5ENCA 4CCGX 5FB0A 3ZYQA 2FSAA 2ECNA 4NR9A 5KO4A 3D7CA 5HRXA 4WZ2A 3U5KA 2R0SA 2K17A 4LKAA 3RPGB 4J0RA 4HBYA 3Q2EA 5F36A 5CQ5A 5ENJA 5KH9A 5E9YA 3JVLA 5HELA 3LQIA 2EODA 1WGMA 2LXHC 2D8SA 3O35A 4YK0A 2G6QA 4GB0A 5EISA 4WA6A 4FLPA 4OGIA 3RPGC 1CHCA 4WHUA 3N9OA 2RO1A 5AITA 5D26A 4QC3A 2WP2A 4A9FA 1HYJA 4F52B 4HXKA
chains in the Genus database with same CATH superfamily
5SVXA 3MDBC 4A4BA 2VPEA 3IU6A 1FP0A 2YURA 4LYSA 1XWHA 4TT2A 3NXBA 4QNSA 2N9GA 5TDWA 2RNXA 5EGUA 5E9LA 2FD4A 5J0DA 4YYGA 5C87A 4BW1A 5G4RA 4NYVA 4L7XA 4GNGA 1G25A 4BW4A 5D3PA 4TS8A 4MSXA 4QR5A 5I40A 2KWNA 5E73A 2OXQC 5FFVA 4QEUA 5A85A 2KTBB 5F3AA 5DLZA 5E9VA 5ACYA 3GL6A 4QSTA 4NR5A 3LJWA 2XP0A 5EWDA 5FDZA 5A81A 4AKHA 2CT2A 2E6RA 3LJUX 2YELA 3SOWA 4KV1A 4V3LC 2DVSA 4CUUA 5D3JA 3Q2FA 1LDKC 5SVYA 5G0FA 3DWDA 4AKIA 3G0LA 5CQ8A 2HDPA 3K2JA 3UW9A 1U6GB 4LLBA 5FE5A 5C4QA 4ALGA 3MB3A 4Q6FA 2VJFB 4WIVA 3MHSA 2MA5A 4O7BA 5LKUA 5I7YA 2VJFA 5KTUA 3ZTGA 2R0VA 2KREA 4C9ZA 4O75A 5CUDA 3N9MA 5CS8A 4ZC9A 2YYNA 5E3DA 5D3HA 4QSQA 1X0JA 4PCIA 5F5ZA 4NRAA 5ENGA 5H1VA 3O7AA 5TBNA 2NAAA 5A5QA 2CKLB 5I89A 4ZW1A 4UYFB 4YBSA 3DQVR 5A5NA 5HJCA 1VFYA 2CKLA 5LUUA 3FJUB 1Z6UA 4F1PA 3KDEC 4IOQA 4Z1QA 4NYXA 1WILA 4Z0OA 5FE4A 2G45A 4AYCB 5B8DA 4R8PK 2VPGA 5TDRA 4ZUXU 2LXPC 2ECGA 4AYCA 1T1HA 3SHBA 5F63A 4MENA 2OWAA 2F6NA 5LCWB 5IGKA 2XOCA 3U5OA 4N4FA 5SVIA 3HTKC 2YW5A 3L1XA 2PNXA 2MNZA 5CQ3A 4X3GA 3SOUA 5ENFA 4FJCA 5IIDA 4QR3A 3FL2A 5EU1A 5H9MA 3T6RA 4TU4A 5B78A 3VKHA 5D3RA 2D82A 5A5PA 2B0OE 4NRBA 2CRWA 4NS5A 4BBQA 4IR3A 2KWOA 4UYHA 3T9KA 3ONIA 2YW8A 4AI6A 4FK5A 2FFWA 5FE0A 5CFWA 4N3WA 4HXLA 4O77A 5I86A 3KQIA 4WZ3B 4Z1SA 3SOXA 5B76A 3FAOA 1WEUA 5CUBA 4LYWA 4HXRA 2AN6A 2L7PA 4OGEA 5AD2A 1WESA 4A9KA 3AADA 5D25A 2OSSA 3EB6A 4HXPA 4QC1A 1BORA 3N9QA 5HM0A 4AP4A 5DX4A 5DBMA 1WEEA 4A9NA 5EPRA 5DYXA 3PHDA 3Q1DA 4QYLA 4CLBA 2YVRA 5KH3A 3UV5A 1WFKA 5CGPA 4O62A 3HCTA 5D3LA 4Z6HA 1Z2QA 4UYDA 2CSYA 4FIPA 3JVKA 5L96A 4BJXA 5E9MA 2DVVA 5COIA 5CRMA 3UV2A 4O72A 3M99A 2K16A 4B7YC 3LQHA 3U5MA 4C66A 5D24A 2MD7B 4KV4A 3N9PA 5FE8A 4TYLA 5CU8A 2ECTA 5LKZA 2LGGA 4XI1A 4A9MA 1WENA 2LAUA 4GNFA 3T7LA 1WUGA 1MBMA 5EVAA 5HFRA 4HBWA 4LJNA 3L11A 4J0SA 3P1DA 5AMEA 3RCWA 4LZ2A 4TKPB 5FBXA 5HQ5A 3S92A 2LV9A 4A9IA 2R10A 3P1CA 4A9OA 4N4HA 5CQ7A 2F6JA 5L99A 3U5PA 3MUKA 4PCEA 2L43A 3U5LA 2MNYA 2FUUA 2XEUA 2YT5A 4UYEA 5D1LB 2XB1A 4GNEA 3JVMA 2LGLA 5JI8A 4V3KC 5I80A 4QEVA 3UVYA 4YYMA 2YEKA 4YAXA 2RR4A 2D9EA 2M6MA 3AQAA 2MUMA 2QJ0A 1JOCA 4TZ2A 2JMIA 2LQ6A 3DPLR 5C13A 1FBVA 5ETDA 1MM3A 1HYIA 2ECVA 5DKAA 2YQDA 2KYUA 4YATA 3UV4A 3N9NA 3LDYA 2E61A 4IOOA 2I8NA 4LDFA 4A0CD 1PUOA 5IG6A 2VP7A 2L5UA 2YU4A 3EB5A 4MR5A 1LDJB 4PPEA 4YY6A 5K29A 2JMJA 1X4UA 5DY7A 3U5JA 4KCXA 4NYWA 2G4AA 4HBXA 4UIXA 4Q0NA 5F1HA 5AD3A 5LJ2A 4XUBA 4LZRA 2DKWA 4O64A 5E9IA 4A9LA 5A83A 4GPJA 4E96A 4IC3A 5EP7A 5DKHA 4NR7A 5FE3A 2KKXA 5H1UA 3I2DA 4OGCA 3ZNIA 1WUMA 4YYHA 2I50A 3GG3A 5G05B 5FH7A 2L85A 2H60A 3PLWA 4HXSA 4TQNA 5FE1A 5AMFA 1Z60A 1X4JA 5E74A 3MB4A 2KKYA 4O74A 2YYRA 5DINA 3ASLA 2YEMA 2CSZA 4OGJA 2WP1A 1V87A 3VK6A 5EV9A 3I3JA 5D1MB 5E3GA 4YH3A 5EQ1A 3SVFA 5LKTA 1ZBDB 4WZ0A 2K4DA 3P1FA 4QR4A 5DFBA 5A5OA 2KR4A 2LGKA 5FH6A 3FM8C 5TRBA 4QF2A 3MXFA 5EA1A 3SUBA 4QSUA 4ALHA 4P5OB 5E9KA 3PURA 5CTLA 3FKMX 2DWWA 4I7BA 5EYAF 5HFQA 2YREA 2DX8A 4FO9A 3HMHA 4YADA 1DVPA 4UP0A 2NXBA 4LZSA 4QSRA 3ZYUA 3KV5A 2MD8C 4S3OB 4QSVA 2LDRA 2MKEA 4LR6A 5FG6A 3ZVYA 2M3HA 3QZSA 2KU3A 3QZVA 4W4UA 2OUOA 2EGMA 2YHNA 3ZPVE 4AKNA 5DKCA 2H0DB 4UIVA 5EK9A 5H85A 4NXJA 5HLSA 5FH8A 2KIZA 4YABA 5LKXA 3HMFA 5E0RA 5F61A 5HRVA 1WEPA 5IGMA 5EPBA 5EM3A 4UI9B 3GV4A 4Z0RA 5F62A 5FE2A 4ZDTA 4LADB 3D1BA 1ZS5A 4YYIA 2JRJA 5IGNA 5LJ1A 3E2DA 4YBMA 2HYED 4CUTA 2C2LA 5LVQA 2Y1MA 4QSWA 4I7CA 4MR6A 2YUCA 5II1A 3LVRE 5HQ7A 1WE9A 2CRRA 4A9JA 5EWWA 4MR4A 4TZ8A 2K1JA 1N87A 5BT4A 5CY9A 2M85A 4A9EA 5CUGA 5C7NA 5C89A 2KWKA 3LVQE 5DLXA 4LRGA 2KE1A 4TU6A 2KWJA 5CUEA 5I88A 2Y43A 4NUCA 2L84A 4MR3A 4O70A 5A82A 4R2YA 4IR4A 5FG5A 5AIUA 3LRQA 2H0DA 2ZETC 3H7HA 5B79A 3C6WA 5B77A 2DSMA 3O37A 3P5OA 3ZPV1 2BAYA 2RSDA 2DVRA 5II2A 5DFDA 5HQ6A 4YC9A 3UVWA 4O7FA 3M7KA 4NR6A 2YQMA 4MVTA 5CZGA 4A9HA 3L1ZB 1K2FA 4LK9A 5CQ6A 5L8TA 1JM7A 1WEMA 4I7DA 2M1RA 5EWVA 3O33A 2FUIA 5G04B 3ZVZB 4YYDA 5KH7A 5CRZA 2LSPB 3IU5A 5CQAA 2RI7A 3RTRB 2L80A 4PTBA 2ECJA 2L0BA 4WHWA 4H9DA 1IYMA 4QEWA 5LVRA 2LN0A 5B75A 5J3XA 3QZTA 5FERA 5FE9A 5DKDA 5KU3A 2KGGA 2CONA 2VJEB 2CSVA 2DVQA 5A7CA 5D7XA 3HMEA 4YYKA 4QBMA 2E7OA 2MJVB 2E7NA 3SVGA 4CUQA 5TCMA 4O7AA 4YYNA 3U5NA 5DW1A 4O76A 4TTEA 5JG6A 4UP5A 4Q0OA 4F3IA 1WEVA 2KFTA 4PS5A 5C8GA 2LRIC 2E3KA 3NG2A 4J1PA 4QSXA 5DW2A 1WEQA 3KNVA 4NQNA 4NQMA 4ZQLA 1RMDA 4O71A 4PY6A 5ENHA 2DATA 5F2PA 5CPEA 4YY4A 4QY4A 4Y03A 4XUAA 1VYXA 2QICA 5FE6A 4MEOA 3PUQA 3O36A 4RVRA 5KHMA 4QF3A 4QUUA 5L8UA 5G4SA 2OO1A 5I83A 2G43A 4HBVA 2UZGA 4XY8A 3DAIA 5JWMA 3HCUA 5CP5A 2IDAA 3P1EA 5DFCA 2VPDA 3UVDA 5D0CA 1F68A 4NN2A 4DONA 2MT5A 2VNFA 5I3LA 3JUEA 3S91A 4O7CA 5ETBA 2M13A 5EICA 4A4CA 4LC2A 1F62A 4QB3A 1VD4A 2XOZA 5H1TA 4IC2A 3O70A 3UVXA 1EQFA 5I7XA 2GRCA 2RNWA 5A5RA 5D3NA 4IR5A 4QSSA 2L5EA 2I7KA 5KTWA 5EWCA 4YH4A 3KV6A 4MEPA 3V43A 3VKGA 4R7EA 1X4IA 2ECIA 4A49A 4IR6A 5FFYA 4OUFA 2DJAA 2JM3A 2YSJA 2R0YA 2RFJA 5DYUA 4UITA 5DYAA 3MQMA 3G0JA 2EA6A 5EPSA 1JM4B 5TABA 3DWYA 4CFLA 4HXOA 3MULA 5F60A 4NR8A 4QZSA 2YHOA 5C11A 5HCLA 4CFKA 5LJ0A 3O34A 5HRWA 4QSPA 5I1QA 4QYDA 4GNDA 1N72A 5EI4A 4CURA 5KTXA 5D3TA 2P57A 1JM7B 5F25A 4UIUA 2MIQA 4Z93A 2EXUA 4CA1A 5CUCA 3ERRA 4LYIA 2EGPA 4MEQA 4NUEA 5TB6A 5CUAA 3TLPA 5FG4A 5HEMA 4CUPA 4CUSA 1WIMA 2L75A 4NUDA 5C85A 5IBNA 3N9LA 2PUYA 3DDTA 4TT4A 3O47A 4AVXA 5CQ4A 4PKLA 5ENEA 3LXJA 4N4IA 4UIWA 2VJEA 4AUQB 4O7EA 2JMDA 4X2IA 5I29A 5D1KB 4UYGA 4HXMA 4UIZA 5IGLA 4BHWA 1DCQA 3MHHA 4J3IA 5D3SA 1WEWA 3C5KA 4XY9A 2KGIA 5F1LA 3D1DA 4YBTA 5L97A 3M62A 4XYAA 2YDWA 2RS9B 4IORA 4UIYA 4BW3A 4Z6IA 2C2VS 2LGVA 3FEHA 1E4UA 3IHPA 3SVHA 2F42A 3LQJA 5ENBA 2QIZA 3M63A 4S3OC 1JSPB 5L98A 3JVJA 5FEYA 2E6SA 3FANA 4L58A 5A5SA 2MA6A 4QQ4A 4YYJA 4O78A 4BW2A 2RNYA 5ENIA 2VPBA 4UYFA 5EWHA 4QUTA 3HCSA 2JUNA 5DYCA 4TT6A 5FB1A 2YQLA 4C67A 2YSMA 2Y1NA 5FE7A 5K3QA 4N4GA 1E6IA 4HXNA 5BT5A 4CL9A 4NR4A 4NRCA 5CQTA 2ECWA 5FFWA 1MM2A 5E7DA 5HENA 5BT3A 4B86C 1WEOA 5ENCA 5SVIB 5FB0A 3ZYQA 4CCGX 2FSAA 2ECNA 4NR9A 5KO4A 3D7CA 5HRXA 4WZ2A 3U5KA 2R0SA 2K17A 4LKAA 3RPGB 2EJNA 4J0RA 4HBYA 2D8UA 3Q2EA 5F36A 5CQ5A 5ENJA 5KH9A 5E9YA 3JVLA 4AKGA 5HELA 3LQIA 2EODA 1WGMA 2LXHC 2D8SA 3O35A 4YK0A 2G6QA 4GB0A 5EISA 4WA6A 4FLPA 4OGIA 3RPGC 1CHCA 4WHUA 3N9OA 2RO1A 5AITA 5D26A 4QC3A 2WP2A 4A9FA 1ZKRA 2IQJA 1HYJA 4F52B 2XOYA 4HXKA
chains in the Genus database with same CATH topology
4A4BA 2VPEA 3IU6A 1FP0A 2YURA 4LYSA 1XWHA 4TT2A 3NXBA 4QNSA 2N9GA 5TDWA 2RNXA 5EGUA 5E9LA 5J0DA 4YYGA 5C87A 4BW1A 5G4RA 4NYVA 4L7XA 4GNGA 1G25A 4BW4A 5D3PA 4TS8A 4MSXA 4QR5A 5I40A 2KWNA 5E73A 2OXQC 5FFVA 4QEUA 5A85A 2KTBB 5F3AA 5DLZA 5E9VA 5ACYA 3GL6A 4QSTA 4NR5A 3LJWA 5EWDA 5FDZA 5A81A 2CT2A 2E6RA 2YELA 3SOWA 4KV1A 4V3LC 2DVSA 4CUUA 5D3JA 3Q2FA 1LDKC 5G0FA 3G0LA 5CQ8A 2HDPA 3K2JA 3UW9A 1U6GB 4LLBA 5FE5A 5C4QA 4ALGA 3MB3A 4Q6FA 2VJFB 4WIVA 3MHSA 2MA5A 4O7BA 5LKUA 5I7YA 2VJFA 5KTUA 3ZTGA 2R0VA 2KREA 4C9ZA 4O75A 5CUDA 3N9MA 5CS8A 4ZC9A 2YYNA 5E3DA 5D3HA 4QSQA 1X0JA 4PCIA 5F5ZA 4NRAA 5ENGA 5H1VA 3O7AA 5TBNA 2NAAA 5A5QA 2CKLB 5I89A 4ZW1A 4UYFB 4YBSA 3DQVR 5A5NA 5HJCA 1VFYA 2CKLA 5LUUA 1Z6UA 4IOQA 4Z1QA 4NYXA 1WILA 5FE4A 2G45A 4AYCB 5B8DA 4R8PK 2VPGA 5TDRA 4ZUXU 2LXPC 2ECGA 4AYCA 1T1HA 3SHBA 5F63A 4MENA 2F6NA 5LCWB 5IGKA 3U5OA 4N4FA 3HTKC 2YW5A 3L1XA 2PNXA 2MNZA 5CQ3A 4X3GA 3SOUA 5ENFA 4FJCA 5IIDA 4QR3A 3FL2A 5EU1A 5H9MA 3T6RA 4TU4A 5B78A 5D3RA 2D82A 5A5PA 4NRBA 4NS5A 4BBQA 4IR3A 2KWOA 4UYHA 3ONIA 2YW8A 4FK5A 5FE0A 5CFWA 4N3WA 4HXLA 4O77A 5I86A 3KQIA 4WZ3B 4Z1SA 3SOXA 5B76A 1WEUA 5CUBA 4LYWA 4HXRA 2AN6A 5AD2A 1WESA 4A9KA 3AADA 5D25A 2OSSA 3EB6A 4HXPA 4QC1A 1BORA 3N9QA 5HM0A 4AP4A 5DX4A 5DBMA 1WEEA 4A9NA 5EPRA 5DYXA 3PHDA 4QYLA 4CLBA 5KH3A 3UV5A 1WFKA 5CGPA 3HCTA 5D3LA 4Z6HA 1Z2QA 4UYDA 2CSYA 4FIPA 3JVKA 5L96A 4BJXA 5E9MA 2DVVA 5COIA 5CRMA 3UV2A 4O72A 3M99A 2K16A 4B7YC 3LQHA 3U5MA 4C66A 5D24A 2MD7B 4KV4A 3N9PA 5FE8A 4TYLA 5CU8A 2ECTA 5LKZA 2LGGA 4XI1A 4A9MA 1WENA 4GNFA 3T7LA 1WUGA 5EVAA 5HFRA 4HBWA 4LJNA 3L11A 4J0SA 3P1DA 5AMEA 3RCWA 4LZ2A 4TKPB 5FBXA 5HQ5A 3S92A 2LV9A 4A9IA 2R10A 3P1CA 4A9OA 4N4HA 5CQ7A 2F6JA 5L99A 3U5PA 3MUKA 4PCEA 2L43A 3U5LA 2MNYA 2FUUA 2XEUA 2YT5A 4UYEA 5D1LB 2XB1A 4GNEA 3JVMA 2LGLA 5JI8A 4V3KC 5I80A 4QEVA 3UVYA 4YYMA 2YEKA 4YAXA 2QJ0A 2D9EA 2M6MA 3AQAA 2MUMA 3DPLR 1JOCA 4TZ2A 2JMIA 2LQ6A 5C13A 1FBVA 5ETDA 1MM3A 1HYIA 2ECVA 5DKAA 2YQDA 2KYUA 4YATA 3UV4A 3N9NA 4IOOA 2I8NA 4LDFA 4A0CD 5IG6A 2VP7A 2L5UA 2YU4A 3EB5A 4MR5A 1LDJB 4PPEA 4YY6A 5K29A 2JMJA 1X4UA 5DY7A 3U5JA 4KCXA 4NYWA 2G4AA 4HBXA 4UIXA 4Q0NA 5F1HA 5AD3A 5LJ2A 4XUBA 4LZRA 2DKWA 4O64A 5E9IA 4A9LA 5A83A 4GPJA 4E96A 4IC3A 5EP7A 5DKHA 4NR7A 5FE3A 5H1UA 3I2DA 3ZNIA 1WUMA 4YYHA 2I50A 3GG3A 5G05B 5FH7A 2L85A 2H60A 4HXSA 4TQNA 5FE1A 5AMFA 1Z60A 1X4JA 5E74A 3MB4A 4O74A 2YYRA 5DINA 3ASLA 2YEMA 2CSZA 4OGJA 2WP1A 1V87A 3VK6A 5EV9A 3I3JA 5D1MB 5E3GA 4YH3A 5EQ1A 3SVFA 5LKTA 1ZBDB 4WZ0A 2K4DA 3P1FA 4QR4A 5DFBA 5A5OA 2KR4A 2LGKA 5FH6A 5TRBA 4QF2A 3MXFA 5EA1A 4QSUA 4ALHA 4P5OB 5E9KA 3PURA 5CTLA 3FKMX 2DWWA 4I7BA 5EYAF 5HFQA 2YREA 2DX8A 4FO9A 3HMHA 4YADA 1DVPA 4UP0A 2NXBA 4LZSA 4QSRA 3ZYUA 3KV5A 2MD8C 4S3OB 4QSVA 2LDRA 4LR6A 5FG6A 3ZVYA 2M3HA 3QZSA 2KU3A 3QZVA 4W4UA 2OUOA 2YHNA 3ZPVE 4AKNA 5DKCA 2H0DB 4UIVA 5EK9A 5H85A 4NXJA 5HLSA 5FH8A 2KIZA 4YABA 5LKXA 3HMFA 5E0RA 5F61A 5HRVA 1WEPA 5IGMA 5EPBA 5EM3A 4UI9B 3GV4A 5F62A 5FE2A 4ZDTA 4LADB 1ZS5A 4YYIA 2JRJA 5IGNA 5LJ1A 4YBMA 2HYED 4CUTA 2C2LA 5LVQA 2Y1MA 4QSWA 4I7CA 4MR6A 2YUCA 5II1A 5HQ7A 1WE9A 4A9JA 5EWWA 4MR4A 4TZ8A 2K1JA 1N87A 5BT4A 5CY9A 2M85A 4A9EA 5CUGA 5C7NA 5C89A 2KWKA 5DLXA 4LRGA 2KE1A 4TU6A 2KWJA 5CUEA 5I88A 2Y43A 4NUCA 2L84A 4MR3A 4O70A 5A82A 4R2YA 4IR4A 5FG5A 5AIUA 3LRQA 2H0DA 2ZETC 5B79A 3C6WA 5B77A 3O37A 3P5OA 3ZPV1 2BAYA 2RSDA 2DVRA 5II2A 5DFDA 5HQ6A 4YC9A 3UVWA 4O7FA 4NR6A 2YQMA 4MVTA 5CZGA 4A9HA 3L1ZB 1K2FA 4LK9A 5CQ6A 5L8TA 1JM7A 1WEMA 4I7DA 2M1RA 5EWVA 3O33A 2FUIA 5G04B 3ZVZB 4YYDA 5KH7A 5CRZA 2LSPB 3IU5A 5CQAA 2RI7A 3RTRB 2L80A 4PTBA 2ECJA 2L0BA 4WHWA 1IYMA 4QEWA 5LVRA 2LN0A 5B75A 5J3XA 3QZTA 5FERA 5FE9A 5DKDA 5KU3A 2KGGA 2VJEB 2DVQA 5A7CA 5D7XA 3HMEA 4YYKA 4QBMA 2E7OA 2MJVB 2E7NA 3SVGA 4CUQA 5TCMA 4O7AA 4YYNA 3U5NA 5DW1A 4O76A 4TTEA 5JG6A 4UP5A 4Q0OA 4F3IA 1WEVA 2KFTA 4PS5A 5C8GA 2LRIC 2E3KA 3NG2A 4J1PA 4QSXA 5DW2A 1WEQA 3KNVA 4NQNA 4NQMA 4ZQLA 1RMDA 4O71A 4PY6A 5ENHA 2DATA 5F2PA 5CPEA 4YY4A 4QY4A 4Y03A 4XUAA 1VYXA 2QICA 5FE6A 4MEOA 3PUQA 3O36A 4RVRA 5KHMA 4QF3A 4QUUA 5L8UA 5G4SA 2OO1A 5I83A 2G43A 4HBVA 2UZGA 4XY8A 3DAIA 5JWMA 3HCUA 5CP5A 2IDAA 3P1EA 5DFCA 2VPDA 3UVDA 5D0CA 1F68A 4NN2A 4DONA 2MT5A 2VNFA 5I3LA 3S91A 4O7CA 5ETBA 1F62A 5EICA 4A4CA 4LC2A 4QB3A 1VD4A 5H1TA 4IC2A 3O70A 3UVXA 1EQFA 5I7XA 2GRCA 2RNWA 5A5RA 5D3NA 4IR5A 4QSSA 2L5EA 2I7KA 5KTWA 5EWCA 4YH4A 3KV6A 4MEPA 3V43A 4R7EA 1X4IA 2ECIA 4A49A 4IR6A 5FFYA 4OUFA 2YSJA 2R0YA 2RFJA 5DYUA 4UITA 5DYAA 3MQMA 3G0JA 2EA6A 5EPSA 1JM4B 5TABA 3DWYA 4CFLA 4HXOA 3MULA 5F60A 4NR8A 4QZSA 2YHOA 5C11A 5HCLA 4CFKA 5LJ0A 3O34A 5HRWA 4QSPA 5I1QA 4QYDA 4GNDA 1N72A 5EI4A 4CURA 5KTXA 5D3TA 1JM7B 5F25A 4UIUA 2MIQA 4Z93A 4CA1A 5CUCA 4LYIA 2EGPA 4MEQA 4NUEA 5TB6A 5CUAA 3TLPA 5FG4A 5HEMA 4CUPA 4CUSA 1WIMA 2L75A 4NUDA 5C85A 5IBNA 3N9LA 2PUYA 4AVXA 4TT4A 5CQ4A 4PKLA 5ENEA 3LXJA 4N4IA 4UIWA 2VJEA 4AUQB 4O7EA 2JMDA 4X2IA 5I29A 5D1KB 4UYGA 4HXMA 4UIZA 5IGLA 4BHWA 3MHHA 4J3IA 5D3SA 1WEWA 3C5KA 4XY9A 2KGIA 5F1LA 4YBTA 5L97A 3M62A 4XYAA 2YDWA 2RS9B 4IORA 4UIYA 4BW3A 4Z6IA 2C2VS 2LGVA 1E4UA 3IHPA 3SVHA 2F42A 3LQJA 5ENBA 2QIZA 3M63A 4S3OC 1JSPB 5L98A 3JVJA 5FEYA 2E6SA 4L58A 5A5SA 2MA6A 4YYJA 4O78A 4BW2A 2RNYA 5ENIA 2VPBA 4UYFA 5EWHA 4QUTA 3HCSA 5DYCA 4TT6A 5FB1A 2YQLA 4C67A 2YSMA 2Y1NA 5FE7A 4N4GA 1E6IA 4HXNA 5BT5A 4CL9A 4NR4A 4NRCA 5CQTA 2ECWA 5FFWA 1MM2A 5E7DA 5HENA 5BT3A 4B86C 1WEOA 5ENCA 4CCGX 5FB0A 3ZYQA 2FSAA 2ECNA 4NR9A 5KO4A 3D7CA 5HRXA 4WZ2A 3U5KA 2R0SA 2K17A 4LKAA 3RPGB 4J0RA 4HBYA 3Q2EA 5F36A 5CQ5A 5ENJA 5KH9A 5E9YA 3JVLA 5HELA 3LQIA 2EODA 1WGMA 2LXHC 2D8SA 3O35A 4YK0A 2G6QA 4GB0A 5EISA 4WA6A 4FLPA 4OGIA 3RPGC 1CHCA 4WHUA 3N9OA 2RO1A 5AITA 5D26A 4QC3A 2WP2A 4A9FA 1HYJA 4F52B 4HXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B A;  2VPE A;  3IU6 A;  1FP0 A;  2YUR A;  4LYS A;  1XWH A;  4TT2 A;  3NXB A;  4QNS A;  2N9G A;  5TDW A;  2RNX A;  5EGU A;  5E9L A;  5J0D A;  4YYG A;  5C87 A;  4BW1 A;  5G4R A;  4NYV A;  4L7X A;  4GNG A;  1G25 A;  4BW4 A;  5D3P A;  4TS8 A;  4MSX A;  4QR5 A;  5I40 A;  2KWN A;  5E73 A;  2OXQ C;  5FFV A;  4QEU A;  5A85 A;  2KTB B;  5F3A A;  5DLZ A;  5E9V A;  5ACY A;  3GL6 A;  4QST A;  4NR5 A;  3LJW A;  5EWD A;  5FDZ A;  5A81 A;  2CT2 A;  2E6R A;  2YEL A;  3SOW A;  4KV1 A;  4V3L C;  2DVS A;  4CUU A;  5D3J A;  3Q2F A;  1LDK C;  5G0F A;  3G0L A;  5CQ8 A;  2HDP A;  3K2J A;  3UW9 A;  1U6G B;  4LLB A;  5FE5 A;  5C4Q A;  4ALG A;  3MB3 A;  4Q6F A;  2VJF B;  4WIV A;  3MHS A;  2MA5 A;  4O7B A;  5LKU A;  5I7Y A;  2VJF A;  5KTU A;  3ZTG A;  2R0V A;  2KRE A;  4C9Z A;  4O75 A;  5CUD A;  3N9M A;  5CS8 A;  4ZC9 A;  2YYN A;  5E3D A;  5D3H A;  4QSQ A;  1X0J A;  4PCI A;  5F5Z A;  4NRA A;  5ENG A;  5H1V A;  3O7A A;  5TBN A;  2NAA A;  5A5Q A;  2CKL B;  5I89 A;  4ZW1 A;  4UYF B;  4YBS A;  3DQV R;  5A5N A;  5HJC A;  1VFY A;  2CKL A;  5LUU A;  1Z6U A;  4IOQ A;  4Z1Q A;  4NYX A;  1WIL A;  5FE4 A;  2G45 A;  4AYC B;  5B8D A;  4R8P K;  2VPG A;  5TDR A;  4ZUX U;  2LXP C;  2ECG A;  4AYC A;  1T1H A;  3SHB A;  5F63 A;  4MEN A;  2F6N A;  5LCW B;  5IGK A;  3U5O A;  4N4F A;  3HTK C;  2YW5 A;  3L1X A;  2PNX A;  2MNZ A;  5CQ3 A;  4X3G A;  3SOU A;  5ENF A;  4FJC A;  5IID A;  4QR3 A;  3FL2 A;  5EU1 A;  5H9M A;  3T6R A;  4TU4 A;  5B78 A;  5D3R A;  2D82 A;  5A5P A;  4NRB A;  4NS5 A;  4BBQ A;  4IR3 A;  2KWO A;  4UYH A;  3ONI A;  2YW8 A;  4FK5 A;  5FE0 A;  5CFW A;  4N3W A;  4HXL A;  4O77 A;  5I86 A;  3KQI A;  4WZ3 B;  4Z1S A;  3SOX A;  5B76 A;  1WEU A;  5CUB A;  4LYW A;  4HXR A;  2AN6 A;  5AD2 A;  1WES A;  4A9K A;  3AAD A;  5D25 A;  2OSS A;  3EB6 A;  4HXP A;  4QC1 A;  1BOR A;  3N9Q A;  5HM0 A;  4AP4 A;  5DX4 A;  5DBM A;  1WEE A;  4A9N A;  5EPR A;  5DYX A;  3PHD A;  4QYL A;  4CLB A;  5KH3 A;  3UV5 A;  1WFK A;  5CGP A;  3HCT A;  5D3L A;  4Z6H A;  1Z2Q A;  4UYD A;  2CSY A;  4FIP A;  3JVK A;  5L96 A;  4BJX A;  5E9M A;  2DVV A;  5COI A;  5CRM A;  3UV2 A;  4O72 A;  3M99 A;  2K16 A;  4B7Y C;  3LQH A;  3U5M A;  4C66 A;  5D24 A;  2MD7 B;  4KV4 A;  3N9P A;  5FE8 A;  4TYL A;  5CU8 A;  2ECT A;  5LKZ A;  2LGG A;  4XI1 A;  4A9M A;  1WEN A;  4GNF A;  3T7L A;  1WUG A;  5EVA A;  5HFR A;  4HBW A;  4LJN A;  3L11 A;  4J0S A;  3P1D A;  5AME A;  3RCW A;  4LZ2 A;  4TKP B;  5FBX A;  5HQ5 A;  3S92 A;  2LV9 A;  4A9I A;  2R10 A;  3P1C A;  4A9O A;  4N4H A;  5CQ7 A;  2F6J A;  5L99 A;  3U5P A;  3MUK A;  4PCE A;  2L43 A;  3U5L A;  2MNY A;  2FUU A;  2XEU A;  2YT5 A;  4UYE A;  5D1L B;  2XB1 A;  4GNE A;  3JVM A;  2LGL A;  5JI8 A;  4V3K C;  5I80 A;  4QEV A;  3UVY A;  4YYM A;  2YEK A;  4YAX A;  2QJ0 A;  2D9E A;  2M6M A;  3AQA A;  2MUM A;  3DPL R;  1JOC A;  4TZ2 A;  2JMI A;  2LQ6 A;  5C13 A;  1FBV A;  5ETD A;  1MM3 A;  1HYI A;  2ECV A;  5DKA A;  2YQD A;  2KYU A;  4YAT A;  3UV4 A;  3N9N A;  4IOO A;  2I8N A;  4LDF A;  4A0C D;  5IG6 A;  2VP7 A;  2L5U A;  2YU4 A;  3EB5 A;  4MR5 A;  1LDJ B;  4PPE A;  4YY6 A;  5K29 A;  2JMJ A;  1X4U A;  5DY7 A;  3U5J A;  4KCX A;  4NYW A;  2G4A A;  4HBX A;  4UIX A;  4Q0N A;  5F1H A;  5AD3 A;  5LJ2 A;  4XUB A;  4LZR A;  2DKW A;  4O64 A;  5E9I A;  4A9L A;  5A83 A;  4GPJ A;  4E96 A;  4IC3 A;  5EP7 A;  5DKH A;  4NR7 A;  5FE3 A;  5H1U A;  3I2D A;  3ZNI A;  1WUM A;  4YYH A;  2I50 A;  3GG3 A;  5G05 B;  5FH7 A;  2L85 A;  2H60 A;  4HXS A;  4TQN A;  5FE1 A;  5AMF A;  1Z60 A;  1X4J A;  5E74 A;  3MB4 A;  4O74 A;  2YYR A;  5DIN A;  3ASL A;  2YEM A;  2CSZ A;  4OGJ A;  2WP1 A;  1V87 A;  3VK6 A;  5EV9 A;  3I3J A;  5D1M B;  5E3G A;  4YH3 A;  5EQ1 A;  3SVF A;  5LKT A;  1ZBD B;  4WZ0 A;  2K4D A;  3P1F A;  4QR4 A;  5DFB A;  5A5O A;  2KR4 A;  2LGK A;  5FH6 A;  5TRB A;  4QF2 A;  3MXF A;  5EA1 A;  4QSU A;  4ALH A;  4P5O B;  5E9K A;  3PUR A;  5CTL A;  3FKM X;  2DWW A;  4I7B A;  5EYA F;  5HFQ A;  2YRE A;  2DX8 A;  4FO9 A;  3HMH A;  4YAD A;  1DVP A;  4UP0 A;  2NXB A;  4LZS A;  4QSR A;  3ZYU A;  3KV5 A;  2MD8 C;  4S3O B;  4QSV A;  2LDR A;  4LR6 A;  5FG6 A;  3ZVY A;  2M3H A;  3QZS A;  2KU3 A;  3QZV A;  4W4U A;  2OUO A;  2YHN A;  3ZPV E;  4AKN A;  5DKC A;  2H0D B;  4UIV A;  5EK9 A;  5H85 A;  4NXJ A;  5HLS A;  5FH8 A;  2KIZ A;  4YAB A;  5LKX A;  3HMF A;  5E0R A;  5F61 A;  5HRV A;  1WEP A;  5IGM A;  5EPB A;  5EM3 A;  4UI9 B;  3GV4 A;  5F62 A;  5FE2 A;  4ZDT A;  4LAD B;  1ZS5 A;  4YYI A;  2JRJ A;  5IGN A;  5LJ1 A;  4YBM A;  2HYE D;  4CUT A;  2C2L A;  5LVQ A;  2Y1M A;  4QSW A;  4I7C A;  4MR6 A;  2YUC A;  5II1 A;  5HQ7 A;  1WE9 A;  4A9J A;  5EWW A;  4MR4 A;  4TZ8 A;  2K1J A;  1N87 A;  5BT4 A;  5CY9 A;  2M85 A;  4A9E A;  5CUG A;  5C7N A;  5C89 A;  2KWK A;  5DLX A;  4LRG A;  2KE1 A;  4TU6 A;  2KWJ A;  5CUE A;  5I88 A;  2Y43 A;  4NUC A;  2L84 A;  4MR3 A;  4O70 A;  5A82 A;  4R2Y A;  4IR4 A;  5FG5 A;  5AIU A;  3LRQ A;  2H0D A;  2ZET C;  5B79 A;  3C6W A;  5B77 A;  3O37 A;  3P5O A;  3ZPV 1;  2BAY A;  2RSD A;  2DVR A;  5II2 A;  5DFD A;  5HQ6 A;  4YC9 A;  3UVW A;  4O7F A;  4NR6 A;  2YQM A;  4MVT A;  5CZG A;  4A9H A;  3L1Z B;  1K2F A;  4LK9 A;  5CQ6 A;  5L8T A;  1JM7 A;  1WEM A;  4I7D A;  2M1R A;  5EWV A;  3O33 A;  2FUI A;  5G04 B;  3ZVZ B;  4YYD A;  5KH7 A;  5CRZ A;  2LSP B;  3IU5 A;  5CQA A;  2RI7 A;  3RTR B;  2L80 A;  4PTB A;  2ECJ A;  2L0B A;  4WHW A;  1IYM A;  4QEW A;  5LVR A;  2LN0 A;  5B75 A;  5J3X A;  3QZT A;  5FER A;  5FE9 A;  5DKD A;  5KU3 A;  2KGG A;  2VJE B;  2DVQ A;  5A7C A;  5D7X A;  3HME A;  4YYK A;  4QBM A;  2E7O A;  2MJV B;  2E7N A;  3SVG A;  4CUQ A;  5TCM A;  4O7A A;  4YYN A;  3U5N A;  5DW1 A;  4O76 A;  4TTE A;  5JG6 A;  4UP5 A;  4Q0O A;  4F3I A;  1WEV A;  2KFT A;  4PS5 A;  5C8G A;  2LRI C;  2E3K A;  3NG2 A;  4J1P A;  4QSX A;  5DW2 A;  1WEQ A;  3KNV A;  4NQN A;  4NQM A;  4ZQL A;  1RMD A;  4O71 A;  4PY6 A;  5ENH A;  2DAT A;  5F2P A;  5CPE A;  4YY4 A;  4QY4 A;  4Y03 A;  4XUA A;  1VYX A;  2QIC A;  5FE6 A;  4MEO A;  3PUQ A;  3O36 A;  4RVR A;  5KHM A;  4QF3 A;  4QUU A;  5L8U A;  5G4S A;  2OO1 A;  5I83 A;  2G43 A;  4HBV A;  2UZG A;  4XY8 A;  3DAI A;  5JWM A;  3HCU A;  5CP5 A;  2IDA A;  3P1E A;  5DFC A;  2VPD A;  3UVD A;  5D0C A;  1F68 A;  4NN2 A;  4DON A;  2MT5 A;  2VNF A;  5I3L A;  3S91 A;  4O7C A;  5ETB A;  1F62 A;  5EIC A;  4A4C A;  4LC2 A;  4QB3 A;  1VD4 A;  5H1T A;  4IC2 A;  3O70 A;  3UVX A;  1EQF A;  5I7X A;  2GRC A;  2RNW A;  5A5R A;  5D3N A;  4IR5 A;  4QSS A;  2L5E A;  2I7K A;  5KTW A;  5EWC A;  4YH4 A;  3KV6 A;  4MEP A;  3V43 A;  4R7E A;  1X4I A;  2ECI A;  4A49 A;  4IR6 A;  5FFY A;  4OUF A;  2YSJ A;  2R0Y A;  2RFJ A;  5DYU A;  4UIT A;  5DYA A;  3MQM A;  3G0J A;  2EA6 A;  5EPS A;  1JM4 B;  5TAB A;  3DWY A;  4CFL A;  4HXO A;  3MUL A;  5F60 A;  4NR8 A;  4QZS A;  2YHO A;  5C11 A;  5HCL A;  4CFK A;  5LJ0 A;  3O34 A;  5HRW A;  4QSP A;  5I1Q A;  4QYD A;  4GND A;  1N72 A;  5EI4 A;  4CUR A;  5KTX A;  5D3T A;  1JM7 B;  5F25 A;  4UIU A;  2MIQ A;  4Z93 A;  4CA1 A;  5CUC A;  4LYI A;  2EGP A;  4MEQ A;  4NUE A;  5TB6 A;  5CUA A;  3TLP A;  5FG4 A;  5HEM A;  4CUP A;  4CUS A;  1WIM A;  2L75 A;  4NUD A;  5C85 A;  5IBN A;  3N9L A;  2PUY A;  4AVX A;  4TT4 A;  5CQ4 A;  4PKL A;  5ENE A;  3LXJ A;  4N4I A;  4UIW A;  2VJE A;  4AUQ B;  4O7E A;  2JMD A;  4X2I A;  5I29 A;  5D1K B;  4UYG A;  4HXM A;  4UIZ A;  5IGL A;  4BHW A;  3MHH A;  4J3I A;  5D3S A;  1WEW A;  3C5K A;  4XY9 A;  2KGI A;  5F1L A;  4YBT A;  5L97 A;  3M62 A;  4XYA A;  2YDW A;  2RS9 B;  4IOR A;  4UIY A;  4BW3 A;  4Z6I A;  2C2V S;  2LGV A;  1E4U A;  3IHP A;  3SVH A;  2F42 A;  3LQJ A;  5ENB A;  2QIZ A;  3M63 A;  4S3O C;  1JSP B;  5L98 A;  3JVJ A;  5FEY A;  2E6S A;  4L58 A;  5A5S A;  2MA6 A;  4YYJ A;  4O78 A;  4BW2 A;  2RNY A;  5ENI A;  2VPB A;  4UYF A;  5EWH A;  4QUT A;  3HCS A;  5DYC A;  4TT6 A;  5FB1 A;  2YQL A;  4C67 A;  2YSM A;  2Y1N A;  5FE7 A;  4N4G A;  1E6I A;  4HXN A;  5BT5 A;  4CL9 A;  4NR4 A;  4NRC A;  5CQT A;  2ECW A;  5FFW A;  1MM2 A;  5E7D A;  5HEN A;  5BT3 A;  4B86 C;  1WEO A;  5ENC A;  4CCG X;  5FB0 A;  3ZYQ A;  2FSA A;  2ECN A;  4NR9 A;  5KO4 A;  3D7C A;  5HRX A;  4WZ2 A;  3U5K A;  2R0S A;  2K17 A;  4LKA A;  3RPG B;  4J0R A;  4HBY A;  3Q2E A;  5F36 A;  5CQ5 A;  5ENJ A;  5KH9 A;  5E9Y A;  3JVL A;  5HEL A;  3LQI A;  2EOD A;  1WGM A;  2LXH C;  2D8S A;  3O35 A;  4YK0 A;  2G6Q A;  4GB0 A;  5EIS A;  4WA6 A;  4FLP A;  4OGI A;  3RPG C;  1CHC A;  4WHU A;  3N9O A;  2RO1 A;  5AIT A;  5D26 A;  4QC3 A;  2WP2 A;  4A9F A;  1HYJ A;  4F52 B;  4HXK A; 
#chains in the Genus database with same CATH topology
 5SVX A;  3MDB C;  4A4B A;  2VPE A;  3IU6 A;  1FP0 A;  2YUR A;  4LYS A;  1XWH A;  4TT2 A;  3NXB A;  4QNS A;  2N9G A;  5TDW A;  2RNX A;  5EGU A;  5E9L A;  2FD4 A;  5J0D A;  4YYG A;  5C87 A;  4BW1 A;  5G4R A;  4NYV A;  4L7X A;  4GNG A;  1G25 A;  4BW4 A;  5D3P A;  4TS8 A;  4MSX A;  4QR5 A;  5I40 A;  2KWN A;  5E73 A;  2OXQ C;  5FFV A;  4QEU A;  5A85 A;  2KTB B;  5F3A A;  5DLZ A;  5E9V A;  5ACY A;  3GL6 A;  4QST A;  4NR5 A;  3LJW A;  2XP0 A;  5EWD A;  5FDZ A;  5A81 A;  4AKH A;  2CT2 A;  2E6R A;  3LJU X;  2YEL A;  3SOW A;  4KV1 A;  4V3L C;  2DVS A;  4CUU A;  5D3J A;  3Q2F A;  1LDK C;  5SVY A;  5G0F A;  3DWD A;  4AKI A;  3G0L A;  5CQ8 A;  2HDP A;  3K2J A;  3UW9 A;  1U6G B;  4LLB A;  5FE5 A;  5C4Q A;  4ALG A;  3MB3 A;  4Q6F A;  2VJF B;  4WIV A;  3MHS A;  2MA5 A;  4O7B A;  5LKU A;  5I7Y A;  2VJF A;  5KTU A;  3ZTG A;  2R0V A;  2KRE A;  4C9Z A;  4O75 A;  5CUD A;  3N9M A;  5CS8 A;  4ZC9 A;  2YYN A;  5E3D A;  5D3H A;  4QSQ A;  1X0J A;  4PCI A;  5F5Z A;  4NRA A;  5ENG A;  5H1V A;  3O7A A;  5TBN A;  2NAA A;  5A5Q A;  2CKL B;  5I89 A;  4ZW1 A;  4UYF B;  4YBS A;  3DQV R;  5A5N A;  5HJC A;  1VFY A;  2CKL A;  5LUU A;  3FJU B;  1Z6U A;  4F1P A;  3KDE C;  4IOQ A;  4Z1Q A;  4NYX A;  1WIL A;  4Z0O A;  5FE4 A;  2G45 A;  4AYC B;  5B8D A;  4R8P K;  2VPG A;  5TDR A;  4ZUX U;  2LXP C;  2ECG A;  4AYC A;  1T1H A;  3SHB A;  5F63 A;  4MEN A;  2OWA A;  2F6N A;  5LCW B;  5IGK A;  2XOC A;  3U5O A;  4N4F A;  5SVI A;  3HTK C;  2YW5 A;  3L1X A;  2PNX A;  2MNZ A;  5CQ3 A;  4X3G A;  3SOU A;  5ENF A;  4FJC A;  5IID A;  4QR3 A;  3FL2 A;  5EU1 A;  5H9M A;  3T6R A;  4TU4 A;  5B78 A;  3VKH A;  5D3R A;  2D82 A;  5A5P A;  2B0O E;  4NRB A;  2CRW A;  4NS5 A;  4BBQ A;  4IR3 A;  2KWO A;  4UYH A;  3T9K A;  3ONI A;  2YW8 A;  4AI6 A;  4FK5 A;  2FFW A;  5FE0 A;  5CFW A;  4N3W A;  4HXL A;  4O77 A;  5I86 A;  3KQI A;  4WZ3 B;  4Z1S A;  3SOX A;  5B76 A;  3FAO A;  1WEU A;  5CUB A;  4LYW A;  4HXR A;  2AN6 A;  2L7P A;  4OGE A;  5AD2 A;  1WES A;  4A9K A;  3AAD A;  5D25 A;  2OSS A;  3EB6 A;  4HXP A;  4QC1 A;  1BOR A;  3N9Q A;  5HM0 A;  4AP4 A;  5DX4 A;  5DBM A;  1WEE A;  4A9N A;  5EPR A;  5DYX A;  3PHD A;  3Q1D A;  4QYL A;  4CLB A;  2YVR A;  5KH3 A;  3UV5 A;  1WFK A;  5CGP A;  4O62 A;  3HCT A;  5D3L A;  4Z6H A;  1Z2Q A;  4UYD A;  2CSY A;  4FIP A;  3JVK A;  5L96 A;  4BJX A;  5E9M A;  2DVV A;  5COI A;  5CRM A;  3UV2 A;  4O72 A;  3M99 A;  2K16 A;  4B7Y C;  3LQH A;  3U5M A;  4C66 A;  5D24 A;  2MD7 B;  4KV4 A;  3N9P A;  5FE8 A;  4TYL A;  5CU8 A;  2ECT A;  5LKZ A;  2LGG A;  4XI1 A;  4A9M A;  1WEN A;  2LAU A;  4GNF A;  3T7L A;  1WUG A;  1MBM A;  5EVA A;  5HFR A;  4HBW A;  4LJN A;  3L11 A;  4J0S A;  3P1D A;  5AME A;  3RCW A;  4LZ2 A;  4TKP B;  5FBX A;  5HQ5 A;  3S92 A;  2LV9 A;  4A9I A;  2R10 A;  3P1C A;  4A9O A;  4N4H A;  5CQ7 A;  2F6J A;  5L99 A;  3U5P A;  3MUK A;  4PCE A;  2L43 A;  3U5L A;  2MNY A;  2FUU A;  2XEU A;  2YT5 A;  4UYE A;  5D1L B;  2XB1 A;  4GNE A;  3JVM A;  2LGL A;  5JI8 A;  4V3K C;  5I80 A;  4QEV A;  3UVY A;  4YYM A;  2YEK A;  4YAX A;  2RR4 A;  2D9E A;  2M6M A;  3AQA A;  2MUM A;  2QJ0 A;  1JOC A;  4TZ2 A;  2JMI A;  2LQ6 A;  3DPL R;  5C13 A;  1FBV A;  5ETD A;  1MM3 A;  1HYI A;  2ECV A;  5DKA A;  2YQD A;  2KYU A;  4YAT A;  3UV4 A;  3N9N A;  3LDY A;  2E61 A;  4IOO A;  2I8N A;  4LDF A;  4A0C D;  1PUO A;  5IG6 A;  2VP7 A;  2L5U A;  2YU4 A;  3EB5 A;  4MR5 A;  1LDJ B;  4PPE A;  4YY6 A;  5K29 A;  2JMJ A;  1X4U A;  5DY7 A;  3U5J A;  4KCX A;  4NYW A;  2G4A A;  4HBX A;  4UIX A;  4Q0N A;  5F1H A;  5AD3 A;  5LJ2 A;  4XUB A;  4LZR A;  2DKW A;  4O64 A;  5E9I A;  4A9L A;  5A83 A;  4GPJ A;  4E96 A;  4IC3 A;  5EP7 A;  5DKH A;  4NR7 A;  5FE3 A;  2KKX A;  5H1U A;  3I2D A;  4OGC A;  3ZNI A;  1WUM A;  4YYH A;  2I50 A;  3GG3 A;  5G05 B;  5FH7 A;  2L85 A;  2H60 A;  3PLW A;  4HXS A;  4TQN A;  5FE1 A;  5AMF A;  1Z60 A;  1X4J A;  5E74 A;  3MB4 A;  2KKY A;  4O74 A;  2YYR A;  5DIN A;  3ASL A;  2YEM A;  2CSZ A;  4OGJ A;  2WP1 A;  1V87 A;  3VK6 A;  5EV9 A;  3I3J A;  5D1M B;  5E3G A;  4YH3 A;  5EQ1 A;  3SVF A;  5LKT A;  1ZBD B;  4WZ0 A;  2K4D A;  3P1F A;  4QR4 A;  5DFB A;  5A5O A;  2KR4 A;  2LGK A;  5FH6 A;  3FM8 C;  5TRB A;  4QF2 A;  3MXF A;  5EA1 A;  3SUB A;  4QSU A;  4ALH A;  4P5O B;  5E9K A;  3PUR A;  5CTL A;  3FKM X;  2DWW A;  4I7B A;  5EYA F;  5HFQ A;  2YRE A;  2DX8 A;  4FO9 A;  3HMH A;  4YAD A;  1DVP A;  4UP0 A;  2NXB A;  4LZS A;  4QSR A;  3ZYU A;  3KV5 A;  2MD8 C;  4S3O B;  4QSV A;  2LDR A;  2MKE A;  4LR6 A;  5FG6 A;  3ZVY A;  2M3H A;  3QZS A;  2KU3 A;  3QZV A;  4W4U A;  2OUO A;  2EGM A;  2YHN A;  3ZPV E;  4AKN A;  5DKC A;  2H0D B;  4UIV A;  5EK9 A;  5H85 A;  4NXJ A;  5HLS A;  5FH8 A;  2KIZ A;  4YAB A;  5LKX A;  3HMF A;  5E0R A;  5F61 A;  5HRV A;  1WEP A;  5IGM A;  5EPB A;  5EM3 A;  4UI9 B;  3GV4 A;  4Z0R A;  5F62 A;  5FE2 A;  4ZDT A;  4LAD B;  3D1B A;  1ZS5 A;  4YYI A;  2JRJ A;  5IGN A;  5LJ1 A;  3E2D A;  4YBM A;  2HYE D;  4CUT A;  2C2L A;  5LVQ A;  2Y1M A;  4QSW A;  4I7C A;  4MR6 A;  2YUC A;  5II1 A;  3LVR E;  5HQ7 A;  1WE9 A;  2CRR A;  4A9J A;  5EWW A;  4MR4 A;  4TZ8 A;  2K1J A;  1N87 A;  5BT4 A;  5CY9 A;  2M85 A;  4A9E A;  5CUG A;  5C7N A;  5C89 A;  2KWK A;  3LVQ E;  5DLX A;  4LRG A;  2KE1 A;  4TU6 A;  2KWJ A;  5CUE A;  5I88 A;  2Y43 A;  4NUC A;  2L84 A;  4MR3 A;  4O70 A;  5A82 A;  4R2Y A;  4IR4 A;  5FG5 A;  5AIU A;  3LRQ A;  2H0D A;  2ZET C;  3H7H A;  5B79 A;  3C6W A;  5B77 A;  2DSM A;  3O37 A;  3P5O A;  3ZPV 1;  2BAY A;  2RSD A;  2DVR A;  5II2 A;  5DFD A;  5HQ6 A;  4YC9 A;  3UVW A;  4O7F A;  3M7K A;  4NR6 A;  2YQM A;  4MVT A;  5CZG A;  4A9H A;  3L1Z B;  1K2F A;  4LK9 A;  5CQ6 A;  5L8T A;  1JM7 A;  1WEM A;  4I7D A;  2M1R A;  5EWV A;  3O33 A;  2FUI A;  5G04 B;  3ZVZ B;  4YYD A;  5KH7 A;  5CRZ A;  2LSP B;  3IU5 A;  5CQA A;  2RI7 A;  3RTR B;  2L80 A;  4PTB A;  2ECJ A;  2L0B A;  4WHW A;  4H9D A;  1IYM A;  4QEW A;  5LVR A;  2LN0 A;  5B75 A;  5J3X A;  3QZT A;  5FER A;  5FE9 A;  5DKD A;  5KU3 A;  2KGG A;  2CON A;  2VJE B;  2CSV A;  2DVQ A;  5A7C A;  5D7X A;  3HME A;  4YYK A;  4QBM A;  2E7O A;  2MJV B;  2E7N A;  3SVG A;  4CUQ A;  5TCM A;  4O7A A;  4YYN A;  3U5N A;  5DW1 A;  4O76 A;  4TTE A;  5JG6 A;  4UP5 A;  4Q0O A;  4F3I A;  1WEV A;  2KFT A;  4PS5 A;  5C8G A;  2LRI C;  2E3K A;  3NG2 A;  4J1P A;  4QSX A;  5DW2 A;  1WEQ A;  3KNV A;  4NQN A;  4NQM A;  4ZQL A;  1RMD A;  4O71 A;  4PY6 A;  5ENH A;  2DAT A;  5F2P A;  5CPE A;  4YY4 A;  4QY4 A;  4Y03 A;  4XUA A;  1VYX A;  2QIC A;  5FE6 A;  4MEO A;  3PUQ A;  3O36 A;  4RVR A;  5KHM A;  4QF3 A;  4QUU A;  5L8U A;  5G4S A;  2OO1 A;  5I83 A;  2G43 A;  4HBV A;  2UZG A;  4XY8 A;  3DAI A;  5JWM A;  3HCU A;  5CP5 A;  2IDA A;  3P1E A;  5DFC A;  2VPD A;  3UVD A;  5D0C A;  1F68 A;  4NN2 A;  4DON A;  2MT5 A;  2VNF A;  5I3L A;  3JUE A;  3S91 A;  4O7C A;  5ETB A;  2M13 A;  5EIC A;  4A4C A;  4LC2 A;  1F62 A;  4QB3 A;  1VD4 A;  2XOZ A;  5H1T A;  4IC2 A;  3O70 A;  3UVX A;  1EQF A;  5I7X A;  2GRC A;  2RNW A;  5A5R A;  5D3N A;  4IR5 A;  4QSS A;  2L5E A;  2I7K A;  5KTW A;  5EWC A;  4YH4 A;  3KV6 A;  4MEP A;  3V43 A;  3VKG A;  4R7E A;  1X4I A;  2ECI A;  4A49 A;  4IR6 A;  5FFY A;  4OUF A;  2DJA A;  2JM3 A;  2YSJ A;  2R0Y A;  2RFJ A;  5DYU A;  4UIT A;  5DYA A;  3MQM A;  3G0J A;  2EA6 A;  5EPS A;  1JM4 B;  5TAB A;  3DWY A;  4CFL A;  4HXO A;  3MUL A;  5F60 A;  4NR8 A;  4QZS A;  2YHO A;  5C11 A;  5HCL A;  4CFK A;  5LJ0 A;  3O34 A;  5HRW A;  4QSP A;  5I1Q A;  4QYD A;  4GND A;  1N72 A;  5EI4 A;  4CUR A;  5KTX A;  5D3T A;  2P57 A;  1JM7 B;  5F25 A;  4UIU A;  2MIQ A;  4Z93 A;  2EXU A;  4CA1 A;  5CUC A;  3ERR A;  4LYI A;  2EGP A;  4MEQ A;  4NUE A;  5TB6 A;  5CUA A;  3TLP A;  5FG4 A;  5HEM A;  4CUP A;  4CUS A;  1WIM A;  2L75 A;  4NUD A;  5C85 A;  5IBN A;  3N9L A;  2PUY A;  3DDT A;  4TT4 A;  3O47 A;  4AVX A;  5CQ4 A;  4PKL A;  5ENE A;  3LXJ A;  4N4I A;  4UIW A;  2VJE A;  4AUQ B;  4O7E A;  2JMD A;  4X2I A;  5I29 A;  5D1K B;  4UYG A;  4HXM A;  4UIZ A;  5IGL A;  4BHW A;  1DCQ A;  3MHH A;  4J3I A;  5D3S A;  1WEW A;  3C5K A;  4XY9 A;  2KGI A;  5F1L A;  3D1D A;  4YBT A;  5L97 A;  3M62 A;  4XYA A;  2YDW A;  2RS9 B;  4IOR A;  4UIY A;  4BW3 A;  4Z6I A;  2C2V S;  2LGV A;  3FEH A;  1E4U A;  3IHP A;  3SVH A;  2F42 A;  3LQJ A;  5ENB A;  2QIZ A;  3M63 A;  4S3O C;  1JSP B;  5L98 A;  3JVJ A;  5FEY A;  2E6S A;  3FAN A;  4L58 A;  5A5S A;  2MA6 A;  4QQ4 A;  4YYJ A;  4O78 A;  4BW2 A;  2RNY A;  5ENI A;  2VPB A;  4UYF A;  5EWH A;  4QUT A;  3HCS A;  2JUN A;  5DYC A;  4TT6 A;  5FB1 A;  2YQL A;  4C67 A;  2YSM A;  2Y1N A;  5FE7 A;  5K3Q A;  4N4G A;  1E6I A;  4HXN A;  5BT5 A;  4CL9 A;  4NR4 A;  4NRC A;  5CQT A;  2ECW A;  5FFW A;  1MM2 A;  5E7D A;  5HEN A;  5BT3 A;  4B86 C;  1WEO A;  5ENC A;  5SVI B;  5FB0 A;  3ZYQ A;  4CCG X;  2FSA A;  2ECN A;  4NR9 A;  5KO4 A;  3D7C A;  5HRX A;  4WZ2 A;  3U5K A;  2R0S A;  2K17 A;  4LKA A;  3RPG B;  2EJN A;  4J0R A;  4HBY A;  2D8U A;  3Q2E A;  5F36 A;  5CQ5 A;  5ENJ A;  5KH9 A;  5E9Y A;  3JVL A;  4AKG A;  5HEL A;  3LQI A;  2EOD A;  1WGM A;  2LXH C;  2D8S A;  3O35 A;  4YK0 A;  2G6Q A;  4GB0 A;  5EIS A;  4WA6 A;  4FLP A;  4OGI A;  3RPG C;  1CHC A;  4WHU A;  3N9O A;  2RO1 A;  5AIT A;  5D26 A;  4QC3 A;  2WP2 A;  4A9F A;  1ZKR A;  2IQJ A;  1HYJ A;  4F52 B;  2XOY A;  4HXK A; 
#chains in the Genus database with same CATH homology
 4A4B A;  2VPE A;  3IU6 A;  1FP0 A;  2YUR A;  4LYS A;  1XWH A;  4TT2 A;  3NXB A;  4QNS A;  2N9G A;  5TDW A;  2RNX A;  5EGU A;  5E9L A;  5J0D A;  4YYG A;  5C87 A;  4BW1 A;  5G4R A;  4NYV A;  4L7X A;  4GNG A;  1G25 A;  4BW4 A;  5D3P A;  4TS8 A;  4MSX A;  4QR5 A;  5I40 A;  2KWN A;  5E73 A;  2OXQ C;  5FFV A;  4QEU A;  5A85 A;  2KTB B;  5F3A A;  5DLZ A;  5E9V A;  5ACY A;  3GL6 A;  4QST A;  4NR5 A;  3LJW A;  5EWD A;  5FDZ A;  5A81 A;  2CT2 A;  2E6R A;  2YEL A;  3SOW A;  4KV1 A;  4V3L C;  2DVS A;  4CUU A;  5D3J A;  3Q2F A;  1LDK C;  5G0F A;  3G0L A;  5CQ8 A;  2HDP A;  3K2J A;  3UW9 A;  1U6G B;  4LLB A;  5FE5 A;  5C4Q A;  4ALG A;  3MB3 A;  4Q6F A;  2VJF B;  4WIV A;  3MHS A;  2MA5 A;  4O7B A;  5LKU A;  5I7Y A;  2VJF A;  5KTU A;  3ZTG A;  2R0V A;  2KRE A;  4C9Z A;  4O75 A;  5CUD A;  3N9M A;  5CS8 A;  4ZC9 A;  2YYN A;  5E3D A;  5D3H A;  4QSQ A;  1X0J A;  4PCI A;  5F5Z A;  4NRA A;  5ENG A;  5H1V A;  3O7A A;  5TBN A;  2NAA A;  5A5Q A;  2CKL B;  5I89 A;  4ZW1 A;  4UYF B;  4YBS A;  3DQV R;  5A5N A;  5HJC A;  1VFY A;  2CKL A;  5LUU A;  1Z6U A;  4IOQ A;  4Z1Q A;  4NYX A;  1WIL A;  5FE4 A;  2G45 A;  4AYC B;  5B8D A;  4R8P K;  2VPG A;  5TDR A;  4ZUX U;  2LXP C;  2ECG A;  4AYC A;  1T1H A;  3SHB A;  5F63 A;  4MEN A;  2F6N A;  5LCW B;  5IGK A;  3U5O A;  4N4F A;  3HTK C;  2YW5 A;  3L1X A;  2PNX A;  2MNZ A;  5CQ3 A;  4X3G A;  3SOU A;  5ENF A;  4FJC A;  5IID A;  4QR3 A;  3FL2 A;  5EU1 A;  5H9M A;  3T6R A;  4TU4 A;  5B78 A;  5D3R A;  2D82 A;  5A5P A;  4NRB A;  4NS5 A;  4BBQ A;  4IR3 A;  2KWO A;  4UYH A;  3ONI A;  2YW8 A;  4FK5 A;  5FE0 A;  5CFW A;  4N3W A;  4HXL A;  4O77 A;  5I86 A;  3KQI A;  4WZ3 B;  4Z1S A;  3SOX A;  5B76 A;  1WEU A;  5CUB A;  4LYW A;  4HXR A;  2AN6 A;  5AD2 A;  1WES A;  4A9K A;  3AAD A;  5D25 A;  2OSS A;  3EB6 A;  4HXP A;  4QC1 A;  1BOR A;  3N9Q A;  5HM0 A;  4AP4 A;  5DX4 A;  5DBM A;  1WEE A;  4A9N A;  5EPR A;  5DYX A;  3PHD A;  4QYL A;  4CLB A;  5KH3 A;  3UV5 A;  1WFK A;  5CGP A;  3HCT A;  5D3L A;  4Z6H A;  1Z2Q A;  4UYD A;  2CSY A;  4FIP A;  3JVK A;  5L96 A;  4BJX A;  5E9M A;  2DVV A;  5COI A;  5CRM A;  3UV2 A;  4O72 A;  3M99 A;  2K16 A;  4B7Y C;  3LQH A;  3U5M A;  4C66 A;  5D24 A;  2MD7 B;  4KV4 A;  3N9P A;  5FE8 A;  4TYL A;  5CU8 A;  2ECT A;  5LKZ A;  2LGG A;  4XI1 A;  4A9M A;  1WEN A;  4GNF A;  3T7L A;  1WUG A;  5EVA A;  5HFR A;  4HBW A;  4LJN A;  3L11 A;  4J0S A;  3P1D A;  5AME A;  3RCW A;  4LZ2 A;  4TKP B;  5FBX A;  5HQ5 A;  3S92 A;  2LV9 A;  4A9I A;  2R10 A;  3P1C A;  4A9O A;  4N4H A;  5CQ7 A;  2F6J A;  5L99 A;  3U5P A;  3MUK A;  4PCE A;  2L43 A;  3U5L A;  2MNY A;  2FUU A;  2XEU A;  2YT5 A;  4UYE A;  5D1L B;  2XB1 A;  4GNE A;  3JVM A;  2LGL A;  5JI8 A;  4V3K C;  5I80 A;  4QEV A;  3UVY A;  4YYM A;  2YEK A;  4YAX A;  2QJ0 A;  2D9E A;  2M6M A;  3AQA A;  2MUM A;  3DPL R;  1JOC A;  4TZ2 A;  2JMI A;  2LQ6 A;  5C13 A;  1FBV A;  5ETD A;  1MM3 A;  1HYI A;  2ECV A;  5DKA A;  2YQD A;  2KYU A;  4YAT A;  3UV4 A;  3N9N A;  4IOO A;  2I8N A;  4LDF A;  4A0C D;  5IG6 A;  2VP7 A;  2L5U A;  2YU4 A;  3EB5 A;  4MR5 A;  1LDJ B;  4PPE A;  4YY6 A;  5K29 A;  2JMJ A;  1X4U A;  5DY7 A;  3U5J A;  4KCX A;  4NYW A;  2G4A A;  4HBX A;  4UIX A;  4Q0N A;  5F1H A;  5AD3 A;  5LJ2 A;  4XUB A;  4LZR A;  2DKW A;  4O64 A;  5E9I A;  4A9L A;  5A83 A;  4GPJ A;  4E96 A;  4IC3 A;  5EP7 A;  5DKH A;  4NR7 A;  5FE3 A;  5H1U A;  3I2D A;  3ZNI A;  1WUM A;  4YYH A;  2I50 A;  3GG3 A;  5G05 B;  5FH7 A;  2L85 A;  2H60 A;  4HXS A;  4TQN A;  5FE1 A;  5AMF A;  1Z60 A;  1X4J A;  5E74 A;  3MB4 A;  4O74 A;  2YYR A;  5DIN A;  3ASL A;  2YEM A;  2CSZ A;  4OGJ A;  2WP1 A;  1V87 A;  3VK6 A;  5EV9 A;  3I3J A;  5D1M B;  5E3G A;  4YH3 A;  5EQ1 A;  3SVF A;  5LKT A;  1ZBD B;  4WZ0 A;  2K4D A;  3P1F A;  4QR4 A;  5DFB A;  5A5O A;  2KR4 A;  2LGK A;  5FH6 A;  5TRB A;  4QF2 A;  3MXF A;  5EA1 A;  4QSU A;  4ALH A;  4P5O B;  5E9K A;  3PUR A;  5CTL A;  3FKM X;  2DWW A;  4I7B A;  5EYA F;  5HFQ A;  2YRE A;  2DX8 A;  4FO9 A;  3HMH A;  4YAD A;  1DVP A;  4UP0 A;  2NXB A;  4LZS A;  4QSR A;  3ZYU A;  3KV5 A;  2MD8 C;  4S3O B;  4QSV A;  2LDR A;  4LR6 A;  5FG6 A;  3ZVY A;  2M3H A;  3QZS A;  2KU3 A;  3QZV A;  4W4U A;  2OUO A;  2YHN A;  3ZPV E;  4AKN A;  5DKC A;  2H0D B;  4UIV A;  5EK9 A;  5H85 A;  4NXJ A;  5HLS A;  5FH8 A;  2KIZ A;  4YAB A;  5LKX A;  3HMF A;  5E0R A;  5F61 A;  5HRV A;  1WEP A;  5IGM A;  5EPB A;  5EM3 A;  4UI9 B;  3GV4 A;  5F62 A;  5FE2 A;  4ZDT A;  4LAD B;  1ZS5 A;  4YYI A;  2JRJ A;  5IGN A;  5LJ1 A;  4YBM A;  2HYE D;  4CUT A;  2C2L A;  5LVQ A;  2Y1M A;  4QSW A;  4I7C A;  4MR6 A;  2YUC A;  5II1 A;  5HQ7 A;  1WE9 A;  4A9J A;  5EWW A;  4MR4 A;  4TZ8 A;  2K1J A;  1N87 A;  5BT4 A;  5CY9 A;  2M85 A;  4A9E A;  5CUG A;  5C7N A;  5C89 A;  2KWK A;  5DLX A;  4LRG A;  2KE1 A;  4TU6 A;  2KWJ A;  5CUE A;  5I88 A;  2Y43 A;  4NUC A;  2L84 A;  4MR3 A;  4O70 A;  5A82 A;  4R2Y A;  4IR4 A;  5FG5 A;  5AIU A;  3LRQ A;  2H0D A;  2ZET C;  5B79 A;  3C6W A;  5B77 A;  3O37 A;  3P5O A;  3ZPV 1;  2BAY A;  2RSD A;  2DVR A;  5II2 A;  5DFD A;  5HQ6 A;  4YC9 A;  3UVW A;  4O7F A;  4NR6 A;  2YQM A;  4MVT A;  5CZG A;  4A9H A;  3L1Z B;  1K2F A;  4LK9 A;  5CQ6 A;  5L8T A;  1JM7 A;  1WEM A;  4I7D A;  2M1R A;  5EWV A;  3O33 A;  2FUI A;  5G04 B;  3ZVZ B;  4YYD A;  5KH7 A;  5CRZ A;  2LSP B;  3IU5 A;  5CQA A;  2RI7 A;  3RTR B;  2L80 A;  4PTB A;  2ECJ A;  2L0B A;  4WHW A;  1IYM A;  4QEW A;  5LVR A;  2LN0 A;  5B75 A;  5J3X A;  3QZT A;  5FER A;  5FE9 A;  5DKD A;  5KU3 A;  2KGG A;  2VJE B;  2DVQ A;  5A7C A;  5D7X A;  3HME A;  4YYK A;  4QBM A;  2E7O A;  2MJV B;  2E7N A;  3SVG A;  4CUQ A;  5TCM A;  4O7A A;  4YYN A;  3U5N A;  5DW1 A;  4O76 A;  4TTE A;  5JG6 A;  4UP5 A;  4Q0O A;  4F3I A;  1WEV A;  2KFT A;  4PS5 A;  5C8G A;  2LRI C;  2E3K A;  3NG2 A;  4J1P A;  4QSX A;  5DW2 A;  1WEQ A;  3KNV A;  4NQN A;  4NQM A;  4ZQL A;  1RMD A;  4O71 A;  4PY6 A;  5ENH A;  2DAT A;  5F2P A;  5CPE A;  4YY4 A;  4QY4 A;  4Y03 A;  4XUA A;  1VYX A;  2QIC A;  5FE6 A;  4MEO A;  3PUQ A;  3O36 A;  4RVR A;  5KHM A;  4QF3 A;  4QUU A;  5L8U A;  5G4S A;  2OO1 A;  5I83 A;  2G43 A;  4HBV A;  2UZG A;  4XY8 A;  3DAI A;  5JWM A;  3HCU A;  5CP5 A;  2IDA A;  3P1E A;  5DFC A;  2VPD A;  3UVD A;  5D0C A;  1F68 A;  4NN2 A;  4DON A;  2MT5 A;  2VNF A;  5I3L A;  3S91 A;  4O7C A;  5ETB A;  1F62 A;  5EIC A;  4A4C A;  4LC2 A;  4QB3 A;  1VD4 A;  5H1T A;  4IC2 A;  3O70 A;  3UVX A;  1EQF A;  5I7X A;  2GRC A;  2RNW A;  5A5R A;  5D3N A;  4IR5 A;  4QSS A;  2L5E A;  2I7K A;  5KTW A;  5EWC A;  4YH4 A;  3KV6 A;  4MEP A;  3V43 A;  4R7E A;  1X4I A;  2ECI A;  4A49 A;  4IR6 A;  5FFY A;  4OUF A;  2YSJ A;  2R0Y A;  2RFJ A;  5DYU A;  4UIT A;  5DYA A;  3MQM A;  3G0J A;  2EA6 A;  5EPS A;  1JM4 B;  5TAB A;  3DWY A;  4CFL A;  4HXO A;  3MUL A;  5F60 A;  4NR8 A;  4QZS A;  2YHO A;  5C11 A;  5HCL A;  4CFK A;  5LJ0 A;  3O34 A;  5HRW A;  4QSP A;  5I1Q A;  4QYD A;  4GND A;  1N72 A;  5EI4 A;  4CUR A;  5KTX A;  5D3T A;  1JM7 B;  5F25 A;  4UIU A;  2MIQ A;  4Z93 A;  4CA1 A;  5CUC A;  4LYI A;  2EGP A;  4MEQ A;  4NUE A;  5TB6 A;  5CUA A;  3TLP A;  5FG4 A;  5HEM A;  4CUP A;  4CUS A;  1WIM A;  2L75 A;  4NUD A;  5C85 A;  5IBN A;  3N9L A;  2PUY A;  4AVX A;  4TT4 A;  5CQ4 A;  4PKL A;  5ENE A;  3LXJ A;  4N4I A;  4UIW A;  2VJE A;  4AUQ B;  4O7E A;  2JMD A;  4X2I A;  5I29 A;  5D1K B;  4UYG A;  4HXM A;  4UIZ A;  5IGL A;  4BHW A;  3MHH A;  4J3I A;  5D3S A;  1WEW A;  3C5K A;  4XY9 A;  2KGI A;  5F1L A;  4YBT A;  5L97 A;  3M62 A;  4XYA A;  2YDW A;  2RS9 B;  4IOR A;  4UIY A;  4BW3 A;  4Z6I A;  2C2V S;  2LGV A;  1E4U A;  3IHP A;  3SVH A;  2F42 A;  3LQJ A;  5ENB A;  2QIZ A;  3M63 A;  4S3O C;  1JSP B;  5L98 A;  3JVJ A;  5FEY A;  2E6S A;  4L58 A;  5A5S A;  2MA6 A;  4YYJ A;  4O78 A;  4BW2 A;  2RNY A;  5ENI A;  2VPB A;  4UYF A;  5EWH A;  4QUT A;  3HCS A;  5DYC A;  4TT6 A;  5FB1 A;  2YQL A;  4C67 A;  2YSM A;  2Y1N A;  5FE7 A;  4N4G A;  1E6I A;  4HXN A;  5BT5 A;  4CL9 A;  4NR4 A;  4NRC A;  5CQT A;  2ECW A;  5FFW A;  1MM2 A;  5E7D A;  5HEN A;  5BT3 A;  4B86 C;  1WEO A;  5ENC A;  4CCG X;  5FB0 A;  3ZYQ A;  2FSA A;  2ECN A;  4NR9 A;  5KO4 A;  3D7C A;  5HRX A;  4WZ2 A;  3U5K A;  2R0S A;  2K17 A;  4LKA A;  3RPG B;  4J0R A;  4HBY A;  3Q2E A;  5F36 A;  5CQ5 A;  5ENJ A;  5KH9 A;  5E9Y A;  3JVL A;  5HEL A;  3LQI A;  2EOD A;  1WGM A;  2LXH C;  2D8S A;  3O35 A;  4YK0 A;  2G6Q A;  4GB0 A;  5EIS A;  4WA6 A;  4FLP A;  4OGI A;  3RPG C;  1CHC A;  4WHU A;  3N9O A;  2RO1 A;  5AIT A;  5D26 A;  4QC3 A;  2WP2 A;  4A9F A;  1HYJ A;  4F52 B;  4HXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...