4YATA

Crystal structure of trim24 phd-bromodomain complexed with n-(1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl)-4-methoxybenzene-1-sulfonamide (5b)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
173
Chain Sequence
b'PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 173
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yatA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yatA01
5B76A 4QEWA 5E9YA 5FH6A 5II2A 3HCSA 3PUQA 5B75A 2CT2A 5DYAA 2KGIA 3HCUA 2ECTA 4TT6A 1N87A 3O35A 1F68A 2KWNA 5B8DA 3RTRB 1HYIA 1WEOA 5KO4A 4O7CA 1WUMA 4A9KA 2E6SA 4WA6A 5FE4A 2H0DA 3C5KA 4IC2A 4WHUA 4MR4A 5ENFA 4LDFA 2MT5A 4KV1A 4QR3A 5J3XA 5CRMA 5EP7A 5HQ6A 2YELA 4FLPA 4YYIA 5E9LA 5CQ6A 1E4UA 4GNFA 4Z6IA 2C2VS 2YURA 3TLPA 2OSSA 2K4DA 2K1JA 4S3OB 3GG3A 1T1HA 1XWHA 5I29A 1LDJB 5EPSA 2Y1MA 2M1RA 2QICA 1X0JA 3UV4A 4A4CA 4WZ2A 4QSSA 4YABA 4BW1A 4S3OC 5D1MB 5L99A 5HM0A 3UVXA 5CUCA 3SVGA 3IHPA 2L5UA 5CRZA 5F1LA 1WUGA 5TB6A 3LQJA 4XI1A 5KTWA 2R0SA 3DAIA 4IORA 5TDRA 4NQNA 4CFLA 5ENJA 4ZQLA 4LZ2A 3ZPVE 2FUIA 2YYRA 2C2LA 3I2DA 5J0DA 4MEPA 4PS5A 2MJVB 5FE3A 5IGLA 4HBVA 5HFRA 4CUUA 2I7KA 1CHCA 1WE9A 3S91A 5B78A 5FERA 4YBSA 4UP0A 4UYFA 4NR7A 2ECJA 3ZVZB 1Z60A 3Q2EA 2LXPC 4A9HA 5C4QA 5G4RA 5LJ2A 2YU4A 4MVTA 5EA1A 5DFDA 4YADA 1WEPA 4IOQA 3DPLR 5CQ5A 3RPGB 4YBMA 2VJEA 2OUOA 4QYLA 4QSXA 4UYFB 4YH4A 5G05B 4A0CD 4N4HA 4MENA 3P1DA 5IGKA 4HBWA 1IYMA 5D3JA 2YW8A 2YQMA 3JVMA 2D82A 4UYGA 5IIDA 2KWJA 4O7BA 2VJEB 4QUUA 5LKZA 1ZBDB 5FG4A 4BBQA 2YYNA 4LKAA 4O77A 2YREA 4TS8A 5LVQA 4PY6A 1WEWA 3O36A 5ENCA 3ZVYA 5H85A 2KIZA 2LGGA 4J0RA 4UIWA 1JM7A 2JRJA 5DLXA 4O70A 4O7AA 3IU6A 3S92A 3U5MA 2L0BA 2RSDA 5C89A 2QJ0A 1ZS5A 1F62A 5E9IA 4HXKA 2ECNA 3N9LA 4YH3A 4WZ0A 5CQ4A 3N9PA 5L8TA 5KHMA 5F62A 4UIYA 3SOXA 2CSZA 5B77A 4HXRA 5EWCA 5D3LA 1JM7B 5AD3A 2LXHC 2YDWA 2G43A 5IBNA 5D3PA 5I7YA 5CUBA 4Z1SA 4HBYA 4V3LC 4YYDA 2QIZA 1RMDA 4ZW1A 5LKUA 3SHBA 4NUCA 5EWDA 4F3IA 3Q2FA 2YEMA 4UP5A 2LGKA 2MIQA 4QSPA 4J0SA 5CUDA 4R7EA 4HXLA 2YQLA 4XYAA 4KV4A 2E7OA 4CA1A 4IR3A 5DFBA 4AUQB 5FB0A 4O74A 5HENA 4LLBA 5HELA 5CFWA 2YT5A 1JSPB 3QZTA 2MA5A 5F60A 4TYLA 4O71A 3LJWA 2KYUA 5FG5A 5D3SA 2EGPA 3VK6A 3P1FA 4C67A 2VPDA 4QY4A 4UIXA 4N3WA 5DBMA 4XUBA 5A7CA 5EQ1A 5ETDA 5LVRA 2RNXA 1WEUA 1JOCA 5CPEA 5D1LB 3GV4A 2M6MA 4B7YC 4QSQA 3U5KA 4NR9A 4HXMA 4QBMA 5LKTA 5LKXA 3MB3A 4QF2A 5G04B 3T7LA 5E9VA 5JWMA 4NYWA 2G6QA 2KGGA 4NR6A 2IDAA 3PURA 4MEQA 5HCLA 4YYJA 5HQ5A 2VJFA 3RCWA 2KFTA 3MXFA 2JMJA 4BJXA 5E9MA 4PKLA 1WEVA 4N4GA 5KH7A 4LC2A 4I7CA 5D25A 3G0LA 5ENBA 3I3JA 5FEYA 3LQIA 4XY8A 2H0DB 4X2IA 5E9KA 4YYHA 3HMFA 4PTBA 4YK0A 5FE7A 4QEVA 4BHWA 2VJFB 1DVPA 4UYDA 5EICA 4MEOA 4TTEA 5A82A 3FL2A 1WILA 4O75A 2RI7A 2F6NA 4AYCA 2LN0A 4HBXA 5D3NA 5I86A 4HXPA 4OUFA 2YSMA 4LK9A 5CUGA 3G0JA 1VYXA 5EPRA 5D24A 4YYKA 5L8UA 3P1CA 4QNSA 5CUEA 3HCTA 2LRIC 5IGMA 3GL6A 2MA6A 4AYCB 4YAXA 3MQMA 2KR4A 2VP7A 1FBVA 3UV2A 5EVAA 4FIPA 1VFYA 4A9FA 2KWOA 4NR4A 1EQFA 5AITA 5FE5A 4CUTA 2H60A 5FH8A 2N9GA 2CKLA 3ZPV1 4A4BA 4J3IA 4Q0NA 1MM3A 3KNVA 2DVQA 4C66A 5EPBA 4YY6A 4YY4A 2KTBB 5LJ1A 2OO1A 4RVRA 2FSAA 5A5QA 5KTXA 5FE2A 4LRGA 3UVYA 2L85A 5HEMA 4Z6HA 4J1PA 3U5LA 5EGUA 4NQMA 4AP4A 5B79A 5A85A 5HQ7A 2G45A 2PUYA 4BW4A 4LJNA 2YW5A 1WFKA 2WP2A 2R10A 4QYDA 1X4IA 5C13A 4QSUA 2VNFA 2ECGA 4GNGA 2CSYA 2DWWA 5A5PA 5I88A 3JVJA 5A5SA 5E7DA 3SVHA 1WIMA 5DFCA 5F1HA 3O7AA 5BT4A 5CZGA 5CU8A 4NXJA 5K29A 5L96A 5H9MA 5I3LA 2K16A 2RNWA 4MR3A 4YBTA 2E7NA 4LR6A 4R8PK 5LCWB 4LYSA 4OGIA 3DWYA 4QSRA 5HRWA 5DKDA 5F36A 5FE1A 5F5ZA 5CQ3A 5CQTA 5TRBA 2ZETC 5DKCA 3QZSA 3MULA 5HFQA 3T6RA 2L5EA 5CGPA 5CQAA 4Z1QA 3MHHA 5D3HA 5IG6A 2XEUA 3KV6A 4O64A 4N4FA 4O7FA 2RS9B 2NAAA 2YEKA 2E6RA 4QC3A 4C9ZA 2R0YA 3FKMX 3P1EA 1FP0A 4UIZA 2ECIA 3LQHA 2I8NA 4NUEA 5FDZA 5JI8A 4QR5A 3V43A 5COIA 4QZSA 4QSWA 3HMEA 5AMEA 3D7CA 4A9OA 2JMDA 3AADA 3MHSA 5L97A 4NRAA 4CLBA 5EK9A 2M3HA 3K2JA 1N72A 2MNZA 2VPBA 2F42A 4BW3A 3UW9A 3U5PA 4A9NA 3C6WA 4FO9A 4ZC9A 5HJCA 2DX8A 5DY7A 5CQ7A 4XUAA 5ENGA 5HLSA 2LDRA 2RNYA 5EWHA 2MUMA 4MSXA 3U5NA 2MNYA 2OXQC 1X4JA 5G4SA 2Y1NA 5I83A 1WGMA 1Z6UA 4TT4A 4NRCA 5EI4A 5DW2A 5ENEA 5AD2A 2AN6A 2VPGA 2YHOA 3M63A 3MB4A 5FFVA 2D9EA 3KV5A 1E6IA 4AVXA 5E0RA 5FE8A 2LGVA 2GRCA 5F61A 3ZYQA 2F6JA 4GPJA 4O78A 3UV5A 5KH9A 4YYGA 2MD7B 4LYWA 4DONA 2HDPA 2JMIA 5JG6A 4A9LA 5KU3A 5FH7A 3SOUA 5KTUA 2DKWA 4NYXA 4N4IA 4NR5A 2VPEA 1BORA 4A9EA 3HTKC 3L1ZB 1JM4B 4YC9A 1V87A 4TZ2A 2YQDA 1WEQA 5C11A 4ALHA 5DW1A 5AMFA 2PNXA 2YHNA 4LZSA 4CCGX 4TU6A 5EV9A 5D3TA 5DLZA 4CUPA 4MR5A 2ECVA 2L43A 5CTLA 4LADB 3N9OA 4WIVA 5EM3A 2DVRA 2YUCA 4UYEA 1X4UA 5FFYA 4ZDTA 3MUKA 4CURA 4TT2A 5D7XA 4B86C 4W4UA 5F2PA 4IC3A 4QEUA 2CKLB 4QSVA 5I7XA 5TBNA 2HYED 1VD4A 5FE6A 4LZRA 4QUTA 5DKHA 4YYMA 5LJ0A 4P5OB 5G0FA 2DVVA 1K2FA 4FJCA 1WENA 4R2YA 4NYVA 5A5RA 3KQIA 4MR6A 2LV9A 1HYJA 3DQVR 5DX4A 4NS5A 3JVKA 4HXOA 2KU3A 5E3DA 4ZUXU 3L11A 5DYUA 4QR4A 5F63A 4A9JA 2FUUA 4Z93A 4Q0OA 5EISA 4L58A 4PPEA 5EU1A 4YYNA 4X3GA 3O33A 5DYXA 4UIUA 2L75A 3ZYUA 5CY9A 2RFJA 5DYCA 2D8SA 5EWWA 3M99A 3IU5A 2K17A 2MD8C 3LXJA 5E74A 4NR8A 4O7EA 4UITA 3UVDA 3NG2A 4CUSA 4UYHA 2BAYA 2DATA 4HXSA 4IR5A 4TZ8A 1G25A 3UVWA 2WP1A 2UZGA 2RO1A 4E96A 3HMHA 4WZ3B 5HRVA 4WHWA 4QC1A 4CUQA 3P5OA 2LQ6A 4OGJA 5EYAF 3ZNIA 5H1UA 3O34A 5C87A 2M85A 5I89A 2G4AA 5II1A 4CFKA 2EA6A 3ASLA 4NN2A 3AQAA 5I40A 5F3AA 2L84A 5KH3A 3SOWA 3RPGC 4F52B 3ONIA 5CP5A 5AIUA 3N9NA 2NXBA 3L1XA 5C85A 5D0CA 3JVLA 5FB1A 4XY9A 5L98A 4UIVA 4PCEA 5ENHA 5A83A 5ACYA 2ECWA 4O76A 4I7DA 5CS8A 5BT5A 5HRXA 5ETBA 3NXBA 4A49A 4TU4A 5C7NA 4TQNA 2LSPB 4QSTA 3ZTGA 5D3RA 2KREA 5E73A 5ENIA 5A81A 4LYIA 5A5NA 5H1VA 1WEMA 2Y43A 3M62A 3PHDA 4TKPB 5TDWA 5IGNA 3O37A 5F25A 4HXNA 3O70A 5LUUA 5C8GA 4Q6FA 4V3KC 4QF3A 5H1TA 3U5JA 5FFWA 4PCIA 5FBXA 3EB6A 5DINA 4BW2A 2YSJA 2E3KA 3N9MA 1WESA 4A9MA 4KCXA 4A9IA 5BT3A 4AKNA 4L7XA 2KE1A 2R0VA 4ALGA 2EODA 2L80A 4I7BA 3SVFA 5A5OA 4QB3A 2LGLA 5D1KB 4Y03A 5E3GA 4IOOA 5EWVA 5DKAA 4O72A 2XB1A 4GNEA 5TABA 5FG6A 5TCMA 3N9QA 2KWKA 3U5OA 5I1QA 5CQ8A 5D26A 4CL9A 5FE9A 1WEEA 1Z2QA 3LRQA 1MM2A 3QZVA 4FK5A 4IR4A 5FE0A 4IR6A 5I80A 4NRBA 4GB0A 2DVSA 4YATA 3EB5A 4UI9B 2I50A 1LDKC 4GNDA 4NUDA 5CUAA 1U6GB
chains in the Genus database with same CATH superfamily
5B76A 4QEWA 5E9YA 5FH6A 5II2A 3HCSA 3PUQA 2CSVA 5B75A 2CT2A 5DYAA 2KGIA 3HCUA 2ECTA 4TT6A 1N87A 3O35A 1F68A 2KWNA 5B8DA 3RTRB 1HYIA 1WEOA 5KO4A 4O7CA 1WUMA 4A9KA 2E6SA 4WA6A 5FE4A 2H0DA 3C5KA 4IC2A 4WHUA 4MR4A 5ENFA 4LDFA 2MT5A 4KV1A 4QR3A 5J3XA 5CRMA 5EP7A 5HQ6A 2YELA 4FLPA 4YYIA 5SVIA 5E9LA 5CQ6A 1E4UA 4GNFA 1DCQA 4Z6IA 2C2VS 2YURA 3TLPA 2OSSA 2K4DA 2K1JA 4S3OB 3GG3A 1T1HA 1XWHA 5I29A 1LDJB 5EPSA 2Y1MA 4AKIA 2M1RA 2QICA 5SVIB 1X0JA 2FD4A 3UV4A 4A4CA 4WZ2A 4QSSA 4YABA 4BW1A 4S3OC 5D1MB 5L99A 5HM0A 3UVXA 5CUCA 3SVGA 3IHPA 2L5UA 5CRZA 5F1LA 1WUGA 5TB6A 3LQJA 4XI1A 5KTWA 2R0SA 3DAIA 4IORA 2XP0A 5TDRA 4NQNA 4CFLA 5ENJA 4ZQLA 4LZ2A 3ZPVE 2FUIA 2YYRA 2C2LA 3I2DA 5J0DA 4MEPA 4PS5A 2MJVB 5FE3A 5IGLA 4HBVA 5HFRA 4CUUA 2I7KA 1CHCA 1WE9A 3FAOA 3S91A 5B78A 5FERA 4YBSA 4UP0A 4UYFA 4NR7A 2ECJA 2XOYA 3DWDA 1Z60A 3ZVZB 3Q2EA 2LXPC 4AKGA 4A9HA 5C4QA 5G4RA 5LJ2A 2YU4A 2MKEA 4MVTA 5EA1A 5DFDA 4YADA 1WEPA 2D8UA 4IOQA 3DPLR 5CQ5A 3RPGB 4YBMA 2VJEA 5SVYA 2OUOA 4QYLA 4QSXA 4UYFB 4YH4A 2M13A 5G05B 4N4HA 4MENA 3P1DA 5IGKA 4HBWA 4A0CD 1IYMA 5D3JA 3D1BA 2YW8A 4AI6A 2YQMA 3JVMA 2D82A 4UYGA 5IIDA 2KWJA 4O7BA 3H7HA 2VJEB 4QUUA 5LKZA 1ZBDB 2L7PA 5FG4A 5K3QA 4BBQA 2YYNA 4LKAA 4O77A 2YREA 4TS8A 5LVQA 4PY6A 1WEWA 3O36A 5ENCA 3ZVYA 5H85A 2KIZA 2LGGA 4J0RA 4UIWA 2KKYA 1JM7A 2JRJA 5DLXA 4O70A 4O7AA 3IU6A 3S92A 3U5MA 2L0BA 2RSDA 5C89A 2QJ0A 1ZS5A 1F62A 5E9IA 4HXKA 3VKHA 2ECNA 4YH3A 3N9LA 4WZ0A 5CQ4A 3N9PA 5L8TA 5KHMA 5F62A 4O62A 4UIYA 3SOXA 2CSZA 5B77A 4HXRA 5EWCA 5D3LA 1JM7B 5AD3A 2LXHC 2YDWA 2G43A 5IBNA 3LVRE 5D3PA 5I7YA 5CUBA 4Z1SA 4HBYA 4V3LC 4YYDA 2QIZA 1RMDA 4ZW1A 5LKUA 3SHBA 4NUCA 5EWDA 4F3IA 3Q2FA 2YEMA 4UP5A 2LGKA 2MIQA 4QSPA 4J0SA 5CUDA 4R7EA 4HXLA 2YQLA 4XYAA 1ZKRA 4KV4A 2E7OA 4CA1A 4IR3A 5DFBA 4AUQB 5FB0A 4O74A 5HENA 4LLBA 5HELA 5CFWA 2YT5A 1JSPB 3QZTA 2MA5A 5F60A 4TYLA 4O71A 3LJWA 2KYUA 5FG5A 5D3SA 4OGEA 2EGPA 3VK6A 3P1FA 4C67A 2VPDA 4QY4A 3PLWA 4UIXA 4N3WA 5DBMA 4XUBA 5A7CA 5EQ1A 5ETDA 5LVRA 2RNXA 1WEUA 3LJUX 4Z0OA 1JOCA 5CPEA 5D1LB 3GV4A 2M6MA 4B7YC 4QSQA 3U5KA 4NR9A 4HXMA 4QBMA 5LKTA 5LKXA 3MB3A 4QF2A 5G04B 3T7LA 5E9VA 5JWMA 4NYWA 2G6QA 2KGGA 4NR6A 2IDAA 3PURA 4MEQA 5HCLA 4YYJA 5HQ5A 2VJFA 3RCWA 2KFTA 3MXFA 2JMJA 4BJXA 5E9MA 4PKLA 1WEVA 4N4GA 5KH7A 4LC2A 4I7CA 5D25A 3G0LA 5ENBA 3I3JA 5FEYA 3LQIA 4XY8A 2H0DB 4X2IA 5E9KA 4YYHA 3HMFA 4PTBA 4YK0A 5FE7A 4QEVA 4BHWA 2VJFB 1DVPA 4UYDA 5EICA 4MEOA 4TTEA 5A82A 3FL2A 1WILA 4O75A 2RI7A 2F6NA 4AYCA 3M7KA 2LN0A 4HBXA 5D3NA 5I86A 4HXPA 4OUFA 2YSMA 3LVQE 4LK9A 5CUGA 3G0JA 1VYXA 5EPRA 5D24A 4YYKA 5L8UA 3P1CA 4QNSA 5CUEA 5SVXA 3HCTA 2LRIC 5IGMA 3GL6A 2MA6A 4AYCB 4YAXA 3MQMA 2KR4A 2VP7A 1FBVA 3UV2A 5EVAA 4FIPA 1VFYA 4A9FA 2KWOA 4NR4A 1EQFA 5AITA 5FE5A 1MBMA 4CUTA 2H60A 5FH8A 2N9GA 2B0OE 2CKLA 3ZPV1 4A4BA 4J3IA 3DDTA 4Q0NA 1MM3A 3KNVA 2DVQA 4C66A 5EPBA 4YY6A 4YY4A 2KTBB 5LJ1A 2OO1A 4RVRA 2FSAA 5A5QA 5KTXA 5FE2A 4LRGA 3UVYA 2L85A 5HEMA 4Z6HA 4J1PA 3U5LA 5EGUA 4NQMA 2DJAA 4AP4A 3D1DA 5B79A 5A85A 5HQ7A 2G45A 1PUOA 2PUYA 4BW4A 4LJNA 2YW5A 1WFKA 2WP2A 2R10A 4QYDA 1X4IA 5C13A 4QSUA 2VNFA 2ECGA 4GNGA 2CSYA 2DWWA 5A5PA 5I88A 3JVJA 5A5SA 5E7DA 3SVHA 1WIMA 5DFCA 5F1HA 3O7AA 4QQ4A 5BT4A 5CZGA 5CU8A 4NXJA 5K29A 5L96A 2EJNA 5H9MA 5I3LA 2K16A 2RNWA 4MR3A 4YBTA 2E7NA 4LR6A 4R8PK 5LCWB 4LYSA 4OGIA 3DWYA 4QSRA 5HRWA 5DKDA 5F36A 2CRWA 5FE1A 5F5ZA 5CQ3A 5CQTA 5TRBA 2ZETC 5DKCA 3QZSA 3MULA 5HFQA 3T6RA 2L5EA 5CGPA 5CQAA 4Z1QA 3MHHA 5D3HA 2IQJA 5IG6A 2XEUA 2OWAA 3FJUB 3KV6A 4O64A 4N4FA 4O7FA 2RS9B 2NAAA 2YEKA 2E6RA 4QC3A 4Z0RA 4C9ZA 2R0YA 3FKMX 3P1EA 1FP0A 4UIZA 2ECIA 3LQHA 2I8NA 4NUEA 5FDZA 5JI8A 4QR5A 3V43A 5COIA 4QZSA 4QSWA 3HMEA 5AMEA 3D7CA 2CRRA 4A9OA 4OGCA 2JMDA 3AADA 3MHSA 5L97A 4NRAA 4CLBA 5EK9A 2M3HA 3K2JA 1N72A 2MNZA 2VPBA 2F42A 4BW3A 3UW9A 3U5PA 4A9NA 3C6WA 4FO9A 4ZC9A 3FM8C 5HJCA 2DX8A 3KDEC 5DY7A 5CQ7A 4XUAA 5ENGA 5HLSA 2LDRA 2RNYA 5EWHA 2MUMA 4MSXA 3U5NA 2MNYA 2OXQC 1X4JA 5G4SA 2Y1NA 5I83A 1WGMA 1Z6UA 4TT4A 4NRCA 5EI4A 5DW2A 5ENEA 5AD2A 2JUNA 2CONA 2AN6A 2VPGA 2YHOA 3M63A 3MB4A 5FFVA 2D9EA 2E61A 3KV5A 1E6IA 4AVXA 5E0RA 5FE8A 2LGVA 2GRCA 5F61A 3O47A 3ZYQA 2F6JA 4GPJA 4O78A 3UV5A 4H9DA 5KH9A 3LDYA 4YYGA 2MD7B 4LYWA 4DONA 2HDPA 2JMIA 5JG6A 4A9LA 5KU3A 5FH7A 3SOUA 5KTUA 2DKWA 4NYXA 4N4IA 4NR5A 2VPEA 1BORA 4A9EA 3HTKC 3VKGA 3L1ZB 1JM4B 4YC9A 1V87A 4TZ2A 2YQDA 1WEQA 5C11A 4ALHA 5DW1A 5AMFA 2PNXA 2YHNA 4LZSA 4CCGX 4TU6A 5EV9A 5D3TA 5DLZA 4CUPA 4MR5A 2ECVA 2L43A 5CTLA 4LADB 3N9OA 4WIVA 5EM3A 2DVRA 2YUCA 4UYEA 1X4UA 5FFYA 4ZDTA 3MUKA 2DSMA 4CURA 4TT2A 5D7XA 4B86C 4W4UA 5F2PA 4IC3A 4QEUA 2CKLB 2EXUA 4QSVA 5I7XA 5TBNA 2HYED 1VD4A 5FE6A 4LZRA 4QUTA 5DKHA 4YYMA 5LJ0A 4P5OB 5G0FA 2DVVA 1K2FA 4FJCA 1WENA 4R2YA 4NYVA 5A5RA 2KKXA 3KQIA 4F1PA 4MR6A 2LV9A 2JM3A 1HYJA 3DQVR 5DX4A 4NS5A 3JVKA 4HXOA 2KU3A 5E3DA 4ZUXU 3L11A 5DYUA 4QR4A 5F63A 4A9JA 2FUUA 4Z93A 4Q0OA 5EISA 4L58A 4PPEA 5EU1A 4YYNA 4X3GA 3O33A 5DYXA 4UIUA 2L75A 3ZYUA 5CY9A 2RFJA 5DYCA 4AKHA 2D8SA 5EWWA 3M99A 3IU5A 2K17A 2MD8C 3LXJA 5E74A 4NR8A 4O7EA 4UITA 3UVDA 3NG2A 4CUSA 4UYHA 2BAYA 2DATA 4HXSA 4IR5A 4TZ8A 1G25A 3UVWA 2WP1A 2UZGA 3Q1DA 2RO1A 4E96A 3HMHA 4WZ3B 5HRVA 4WHWA 4QC1A 4CUQA 3P5OA 2LQ6A 4OGJA 5EYAF 3T9KA 3ZNIA 5H1UA 3O34A 5C87A 2M85A 5I89A 2G4AA 5II1A 4CFKA 2EA6A 3ASLA 4NN2A 3AQAA 5I40A 5F3AA 2L84A 5KH3A 3SOWA 3RPGC 4F52B 3ONIA 5CP5A 5AIUA 3N9NA 2LAUA 2NXBA 3L1XA 5C85A 3ERRA 5D0CA 3JVLA 5FB1A 4XY9A 5L98A 4UIVA 4PCEA 5ENHA 5A83A 5ACYA 2ECWA 4O76A 4I7DA 5CS8A 5BT5A 5HRXA 3E2DA 5ETBA 3NXBA 4A49A 4TU4A 5C7NA 4TQNA 2LSPB 4QSTA 3ZTGA 5D3RA 2KREA 5E73A 5ENIA 5A81A 4LYIA 3FANA 5A5NA 5H1VA 1WEMA 2Y43A 3M62A 3PHDA 4TKPB 5TDWA 5IGNA 3O37A 5F25A 4HXNA 3O70A 5LUUA 5C8GA 4Q6FA 4V3KC 4QF3A 5H1TA 3U5JA 5FFWA 4PCIA 5FBXA 3EB6A 2XOCA 5DINA 4BW2A 2EGMA 2YSJA 2E3KA 3N9MA 1WESA 4A9MA 4KCXA 4A9IA 5BT3A 4AKNA 4L7XA 2KE1A 2R0VA 4ALGA 2EODA 2L80A 4I7BA 3SVFA 5A5OA 4QB3A 2LGLA 2XOZA 4Y03A 5E3GA 4IOOA 5EWVA 5D1KB 4O72A 2XB1A 4GNEA 5DKAA 5TABA 3MDBC 5FG6A 2FFWA 5TCMA 3N9QA 2KWKA 3U5OA 5I1QA 5CQ8A 5D26A 4CL9A 2RR4A 5FE9A 1WEEA 1Z2QA 3LRQA 1MM2A 3QZVA 4FK5A 4IR4A 5FE0A 4IR6A 5I80A 3JUEA 4NRBA 2YVRA 2P57A 4GB0A 3SUBA 2DVSA 4YATA 3EB5A 4UI9B 2I50A 1LDKC 3FEHA 4GNDA 4NUDA 5CUAA 1U6GB
chains in the Genus database with same CATH topology
5B76A 4QEWA 5E9YA 5FH6A 5II2A 3HCSA 3PUQA 5B75A 2CT2A 5DYAA 2KGIA 3HCUA 2ECTA 4TT6A 1N87A 3O35A 1F68A 2KWNA 5B8DA 3RTRB 1HYIA 1WEOA 5KO4A 4O7CA 1WUMA 4A9KA 2E6SA 4WA6A 5FE4A 2H0DA 3C5KA 4IC2A 4WHUA 4MR4A 5ENFA 4LDFA 2MT5A 4KV1A 4QR3A 5J3XA 5CRMA 5EP7A 5HQ6A 2YELA 4FLPA 4YYIA 5E9LA 5CQ6A 1E4UA 4GNFA 4Z6IA 2C2VS 2YURA 3TLPA 2OSSA 2K4DA 2K1JA 4S3OB 3GG3A 1T1HA 1XWHA 5I29A 1LDJB 5EPSA 2Y1MA 2M1RA 2QICA 1X0JA 3UV4A 4A4CA 4WZ2A 4QSSA 4YABA 4BW1A 4S3OC 5D1MB 5L99A 5HM0A 3UVXA 5CUCA 3SVGA 3IHPA 2L5UA 5CRZA 5F1LA 1WUGA 5TB6A 3LQJA 4XI1A 5KTWA 2R0SA 3DAIA 4IORA 5TDRA 4NQNA 4CFLA 5ENJA 4ZQLA 4LZ2A 3ZPVE 2FUIA 2YYRA 2C2LA 3I2DA 5J0DA 4MEPA 4PS5A 2MJVB 5FE3A 5IGLA 4HBVA 5HFRA 4CUUA 2I7KA 1CHCA 1WE9A 3S91A 5B78A 5FERA 4YBSA 4UP0A 4UYFA 4NR7A 2ECJA 3ZVZB 1Z60A 3Q2EA 2LXPC 4A9HA 5C4QA 5G4RA 5LJ2A 2YU4A 4MVTA 5EA1A 5DFDA 4YADA 1WEPA 4IOQA 3DPLR 5CQ5A 3RPGB 4YBMA 2VJEA 2OUOA 4QYLA 4QSXA 4UYFB 4YH4A 5G05B 4A0CD 4N4HA 4MENA 3P1DA 5IGKA 4HBWA 1IYMA 5D3JA 2YW8A 2YQMA 3JVMA 2D82A 4UYGA 5IIDA 2KWJA 4O7BA 2VJEB 4QUUA 5LKZA 1ZBDB 5FG4A 4BBQA 2YYNA 4LKAA 4O77A 2YREA 4TS8A 5LVQA 4PY6A 1WEWA 3O36A 5ENCA 3ZVYA 5H85A 2KIZA 2LGGA 4J0RA 4UIWA 1JM7A 2JRJA 5DLXA 4O70A 4O7AA 3IU6A 3S92A 3U5MA 2L0BA 2RSDA 5C89A 2QJ0A 1ZS5A 1F62A 5E9IA 4HXKA 2ECNA 3N9LA 4YH3A 4WZ0A 5CQ4A 3N9PA 5L8TA 5KHMA 5F62A 4UIYA 3SOXA 2CSZA 5B77A 4HXRA 5EWCA 5D3LA 1JM7B 5AD3A 2LXHC 2YDWA 2G43A 5IBNA 5D3PA 5I7YA 5CUBA 4Z1SA 4HBYA 4V3LC 4YYDA 2QIZA 1RMDA 4ZW1A 5LKUA 3SHBA 4NUCA 5EWDA 4F3IA 3Q2FA 2YEMA 4UP5A 2LGKA 2MIQA 4QSPA 4J0SA 5CUDA 4R7EA 4HXLA 2YQLA 4XYAA 4KV4A 2E7OA 4CA1A 4IR3A 5DFBA 4AUQB 5FB0A 4O74A 5HENA 4LLBA 5HELA 5CFWA 2YT5A 1JSPB 3QZTA 2MA5A 5F60A 4TYLA 4O71A 3LJWA 2KYUA 5FG5A 5D3SA 2EGPA 3VK6A 3P1FA 4C67A 2VPDA 4QY4A 4UIXA 4N3WA 5DBMA 4XUBA 5A7CA 5EQ1A 5ETDA 5LVRA 2RNXA 1WEUA 1JOCA 5CPEA 5D1LB 3GV4A 2M6MA 4B7YC 4QSQA 3U5KA 4NR9A 4HXMA 4QBMA 5LKTA 5LKXA 3MB3A 4QF2A 5G04B 3T7LA 5E9VA 5JWMA 4NYWA 2G6QA 2KGGA 4NR6A 2IDAA 3PURA 4MEQA 5HCLA 4YYJA 5HQ5A 2VJFA 3RCWA 2KFTA 3MXFA 2JMJA 4BJXA 5E9MA 4PKLA 1WEVA 4N4GA 5KH7A 4LC2A 4I7CA 5D25A 3G0LA 5ENBA 3I3JA 5FEYA 3LQIA 4XY8A 2H0DB 4X2IA 5E9KA 4YYHA 3HMFA 4PTBA 4YK0A 5FE7A 4QEVA 4BHWA 2VJFB 1DVPA 4UYDA 5EICA 4MEOA 4TTEA 5A82A 3FL2A 1WILA 4O75A 2RI7A 2F6NA 4AYCA 2LN0A 4HBXA 5D3NA 5I86A 4HXPA 4OUFA 2YSMA 4LK9A 5CUGA 3G0JA 1VYXA 5EPRA 5D24A 4YYKA 5L8UA 3P1CA 4QNSA 5CUEA 3HCTA 2LRIC 5IGMA 3GL6A 2MA6A 4AYCB 4YAXA 3MQMA 2KR4A 2VP7A 1FBVA 3UV2A 5EVAA 4FIPA 1VFYA 4A9FA 2KWOA 4NR4A 1EQFA 5AITA 5FE5A 4CUTA 2H60A 5FH8A 2N9GA 2CKLA 3ZPV1 4A4BA 4J3IA 4Q0NA 1MM3A 3KNVA 2DVQA 4C66A 5EPBA 4YY6A 4YY4A 2KTBB 5LJ1A 2OO1A 4RVRA 2FSAA 5A5QA 5KTXA 5FE2A 4LRGA 3UVYA 2L85A 5HEMA 4Z6HA 4J1PA 3U5LA 5EGUA 4NQMA 4AP4A 5B79A 5A85A 5HQ7A 2G45A 2PUYA 4BW4A 4LJNA 2YW5A 1WFKA 2WP2A 2R10A 4QYDA 1X4IA 5C13A 4QSUA 2VNFA 2ECGA 4GNGA 2CSYA 2DWWA 5A5PA 5I88A 3JVJA 5A5SA 5E7DA 3SVHA 1WIMA 5DFCA 5F1HA 3O7AA 5BT4A 5CZGA 5CU8A 4NXJA 5K29A 5L96A 5H9MA 5I3LA 2K16A 2RNWA 4MR3A 4YBTA 2E7NA 4LR6A 4R8PK 5LCWB 4LYSA 4OGIA 3DWYA 4QSRA 5HRWA 5DKDA 5F36A 5FE1A 5F5ZA 5CQ3A 5CQTA 5TRBA 2ZETC 5DKCA 3QZSA 3MULA 5HFQA 3T6RA 2L5EA 5CGPA 5CQAA 4Z1QA 3MHHA 5D3HA 5IG6A 2XEUA 3KV6A 4O64A 4N4FA 4O7FA 2RS9B 2NAAA 2YEKA 2E6RA 4QC3A 4C9ZA 2R0YA 3FKMX 3P1EA 1FP0A 4UIZA 2ECIA 3LQHA 2I8NA 4NUEA 5FDZA 5JI8A 4QR5A 3V43A 5COIA 4QZSA 4QSWA 3HMEA 5AMEA 3D7CA 4A9OA 2JMDA 3AADA 3MHSA 5L97A 4NRAA 4CLBA 5EK9A 2M3HA 3K2JA 1N72A 2MNZA 2VPBA 2F42A 4BW3A 3UW9A 3U5PA 4A9NA 3C6WA 4FO9A 4ZC9A 5HJCA 2DX8A 5DY7A 5CQ7A 4XUAA 5ENGA 5HLSA 2LDRA 2RNYA 5EWHA 2MUMA 4MSXA 3U5NA 2MNYA 2OXQC 1X4JA 5G4SA 2Y1NA 5I83A 1WGMA 1Z6UA 4TT4A 4NRCA 5EI4A 5DW2A 5ENEA 5AD2A 2AN6A 2VPGA 2YHOA 3M63A 3MB4A 5FFVA 2D9EA 3KV5A 1E6IA 4AVXA 5E0RA 5FE8A 2LGVA 2GRCA 5F61A 3ZYQA 2F6JA 4GPJA 4O78A 3UV5A 5KH9A 4YYGA 2MD7B 4LYWA 4DONA 2HDPA 2JMIA 5JG6A 4A9LA 5KU3A 5FH7A 3SOUA 5KTUA 2DKWA 4NYXA 4N4IA 4NR5A 2VPEA 1BORA 4A9EA 3HTKC 3L1ZB 1JM4B 4YC9A 1V87A 4TZ2A 2YQDA 1WEQA 5C11A 4ALHA 5DW1A 5AMFA 2PNXA 2YHNA 4LZSA 4CCGX 4TU6A 5EV9A 5D3TA 5DLZA 4CUPA 4MR5A 2ECVA 2L43A 5CTLA 4LADB 3N9OA 4WIVA 5EM3A 2DVRA 2YUCA 4UYEA 1X4UA 5FFYA 4ZDTA 3MUKA 4CURA 4TT2A 5D7XA 4B86C 4W4UA 5F2PA 4IC3A 4QEUA 2CKLB 4QSVA 5I7XA 5TBNA 2HYED 1VD4A 5FE6A 4LZRA 4QUTA 5DKHA 4YYMA 5LJ0A 4P5OB 5G0FA 2DVVA 1K2FA 4FJCA 1WENA 4R2YA 4NYVA 5A5RA 3KQIA 4MR6A 2LV9A 1HYJA 3DQVR 5DX4A 4NS5A 3JVKA 4HXOA 2KU3A 5E3DA 4ZUXU 3L11A 5DYUA 4QR4A 5F63A 4A9JA 2FUUA 4Z93A 4Q0OA 5EISA 4L58A 4PPEA 5EU1A 4YYNA 4X3GA 3O33A 5DYXA 4UIUA 2L75A 3ZYUA 5CY9A 2RFJA 5DYCA 2D8SA 5EWWA 3M99A 3IU5A 2K17A 2MD8C 3LXJA 5E74A 4NR8A 4O7EA 4UITA 3UVDA 3NG2A 4CUSA 4UYHA 2BAYA 2DATA 4HXSA 4IR5A 4TZ8A 1G25A 3UVWA 2WP1A 2UZGA 2RO1A 4E96A 3HMHA 4WZ3B 5HRVA 4WHWA 4QC1A 4CUQA 3P5OA 2LQ6A 4OGJA 5EYAF 3ZNIA 5H1UA 3O34A 5C87A 2M85A 5I89A 2G4AA 5II1A 4CFKA 2EA6A 3ASLA 4NN2A 3AQAA 5I40A 5F3AA 2L84A 5KH3A 3SOWA 3RPGC 4F52B 3ONIA 5CP5A 5AIUA 3N9NA 2NXBA 3L1XA 5C85A 5D0CA 3JVLA 5FB1A 4XY9A 5L98A 4UIVA 4PCEA 5ENHA 5A83A 5ACYA 2ECWA 4O76A 4I7DA 5CS8A 5BT5A 5HRXA 5ETBA 3NXBA 4A49A 4TU4A 5C7NA 4TQNA 2LSPB 4QSTA 3ZTGA 5D3RA 2KREA 5E73A 5ENIA 5A81A 4LYIA 5A5NA 5H1VA 1WEMA 2Y43A 3M62A 3PHDA 4TKPB 5TDWA 5IGNA 3O37A 5F25A 4HXNA 3O70A 5LUUA 5C8GA 4Q6FA 4V3KC 4QF3A 5H1TA 3U5JA 5FFWA 4PCIA 5FBXA 3EB6A 5DINA 4BW2A 2YSJA 2E3KA 3N9MA 1WESA 4A9MA 4KCXA 4A9IA 5BT3A 4AKNA 4L7XA 2KE1A 2R0VA 4ALGA 2EODA 2L80A 4I7BA 3SVFA 5A5OA 4QB3A 2LGLA 5D1KB 4Y03A 5E3GA 4IOOA 5EWVA 5DKAA 4O72A 2XB1A 4GNEA 5TABA 5FG6A 5TCMA 3N9QA 2KWKA 3U5OA 5I1QA 5CQ8A 5D26A 4CL9A 5FE9A 1WEEA 1Z2QA 3LRQA 1MM2A 3QZVA 4FK5A 4IR4A 5FE0A 4IR6A 5I80A 4NRBA 4GB0A 2DVSA 4YATA 3EB5A 4UI9B 2I50A 1LDKC 4GNDA 4NUDA 5CUAA 1U6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B76 A;  4QEW A;  5E9Y A;  5FH6 A;  5II2 A;  3HCS A;  3PUQ A;  5B75 A;  2CT2 A;  5DYA A;  2KGI A;  3HCU A;  2ECT A;  4TT6 A;  1N87 A;  3O35 A;  1F68 A;  2KWN A;  5B8D A;  3RTR B;  1HYI A;  1WEO A;  5KO4 A;  4O7C A;  1WUM A;  4A9K A;  2E6S A;  4WA6 A;  5FE4 A;  2H0D A;  3C5K A;  4IC2 A;  4WHU A;  4MR4 A;  5ENF A;  4LDF A;  2MT5 A;  4KV1 A;  4QR3 A;  5J3X A;  5CRM A;  5EP7 A;  5HQ6 A;  2YEL A;  4FLP A;  4YYI A;  5E9L A;  5CQ6 A;  1E4U A;  4GNF A;  4Z6I A;  2C2V S;  2YUR A;  3TLP A;  2OSS A;  2K4D A;  2K1J A;  4S3O B;  3GG3 A;  1T1H A;  1XWH A;  5I29 A;  1LDJ B;  5EPS A;  2Y1M A;  2M1R A;  2QIC A;  1X0J A;  3UV4 A;  4A4C A;  4WZ2 A;  4QSS A;  4YAB A;  4BW1 A;  4S3O C;  5D1M B;  5L99 A;  5HM0 A;  3UVX A;  5CUC A;  3SVG A;  3IHP A;  2L5U A;  5CRZ A;  5F1L A;  1WUG A;  5TB6 A;  3LQJ A;  4XI1 A;  5KTW A;  2R0S A;  3DAI A;  4IOR A;  5TDR A;  4NQN A;  4CFL A;  5ENJ A;  4ZQL A;  4LZ2 A;  3ZPV E;  2FUI A;  2YYR A;  2C2L A;  3I2D A;  5J0D A;  4MEP A;  4PS5 A;  2MJV B;  5FE3 A;  5IGL A;  4HBV A;  5HFR A;  4CUU A;  2I7K A;  1CHC A;  1WE9 A;  3S91 A;  5B78 A;  5FER A;  4YBS A;  4UP0 A;  4UYF A;  4NR7 A;  2ECJ A;  3ZVZ B;  1Z60 A;  3Q2E A;  2LXP C;  4A9H A;  5C4Q A;  5G4R A;  5LJ2 A;  2YU4 A;  4MVT A;  5EA1 A;  5DFD A;  4YAD A;  1WEP A;  4IOQ A;  3DPL R;  5CQ5 A;  3RPG B;  4YBM A;  2VJE A;  2OUO A;  4QYL A;  4QSX A;  4UYF B;  4YH4 A;  5G05 B;  4A0C D;  4N4H A;  4MEN A;  3P1D A;  5IGK A;  4HBW A;  1IYM A;  5D3J A;  2YW8 A;  2YQM A;  3JVM A;  2D82 A;  4UYG A;  5IID A;  2KWJ A;  4O7B A;  2VJE B;  4QUU A;  5LKZ A;  1ZBD B;  5FG4 A;  4BBQ A;  2YYN A;  4LKA A;  4O77 A;  2YRE A;  4TS8 A;  5LVQ A;  4PY6 A;  1WEW A;  3O36 A;  5ENC A;  3ZVY A;  5H85 A;  2KIZ A;  2LGG A;  4J0R A;  4UIW A;  1JM7 A;  2JRJ A;  5DLX A;  4O70 A;  4O7A A;  3IU6 A;  3S92 A;  3U5M A;  2L0B A;  2RSD A;  5C89 A;  2QJ0 A;  1ZS5 A;  1F62 A;  5E9I A;  4HXK A;  2ECN A;  3N9L A;  4YH3 A;  4WZ0 A;  5CQ4 A;  3N9P A;  5L8T A;  5KHM A;  5F62 A;  4UIY A;  3SOX A;  2CSZ A;  5B77 A;  4HXR A;  5EWC A;  5D3L A;  1JM7 B;  5AD3 A;  2LXH C;  2YDW A;  2G43 A;  5IBN A;  5D3P A;  5I7Y A;  5CUB A;  4Z1S A;  4HBY A;  4V3L C;  4YYD A;  2QIZ A;  1RMD A;  4ZW1 A;  5LKU A;  3SHB A;  4NUC A;  5EWD A;  4F3I A;  3Q2F A;  2YEM A;  4UP5 A;  2LGK A;  2MIQ A;  4QSP A;  4J0S A;  5CUD A;  4R7E A;  4HXL A;  2YQL A;  4XYA A;  4KV4 A;  2E7O A;  4CA1 A;  4IR3 A;  5DFB A;  4AUQ B;  5FB0 A;  4O74 A;  5HEN A;  4LLB A;  5HEL A;  5CFW A;  2YT5 A;  1JSP B;  3QZT A;  2MA5 A;  5F60 A;  4TYL A;  4O71 A;  3LJW A;  2KYU A;  5FG5 A;  5D3S A;  2EGP A;  3VK6 A;  3P1F A;  4C67 A;  2VPD A;  4QY4 A;  4UIX A;  4N3W A;  5DBM A;  4XUB A;  5A7C A;  5EQ1 A;  5ETD A;  5LVR A;  2RNX A;  1WEU A;  1JOC A;  5CPE A;  5D1L B;  3GV4 A;  2M6M A;  4B7Y C;  4QSQ A;  3U5K A;  4NR9 A;  4HXM A;  4QBM A;  5LKT A;  5LKX A;  3MB3 A;  4QF2 A;  5G04 B;  3T7L A;  5E9V A;  5JWM A;  4NYW A;  2G6Q A;  2KGG A;  4NR6 A;  2IDA A;  3PUR A;  4MEQ A;  5HCL A;  4YYJ A;  5HQ5 A;  2VJF A;  3RCW A;  2KFT A;  3MXF A;  2JMJ A;  4BJX A;  5E9M A;  4PKL A;  1WEV A;  4N4G A;  5KH7 A;  4LC2 A;  4I7C A;  5D25 A;  3G0L A;  5ENB A;  3I3J A;  5FEY A;  3LQI A;  4XY8 A;  2H0D B;  4X2I A;  5E9K A;  4YYH A;  3HMF A;  4PTB A;  4YK0 A;  5FE7 A;  4QEV A;  4BHW A;  2VJF B;  1DVP A;  4UYD A;  5EIC A;  4MEO A;  4TTE A;  5A82 A;  3FL2 A;  1WIL A;  4O75 A;  2RI7 A;  2F6N A;  4AYC A;  2LN0 A;  4HBX A;  5D3N A;  5I86 A;  4HXP A;  4OUF A;  2YSM A;  4LK9 A;  5CUG A;  3G0J A;  1VYX A;  5EPR A;  5D24 A;  4YYK A;  5L8U A;  3P1C A;  4QNS A;  5CUE A;  3HCT A;  2LRI C;  5IGM A;  3GL6 A;  2MA6 A;  4AYC B;  4YAX A;  3MQM A;  2KR4 A;  2VP7 A;  1FBV A;  3UV2 A;  5EVA A;  4FIP A;  1VFY A;  4A9F A;  2KWO A;  4NR4 A;  1EQF A;  5AIT A;  5FE5 A;  4CUT A;  2H60 A;  5FH8 A;  2N9G A;  2CKL A;  3ZPV 1;  4A4B A;  4J3I A;  4Q0N A;  1MM3 A;  3KNV A;  2DVQ A;  4C66 A;  5EPB A;  4YY6 A;  4YY4 A;  2KTB B;  5LJ1 A;  2OO1 A;  4RVR A;  2FSA A;  5A5Q A;  5KTX A;  5FE2 A;  4LRG A;  3UVY A;  2L85 A;  5HEM A;  4Z6H A;  4J1P A;  3U5L A;  5EGU A;  4NQM A;  4AP4 A;  5B79 A;  5A85 A;  5HQ7 A;  2G45 A;  2PUY A;  4BW4 A;  4LJN A;  2YW5 A;  1WFK A;  2WP2 A;  2R10 A;  4QYD A;  1X4I A;  5C13 A;  4QSU A;  2VNF A;  2ECG A;  4GNG A;  2CSY A;  2DWW A;  5A5P A;  5I88 A;  3JVJ A;  5A5S A;  5E7D A;  3SVH A;  1WIM A;  5DFC A;  5F1H A;  3O7A A;  5BT4 A;  5CZG A;  5CU8 A;  4NXJ A;  5K29 A;  5L96 A;  5H9M A;  5I3L A;  2K16 A;  2RNW A;  4MR3 A;  4YBT A;  2E7N A;  4LR6 A;  4R8P K;  5LCW B;  4LYS A;  4OGI A;  3DWY A;  4QSR A;  5HRW A;  5DKD A;  5F36 A;  5FE1 A;  5F5Z A;  5CQ3 A;  5CQT A;  5TRB A;  2ZET C;  5DKC A;  3QZS A;  3MUL A;  5HFQ A;  3T6R A;  2L5E A;  5CGP A;  5CQA A;  4Z1Q A;  3MHH A;  5D3H A;  5IG6 A;  2XEU A;  3KV6 A;  4O64 A;  4N4F A;  4O7F A;  2RS9 B;  2NAA A;  2YEK A;  2E6R A;  4QC3 A;  4C9Z A;  2R0Y A;  3FKM X;  3P1E A;  1FP0 A;  4UIZ A;  2ECI A;  3LQH A;  2I8N A;  4NUE A;  5FDZ A;  5JI8 A;  4QR5 A;  3V43 A;  5COI A;  4QZS A;  4QSW A;  3HME A;  5AME A;  3D7C A;  4A9O A;  2JMD A;  3AAD A;  3MHS A;  5L97 A;  4NRA A;  4CLB A;  5EK9 A;  2M3H A;  3K2J A;  1N72 A;  2MNZ A;  2VPB A;  2F42 A;  4BW3 A;  3UW9 A;  3U5P A;  4A9N A;  3C6W A;  4FO9 A;  4ZC9 A;  5HJC A;  2DX8 A;  5DY7 A;  5CQ7 A;  4XUA A;  5ENG A;  5HLS A;  2LDR A;  2RNY A;  5EWH A;  2MUM A;  4MSX A;  3U5N A;  2MNY A;  2OXQ C;  1X4J A;  5G4S A;  2Y1N A;  5I83 A;  1WGM A;  1Z6U A;  4TT4 A;  4NRC A;  5EI4 A;  5DW2 A;  5ENE A;  5AD2 A;  2AN6 A;  2VPG A;  2YHO A;  3M63 A;  3MB4 A;  5FFV A;  2D9E A;  3KV5 A;  1E6I A;  4AVX A;  5E0R A;  5FE8 A;  2LGV A;  2GRC A;  5F61 A;  3ZYQ A;  2F6J A;  4GPJ A;  4O78 A;  3UV5 A;  5KH9 A;  4YYG A;  2MD7 B;  4LYW A;  4DON A;  2HDP A;  2JMI A;  5JG6 A;  4A9L A;  5KU3 A;  5FH7 A;  3SOU A;  5KTU A;  2DKW A;  4NYX A;  4N4I A;  4NR5 A;  2VPE A;  1BOR A;  4A9E A;  3HTK C;  3L1Z B;  1JM4 B;  4YC9 A;  1V87 A;  4TZ2 A;  2YQD A;  1WEQ A;  5C11 A;  4ALH A;  5DW1 A;  5AMF A;  2PNX A;  2YHN A;  4LZS A;  4CCG X;  4TU6 A;  5EV9 A;  5D3T A;  5DLZ A;  4CUP A;  4MR5 A;  2ECV A;  2L43 A;  5CTL A;  4LAD B;  3N9O A;  4WIV A;  5EM3 A;  2DVR A;  2YUC A;  4UYE A;  1X4U A;  5FFY A;  4ZDT A;  3MUK A;  4CUR A;  4TT2 A;  5D7X A;  4B86 C;  4W4U A;  5F2P A;  4IC3 A;  4QEU A;  2CKL B;  4QSV A;  5I7X A;  5TBN A;  2HYE D;  1VD4 A;  5FE6 A;  4LZR A;  4QUT A;  5DKH A;  4YYM A;  5LJ0 A;  4P5O B;  5G0F A;  2DVV A;  1K2F A;  4FJC A;  1WEN A;  4R2Y A;  4NYV A;  5A5R A;  3KQI A;  4MR6 A;  2LV9 A;  1HYJ A;  3DQV R;  5DX4 A;  4NS5 A;  3JVK A;  4HXO A;  2KU3 A;  5E3D A;  4ZUX U;  3L11 A;  5DYU A;  4QR4 A;  5F63 A;  4A9J A;  2FUU A;  4Z93 A;  4Q0O A;  5EIS A;  4L58 A;  4PPE A;  5EU1 A;  4YYN A;  4X3G A;  3O33 A;  5DYX A;  4UIU A;  2L75 A;  3ZYU A;  5CY9 A;  2RFJ A;  5DYC A;  2D8S A;  5EWW A;  3M99 A;  3IU5 A;  2K17 A;  2MD8 C;  3LXJ A;  5E74 A;  4NR8 A;  4O7E A;  4UIT A;  3UVD A;  3NG2 A;  4CUS A;  4UYH A;  2BAY A;  2DAT A;  4HXS A;  4IR5 A;  4TZ8 A;  1G25 A;  3UVW A;  2WP1 A;  2UZG A;  2RO1 A;  4E96 A;  3HMH A;  4WZ3 B;  5HRV A;  4WHW A;  4QC1 A;  4CUQ A;  3P5O A;  2LQ6 A;  4OGJ A;  5EYA F;  3ZNI A;  5H1U A;  3O34 A;  5C87 A;  2M85 A;  5I89 A;  2G4A A;  5II1 A;  4CFK A;  2EA6 A;  3ASL A;  4NN2 A;  3AQA A;  5I40 A;  5F3A A;  2L84 A;  5KH3 A;  3SOW A;  3RPG C;  4F52 B;  3ONI A;  5CP5 A;  5AIU A;  3N9N A;  2NXB A;  3L1X A;  5C85 A;  5D0C A;  3JVL A;  5FB1 A;  4XY9 A;  5L98 A;  4UIV A;  4PCE A;  5ENH A;  5A83 A;  5ACY A;  2ECW A;  4O76 A;  4I7D A;  5CS8 A;  5BT5 A;  5HRX A;  5ETB A;  3NXB A;  4A49 A;  4TU4 A;  5C7N A;  4TQN A;  2LSP B;  4QST A;  3ZTG A;  5D3R A;  2KRE A;  5E73 A;  5ENI A;  5A81 A;  4LYI A;  5A5N A;  5H1V A;  1WEM A;  2Y43 A;  3M62 A;  3PHD A;  4TKP B;  5TDW A;  5IGN A;  3O37 A;  5F25 A;  4HXN A;  3O70 A;  5LUU A;  5C8G A;  4Q6F A;  4V3K C;  4QF3 A;  5H1T A;  3U5J A;  5FFW A;  4PCI A;  5FBX A;  3EB6 A;  5DIN A;  4BW2 A;  2YSJ A;  2E3K A;  3N9M A;  1WES A;  4A9M A;  4KCX A;  4A9I A;  5BT3 A;  4AKN A;  4L7X A;  2KE1 A;  2R0V A;  4ALG A;  2EOD A;  2L80 A;  4I7B A;  3SVF A;  5A5O A;  4QB3 A;  2LGL A;  5D1K B;  4Y03 A;  5E3G A;  4IOO A;  5EWV A;  5DKA A;  4O72 A;  2XB1 A;  4GNE A;  5TAB A;  5FG6 A;  5TCM A;  3N9Q A;  2KWK A;  3U5O A;  5I1Q A;  5CQ8 A;  5D26 A;  4CL9 A;  5FE9 A;  1WEE A;  1Z2Q A;  3LRQ A;  1MM2 A;  3QZV A;  4FK5 A;  4IR4 A;  5FE0 A;  4IR6 A;  5I80 A;  4NRB A;  4GB0 A;  2DVS A;  4YAT A;  3EB5 A;  4UI9 B;  2I50 A;  1LDK C;  4GND A;  4NUD A;  5CUA A;  1U6G B; 
#chains in the Genus database with same CATH topology
 5B76 A;  4QEW A;  5E9Y A;  5FH6 A;  5II2 A;  3HCS A;  3PUQ A;  2CSV A;  5B75 A;  2CT2 A;  5DYA A;  2KGI A;  3HCU A;  2ECT A;  4TT6 A;  1N87 A;  3O35 A;  1F68 A;  2KWN A;  5B8D A;  3RTR B;  1HYI A;  1WEO A;  5KO4 A;  4O7C A;  1WUM A;  4A9K A;  2E6S A;  4WA6 A;  5FE4 A;  2H0D A;  3C5K A;  4IC2 A;  4WHU A;  4MR4 A;  5ENF A;  4LDF A;  2MT5 A;  4KV1 A;  4QR3 A;  5J3X A;  5CRM A;  5EP7 A;  5HQ6 A;  2YEL A;  4FLP A;  4YYI A;  5SVI A;  5E9L A;  5CQ6 A;  1E4U A;  4GNF A;  1DCQ A;  4Z6I A;  2C2V S;  2YUR A;  3TLP A;  2OSS A;  2K4D A;  2K1J A;  4S3O B;  3GG3 A;  1T1H A;  1XWH A;  5I29 A;  1LDJ B;  5EPS A;  2Y1M A;  4AKI A;  2M1R A;  2QIC A;  5SVI B;  1X0J A;  2FD4 A;  3UV4 A;  4A4C A;  4WZ2 A;  4QSS A;  4YAB A;  4BW1 A;  4S3O C;  5D1M B;  5L99 A;  5HM0 A;  3UVX A;  5CUC A;  3SVG A;  3IHP A;  2L5U A;  5CRZ A;  5F1L A;  1WUG A;  5TB6 A;  3LQJ A;  4XI1 A;  5KTW A;  2R0S A;  3DAI A;  4IOR A;  2XP0 A;  5TDR A;  4NQN A;  4CFL A;  5ENJ A;  4ZQL A;  4LZ2 A;  3ZPV E;  2FUI A;  2YYR A;  2C2L A;  3I2D A;  5J0D A;  4MEP A;  4PS5 A;  2MJV B;  5FE3 A;  5IGL A;  4HBV A;  5HFR A;  4CUU A;  2I7K A;  1CHC A;  1WE9 A;  3FAO A;  3S91 A;  5B78 A;  5FER A;  4YBS A;  4UP0 A;  4UYF A;  4NR7 A;  2ECJ A;  2XOY A;  3DWD A;  1Z60 A;  3ZVZ B;  3Q2E A;  2LXP C;  4AKG A;  4A9H A;  5C4Q A;  5G4R A;  5LJ2 A;  2YU4 A;  2MKE A;  4MVT A;  5EA1 A;  5DFD A;  4YAD A;  1WEP A;  2D8U A;  4IOQ A;  3DPL R;  5CQ5 A;  3RPG B;  4YBM A;  2VJE A;  5SVY A;  2OUO A;  4QYL A;  4QSX A;  4UYF B;  4YH4 A;  2M13 A;  5G05 B;  4N4H A;  4MEN A;  3P1D A;  5IGK A;  4HBW A;  4A0C D;  1IYM A;  5D3J A;  3D1B A;  2YW8 A;  4AI6 A;  2YQM A;  3JVM A;  2D82 A;  4UYG A;  5IID A;  2KWJ A;  4O7B A;  3H7H A;  2VJE B;  4QUU A;  5LKZ A;  1ZBD B;  2L7P A;  5FG4 A;  5K3Q A;  4BBQ A;  2YYN A;  4LKA A;  4O77 A;  2YRE A;  4TS8 A;  5LVQ A;  4PY6 A;  1WEW A;  3O36 A;  5ENC A;  3ZVY A;  5H85 A;  2KIZ A;  2LGG A;  4J0R A;  4UIW A;  2KKY A;  1JM7 A;  2JRJ A;  5DLX A;  4O70 A;  4O7A A;  3IU6 A;  3S92 A;  3U5M A;  2L0B A;  2RSD A;  5C89 A;  2QJ0 A;  1ZS5 A;  1F62 A;  5E9I A;  4HXK A;  3VKH A;  2ECN A;  4YH3 A;  3N9L A;  4WZ0 A;  5CQ4 A;  3N9P A;  5L8T A;  5KHM A;  5F62 A;  4O62 A;  4UIY A;  3SOX A;  2CSZ A;  5B77 A;  4HXR A;  5EWC A;  5D3L A;  1JM7 B;  5AD3 A;  2LXH C;  2YDW A;  2G43 A;  5IBN A;  3LVR E;  5D3P A;  5I7Y A;  5CUB A;  4Z1S A;  4HBY A;  4V3L C;  4YYD A;  2QIZ A;  1RMD A;  4ZW1 A;  5LKU A;  3SHB A;  4NUC A;  5EWD A;  4F3I A;  3Q2F A;  2YEM A;  4UP5 A;  2LGK A;  2MIQ A;  4QSP A;  4J0S A;  5CUD A;  4R7E A;  4HXL A;  2YQL A;  4XYA A;  1ZKR A;  4KV4 A;  2E7O A;  4CA1 A;  4IR3 A;  5DFB A;  4AUQ B;  5FB0 A;  4O74 A;  5HEN A;  4LLB A;  5HEL A;  5CFW A;  2YT5 A;  1JSP B;  3QZT A;  2MA5 A;  5F60 A;  4TYL A;  4O71 A;  3LJW A;  2KYU A;  5FG5 A;  5D3S A;  4OGE A;  2EGP A;  3VK6 A;  3P1F A;  4C67 A;  2VPD A;  4QY4 A;  3PLW A;  4UIX A;  4N3W A;  5DBM A;  4XUB A;  5A7C A;  5EQ1 A;  5ETD A;  5LVR A;  2RNX A;  1WEU A;  3LJU X;  4Z0O A;  1JOC A;  5CPE A;  5D1L B;  3GV4 A;  2M6M A;  4B7Y C;  4QSQ A;  3U5K A;  4NR9 A;  4HXM A;  4QBM A;  5LKT A;  5LKX A;  3MB3 A;  4QF2 A;  5G04 B;  3T7L A;  5E9V A;  5JWM A;  4NYW A;  2G6Q A;  2KGG A;  4NR6 A;  2IDA A;  3PUR A;  4MEQ A;  5HCL A;  4YYJ A;  5HQ5 A;  2VJF A;  3RCW A;  2KFT A;  3MXF A;  2JMJ A;  4BJX A;  5E9M A;  4PKL A;  1WEV A;  4N4G A;  5KH7 A;  4LC2 A;  4I7C A;  5D25 A;  3G0L A;  5ENB A;  3I3J A;  5FEY A;  3LQI A;  4XY8 A;  2H0D B;  4X2I A;  5E9K A;  4YYH A;  3HMF A;  4PTB A;  4YK0 A;  5FE7 A;  4QEV A;  4BHW A;  2VJF B;  1DVP A;  4UYD A;  5EIC A;  4MEO A;  4TTE A;  5A82 A;  3FL2 A;  1WIL A;  4O75 A;  2RI7 A;  2F6N A;  4AYC A;  3M7K A;  2LN0 A;  4HBX A;  5D3N A;  5I86 A;  4HXP A;  4OUF A;  2YSM A;  3LVQ E;  4LK9 A;  5CUG A;  3G0J A;  1VYX A;  5EPR A;  5D24 A;  4YYK A;  5L8U A;  3P1C A;  4QNS A;  5CUE A;  5SVX A;  3HCT A;  2LRI C;  5IGM A;  3GL6 A;  2MA6 A;  4AYC B;  4YAX A;  3MQM A;  2KR4 A;  2VP7 A;  1FBV A;  3UV2 A;  5EVA A;  4FIP A;  1VFY A;  4A9F A;  2KWO A;  4NR4 A;  1EQF A;  5AIT A;  5FE5 A;  1MBM A;  4CUT A;  2H60 A;  5FH8 A;  2N9G A;  2B0O E;  2CKL A;  3ZPV 1;  4A4B A;  4J3I A;  3DDT A;  4Q0N A;  1MM3 A;  3KNV A;  2DVQ A;  4C66 A;  5EPB A;  4YY6 A;  4YY4 A;  2KTB B;  5LJ1 A;  2OO1 A;  4RVR A;  2FSA A;  5A5Q A;  5KTX A;  5FE2 A;  4LRG A;  3UVY A;  2L85 A;  5HEM A;  4Z6H A;  4J1P A;  3U5L A;  5EGU A;  4NQM A;  2DJA A;  4AP4 A;  3D1D A;  5B79 A;  5A85 A;  5HQ7 A;  2G45 A;  1PUO A;  2PUY A;  4BW4 A;  4LJN A;  2YW5 A;  1WFK A;  2WP2 A;  2R10 A;  4QYD A;  1X4I A;  5C13 A;  4QSU A;  2VNF A;  2ECG A;  4GNG A;  2CSY A;  2DWW A;  5A5P A;  5I88 A;  3JVJ A;  5A5S A;  5E7D A;  3SVH A;  1WIM A;  5DFC A;  5F1H A;  3O7A A;  4QQ4 A;  5BT4 A;  5CZG A;  5CU8 A;  4NXJ A;  5K29 A;  5L96 A;  2EJN A;  5H9M A;  5I3L A;  2K16 A;  2RNW A;  4MR3 A;  4YBT A;  2E7N A;  4LR6 A;  4R8P K;  5LCW B;  4LYS A;  4OGI A;  3DWY A;  4QSR A;  5HRW A;  5DKD A;  5F36 A;  2CRW A;  5FE1 A;  5F5Z A;  5CQ3 A;  5CQT A;  5TRB A;  2ZET C;  5DKC A;  3QZS A;  3MUL A;  5HFQ A;  3T6R A;  2L5E A;  5CGP A;  5CQA A;  4Z1Q A;  3MHH A;  5D3H A;  2IQJ A;  5IG6 A;  2XEU A;  2OWA A;  3FJU B;  3KV6 A;  4O64 A;  4N4F A;  4O7F A;  2RS9 B;  2NAA A;  2YEK A;  2E6R A;  4QC3 A;  4Z0R A;  4C9Z A;  2R0Y A;  3FKM X;  3P1E A;  1FP0 A;  4UIZ A;  2ECI A;  3LQH A;  2I8N A;  4NUE A;  5FDZ A;  5JI8 A;  4QR5 A;  3V43 A;  5COI A;  4QZS A;  4QSW A;  3HME A;  5AME A;  3D7C A;  2CRR A;  4A9O A;  4OGC A;  2JMD A;  3AAD A;  3MHS A;  5L97 A;  4NRA A;  4CLB A;  5EK9 A;  2M3H A;  3K2J A;  1N72 A;  2MNZ A;  2VPB A;  2F42 A;  4BW3 A;  3UW9 A;  3U5P A;  4A9N A;  3C6W A;  4FO9 A;  4ZC9 A;  3FM8 C;  5HJC A;  2DX8 A;  3KDE C;  5DY7 A;  5CQ7 A;  4XUA A;  5ENG A;  5HLS A;  2LDR A;  2RNY A;  5EWH A;  2MUM A;  4MSX A;  3U5N A;  2MNY A;  2OXQ C;  1X4J A;  5G4S A;  2Y1N A;  5I83 A;  1WGM A;  1Z6U A;  4TT4 A;  4NRC A;  5EI4 A;  5DW2 A;  5ENE A;  5AD2 A;  2JUN A;  2CON A;  2AN6 A;  2VPG A;  2YHO A;  3M63 A;  3MB4 A;  5FFV A;  2D9E A;  2E61 A;  3KV5 A;  1E6I A;  4AVX A;  5E0R A;  5FE8 A;  2LGV A;  2GRC A;  5F61 A;  3O47 A;  3ZYQ A;  2F6J A;  4GPJ A;  4O78 A;  3UV5 A;  4H9D A;  5KH9 A;  3LDY A;  4YYG A;  2MD7 B;  4LYW A;  4DON A;  2HDP A;  2JMI A;  5JG6 A;  4A9L A;  5KU3 A;  5FH7 A;  3SOU A;  5KTU A;  2DKW A;  4NYX A;  4N4I A;  4NR5 A;  2VPE A;  1BOR A;  4A9E A;  3HTK C;  3VKG A;  3L1Z B;  1JM4 B;  4YC9 A;  1V87 A;  4TZ2 A;  2YQD A;  1WEQ A;  5C11 A;  4ALH A;  5DW1 A;  5AMF A;  2PNX A;  2YHN A;  4LZS A;  4CCG X;  4TU6 A;  5EV9 A;  5D3T A;  5DLZ A;  4CUP A;  4MR5 A;  2ECV A;  2L43 A;  5CTL A;  4LAD B;  3N9O A;  4WIV A;  5EM3 A;  2DVR A;  2YUC A;  4UYE A;  1X4U A;  5FFY A;  4ZDT A;  3MUK A;  2DSM A;  4CUR A;  4TT2 A;  5D7X A;  4B86 C;  4W4U A;  5F2P A;  4IC3 A;  4QEU A;  2CKL B;  2EXU A;  4QSV A;  5I7X A;  5TBN A;  2HYE D;  1VD4 A;  5FE6 A;  4LZR A;  4QUT A;  5DKH A;  4YYM A;  5LJ0 A;  4P5O B;  5G0F A;  2DVV A;  1K2F A;  4FJC A;  1WEN A;  4R2Y A;  4NYV A;  5A5R A;  2KKX A;  3KQI A;  4F1P A;  4MR6 A;  2LV9 A;  2JM3 A;  1HYJ A;  3DQV R;  5DX4 A;  4NS5 A;  3JVK A;  4HXO A;  2KU3 A;  5E3D A;  4ZUX U;  3L11 A;  5DYU A;  4QR4 A;  5F63 A;  4A9J A;  2FUU A;  4Z93 A;  4Q0O A;  5EIS A;  4L58 A;  4PPE A;  5EU1 A;  4YYN A;  4X3G A;  3O33 A;  5DYX A;  4UIU A;  2L75 A;  3ZYU A;  5CY9 A;  2RFJ A;  5DYC A;  4AKH A;  2D8S A;  5EWW A;  3M99 A;  3IU5 A;  2K17 A;  2MD8 C;  3LXJ A;  5E74 A;  4NR8 A;  4O7E A;  4UIT A;  3UVD A;  3NG2 A;  4CUS A;  4UYH A;  2BAY A;  2DAT A;  4HXS A;  4IR5 A;  4TZ8 A;  1G25 A;  3UVW A;  2WP1 A;  2UZG A;  3Q1D A;  2RO1 A;  4E96 A;  3HMH A;  4WZ3 B;  5HRV A;  4WHW A;  4QC1 A;  4CUQ A;  3P5O A;  2LQ6 A;  4OGJ A;  5EYA F;  3T9K A;  3ZNI A;  5H1U A;  3O34 A;  5C87 A;  2M85 A;  5I89 A;  2G4A A;  5II1 A;  4CFK A;  2EA6 A;  3ASL A;  4NN2 A;  3AQA A;  5I40 A;  5F3A A;  2L84 A;  5KH3 A;  3SOW A;  3RPG C;  4F52 B;  3ONI A;  5CP5 A;  5AIU A;  3N9N A;  2LAU A;  2NXB A;  3L1X A;  5C85 A;  3ERR A;  5D0C A;  3JVL A;  5FB1 A;  4XY9 A;  5L98 A;  4UIV A;  4PCE A;  5ENH A;  5A83 A;  5ACY A;  2ECW A;  4O76 A;  4I7D A;  5CS8 A;  5BT5 A;  5HRX A;  3E2D A;  5ETB A;  3NXB A;  4A49 A;  4TU4 A;  5C7N A;  4TQN A;  2LSP B;  4QST A;  3ZTG A;  5D3R A;  2KRE A;  5E73 A;  5ENI A;  5A81 A;  4LYI A;  3FAN A;  5A5N A;  5H1V A;  1WEM A;  2Y43 A;  3M62 A;  3PHD A;  4TKP B;  5TDW A;  5IGN A;  3O37 A;  5F25 A;  4HXN A;  3O70 A;  5LUU A;  5C8G A;  4Q6F A;  4V3K C;  4QF3 A;  5H1T A;  3U5J A;  5FFW A;  4PCI A;  5FBX A;  3EB6 A;  2XOC A;  5DIN A;  4BW2 A;  2EGM A;  2YSJ A;  2E3K A;  3N9M A;  1WES A;  4A9M A;  4KCX A;  4A9I A;  5BT3 A;  4AKN A;  4L7X A;  2KE1 A;  2R0V A;  4ALG A;  2EOD A;  2L80 A;  4I7B A;  3SVF A;  5A5O A;  4QB3 A;  2LGL A;  2XOZ A;  4Y03 A;  5E3G A;  4IOO A;  5EWV A;  5D1K B;  4O72 A;  2XB1 A;  4GNE A;  5DKA A;  5TAB A;  3MDB C;  5FG6 A;  2FFW A;  5TCM A;  3N9Q A;  2KWK A;  3U5O A;  5I1Q A;  5CQ8 A;  5D26 A;  4CL9 A;  2RR4 A;  5FE9 A;  1WEE A;  1Z2Q A;  3LRQ A;  1MM2 A;  3QZV A;  4FK5 A;  4IR4 A;  5FE0 A;  4IR6 A;  5I80 A;  3JUE A;  4NRB A;  2YVR A;  2P57 A;  4GB0 A;  3SUB A;  2DVS A;  4YAT A;  3EB5 A;  4UI9 B;  2I50 A;  1LDK C;  3FEH A;  4GND A;  4NUD A;  5CUA A;  1U6G B; 
#chains in the Genus database with same CATH homology
 5B76 A;  4QEW A;  5E9Y A;  5FH6 A;  5II2 A;  3HCS A;  3PUQ A;  5B75 A;  2CT2 A;  5DYA A;  2KGI A;  3HCU A;  2ECT A;  4TT6 A;  1N87 A;  3O35 A;  1F68 A;  2KWN A;  5B8D A;  3RTR B;  1HYI A;  1WEO A;  5KO4 A;  4O7C A;  1WUM A;  4A9K A;  2E6S A;  4WA6 A;  5FE4 A;  2H0D A;  3C5K A;  4IC2 A;  4WHU A;  4MR4 A;  5ENF A;  4LDF A;  2MT5 A;  4KV1 A;  4QR3 A;  5J3X A;  5CRM A;  5EP7 A;  5HQ6 A;  2YEL A;  4FLP A;  4YYI A;  5E9L A;  5CQ6 A;  1E4U A;  4GNF A;  4Z6I A;  2C2V S;  2YUR A;  3TLP A;  2OSS A;  2K4D A;  2K1J A;  4S3O B;  3GG3 A;  1T1H A;  1XWH A;  5I29 A;  1LDJ B;  5EPS A;  2Y1M A;  2M1R A;  2QIC A;  1X0J A;  3UV4 A;  4A4C A;  4WZ2 A;  4QSS A;  4YAB A;  4BW1 A;  4S3O C;  5D1M B;  5L99 A;  5HM0 A;  3UVX A;  5CUC A;  3SVG A;  3IHP A;  2L5U A;  5CRZ A;  5F1L A;  1WUG A;  5TB6 A;  3LQJ A;  4XI1 A;  5KTW A;  2R0S A;  3DAI A;  4IOR A;  5TDR A;  4NQN A;  4CFL A;  5ENJ A;  4ZQL A;  4LZ2 A;  3ZPV E;  2FUI A;  2YYR A;  2C2L A;  3I2D A;  5J0D A;  4MEP A;  4PS5 A;  2MJV B;  5FE3 A;  5IGL A;  4HBV A;  5HFR A;  4CUU A;  2I7K A;  1CHC A;  1WE9 A;  3S91 A;  5B78 A;  5FER A;  4YBS A;  4UP0 A;  4UYF A;  4NR7 A;  2ECJ A;  3ZVZ B;  1Z60 A;  3Q2E A;  2LXP C;  4A9H A;  5C4Q A;  5G4R A;  5LJ2 A;  2YU4 A;  4MVT A;  5EA1 A;  5DFD A;  4YAD A;  1WEP A;  4IOQ A;  3DPL R;  5CQ5 A;  3RPG B;  4YBM A;  2VJE A;  2OUO A;  4QYL A;  4QSX A;  4UYF B;  4YH4 A;  5G05 B;  4A0C D;  4N4H A;  4MEN A;  3P1D A;  5IGK A;  4HBW A;  1IYM A;  5D3J A;  2YW8 A;  2YQM A;  3JVM A;  2D82 A;  4UYG A;  5IID A;  2KWJ A;  4O7B A;  2VJE B;  4QUU A;  5LKZ A;  1ZBD B;  5FG4 A;  4BBQ A;  2YYN A;  4LKA A;  4O77 A;  2YRE A;  4TS8 A;  5LVQ A;  4PY6 A;  1WEW A;  3O36 A;  5ENC A;  3ZVY A;  5H85 A;  2KIZ A;  2LGG A;  4J0R A;  4UIW A;  1JM7 A;  2JRJ A;  5DLX A;  4O70 A;  4O7A A;  3IU6 A;  3S92 A;  3U5M A;  2L0B A;  2RSD A;  5C89 A;  2QJ0 A;  1ZS5 A;  1F62 A;  5E9I A;  4HXK A;  2ECN A;  3N9L A;  4YH3 A;  4WZ0 A;  5CQ4 A;  3N9P A;  5L8T A;  5KHM A;  5F62 A;  4UIY A;  3SOX A;  2CSZ A;  5B77 A;  4HXR A;  5EWC A;  5D3L A;  1JM7 B;  5AD3 A;  2LXH C;  2YDW A;  2G43 A;  5IBN A;  5D3P A;  5I7Y A;  5CUB A;  4Z1S A;  4HBY A;  4V3L C;  4YYD A;  2QIZ A;  1RMD A;  4ZW1 A;  5LKU A;  3SHB A;  4NUC A;  5EWD A;  4F3I A;  3Q2F A;  2YEM A;  4UP5 A;  2LGK A;  2MIQ A;  4QSP A;  4J0S A;  5CUD A;  4R7E A;  4HXL A;  2YQL A;  4XYA A;  4KV4 A;  2E7O A;  4CA1 A;  4IR3 A;  5DFB A;  4AUQ B;  5FB0 A;  4O74 A;  5HEN A;  4LLB A;  5HEL A;  5CFW A;  2YT5 A;  1JSP B;  3QZT A;  2MA5 A;  5F60 A;  4TYL A;  4O71 A;  3LJW A;  2KYU A;  5FG5 A;  5D3S A;  2EGP A;  3VK6 A;  3P1F A;  4C67 A;  2VPD A;  4QY4 A;  4UIX A;  4N3W A;  5DBM A;  4XUB A;  5A7C A;  5EQ1 A;  5ETD A;  5LVR A;  2RNX A;  1WEU A;  1JOC A;  5CPE A;  5D1L B;  3GV4 A;  2M6M A;  4B7Y C;  4QSQ A;  3U5K A;  4NR9 A;  4HXM A;  4QBM A;  5LKT A;  5LKX A;  3MB3 A;  4QF2 A;  5G04 B;  3T7L A;  5E9V A;  5JWM A;  4NYW A;  2G6Q A;  2KGG A;  4NR6 A;  2IDA A;  3PUR A;  4MEQ A;  5HCL A;  4YYJ A;  5HQ5 A;  2VJF A;  3RCW A;  2KFT A;  3MXF A;  2JMJ A;  4BJX A;  5E9M A;  4PKL A;  1WEV A;  4N4G A;  5KH7 A;  4LC2 A;  4I7C A;  5D25 A;  3G0L A;  5ENB A;  3I3J A;  5FEY A;  3LQI A;  4XY8 A;  2H0D B;  4X2I A;  5E9K A;  4YYH A;  3HMF A;  4PTB A;  4YK0 A;  5FE7 A;  4QEV A;  4BHW A;  2VJF B;  1DVP A;  4UYD A;  5EIC A;  4MEO A;  4TTE A;  5A82 A;  3FL2 A;  1WIL A;  4O75 A;  2RI7 A;  2F6N A;  4AYC A;  2LN0 A;  4HBX A;  5D3N A;  5I86 A;  4HXP A;  4OUF A;  2YSM A;  4LK9 A;  5CUG A;  3G0J A;  1VYX A;  5EPR A;  5D24 A;  4YYK A;  5L8U A;  3P1C A;  4QNS A;  5CUE A;  3HCT A;  2LRI C;  5IGM A;  3GL6 A;  2MA6 A;  4AYC B;  4YAX A;  3MQM A;  2KR4 A;  2VP7 A;  1FBV A;  3UV2 A;  5EVA A;  4FIP A;  1VFY A;  4A9F A;  2KWO A;  4NR4 A;  1EQF A;  5AIT A;  5FE5 A;  4CUT A;  2H60 A;  5FH8 A;  2N9G A;  2CKL A;  3ZPV 1;  4A4B A;  4J3I A;  4Q0N A;  1MM3 A;  3KNV A;  2DVQ A;  4C66 A;  5EPB A;  4YY6 A;  4YY4 A;  2KTB B;  5LJ1 A;  2OO1 A;  4RVR A;  2FSA A;  5A5Q A;  5KTX A;  5FE2 A;  4LRG A;  3UVY A;  2L85 A;  5HEM A;  4Z6H A;  4J1P A;  3U5L A;  5EGU A;  4NQM A;  4AP4 A;  5B79 A;  5A85 A;  5HQ7 A;  2G45 A;  2PUY A;  4BW4 A;  4LJN A;  2YW5 A;  1WFK A;  2WP2 A;  2R10 A;  4QYD A;  1X4I A;  5C13 A;  4QSU A;  2VNF A;  2ECG A;  4GNG A;  2CSY A;  2DWW A;  5A5P A;  5I88 A;  3JVJ A;  5A5S A;  5E7D A;  3SVH A;  1WIM A;  5DFC A;  5F1H A;  3O7A A;  5BT4 A;  5CZG A;  5CU8 A;  4NXJ A;  5K29 A;  5L96 A;  5H9M A;  5I3L A;  2K16 A;  2RNW A;  4MR3 A;  4YBT A;  2E7N A;  4LR6 A;  4R8P K;  5LCW B;  4LYS A;  4OGI A;  3DWY A;  4QSR A;  5HRW A;  5DKD A;  5F36 A;  5FE1 A;  5F5Z A;  5CQ3 A;  5CQT A;  5TRB A;  2ZET C;  5DKC A;  3QZS A;  3MUL A;  5HFQ A;  3T6R A;  2L5E A;  5CGP A;  5CQA A;  4Z1Q A;  3MHH A;  5D3H A;  5IG6 A;  2XEU A;  3KV6 A;  4O64 A;  4N4F A;  4O7F A;  2RS9 B;  2NAA A;  2YEK A;  2E6R A;  4QC3 A;  4C9Z A;  2R0Y A;  3FKM X;  3P1E A;  1FP0 A;  4UIZ A;  2ECI A;  3LQH A;  2I8N A;  4NUE A;  5FDZ A;  5JI8 A;  4QR5 A;  3V43 A;  5COI A;  4QZS A;  4QSW A;  3HME A;  5AME A;  3D7C A;  4A9O A;  2JMD A;  3AAD A;  3MHS A;  5L97 A;  4NRA A;  4CLB A;  5EK9 A;  2M3H A;  3K2J A;  1N72 A;  2MNZ A;  2VPB A;  2F42 A;  4BW3 A;  3UW9 A;  3U5P A;  4A9N A;  3C6W A;  4FO9 A;  4ZC9 A;  5HJC A;  2DX8 A;  5DY7 A;  5CQ7 A;  4XUA A;  5ENG A;  5HLS A;  2LDR A;  2RNY A;  5EWH A;  2MUM A;  4MSX A;  3U5N A;  2MNY A;  2OXQ C;  1X4J A;  5G4S A;  2Y1N A;  5I83 A;  1WGM A;  1Z6U A;  4TT4 A;  4NRC A;  5EI4 A;  5DW2 A;  5ENE A;  5AD2 A;  2AN6 A;  2VPG A;  2YHO A;  3M63 A;  3MB4 A;  5FFV A;  2D9E A;  3KV5 A;  1E6I A;  4AVX A;  5E0R A;  5FE8 A;  2LGV A;  2GRC A;  5F61 A;  3ZYQ A;  2F6J A;  4GPJ A;  4O78 A;  3UV5 A;  5KH9 A;  4YYG A;  2MD7 B;  4LYW A;  4DON A;  2HDP A;  2JMI A;  5JG6 A;  4A9L A;  5KU3 A;  5FH7 A;  3SOU A;  5KTU A;  2DKW A;  4NYX A;  4N4I A;  4NR5 A;  2VPE A;  1BOR A;  4A9E A;  3HTK C;  3L1Z B;  1JM4 B;  4YC9 A;  1V87 A;  4TZ2 A;  2YQD A;  1WEQ A;  5C11 A;  4ALH A;  5DW1 A;  5AMF A;  2PNX A;  2YHN A;  4LZS A;  4CCG X;  4TU6 A;  5EV9 A;  5D3T A;  5DLZ A;  4CUP A;  4MR5 A;  2ECV A;  2L43 A;  5CTL A;  4LAD B;  3N9O A;  4WIV A;  5EM3 A;  2DVR A;  2YUC A;  4UYE A;  1X4U A;  5FFY A;  4ZDT A;  3MUK A;  4CUR A;  4TT2 A;  5D7X A;  4B86 C;  4W4U A;  5F2P A;  4IC3 A;  4QEU A;  2CKL B;  4QSV A;  5I7X A;  5TBN A;  2HYE D;  1VD4 A;  5FE6 A;  4LZR A;  4QUT A;  5DKH A;  4YYM A;  5LJ0 A;  4P5O B;  5G0F A;  2DVV A;  1K2F A;  4FJC A;  1WEN A;  4R2Y A;  4NYV A;  5A5R A;  3KQI A;  4MR6 A;  2LV9 A;  1HYJ A;  3DQV R;  5DX4 A;  4NS5 A;  3JVK A;  4HXO A;  2KU3 A;  5E3D A;  4ZUX U;  3L11 A;  5DYU A;  4QR4 A;  5F63 A;  4A9J A;  2FUU A;  4Z93 A;  4Q0O A;  5EIS A;  4L58 A;  4PPE A;  5EU1 A;  4YYN A;  4X3G A;  3O33 A;  5DYX A;  4UIU A;  2L75 A;  3ZYU A;  5CY9 A;  2RFJ A;  5DYC A;  2D8S A;  5EWW A;  3M99 A;  3IU5 A;  2K17 A;  2MD8 C;  3LXJ A;  5E74 A;  4NR8 A;  4O7E A;  4UIT A;  3UVD A;  3NG2 A;  4CUS A;  4UYH A;  2BAY A;  2DAT A;  4HXS A;  4IR5 A;  4TZ8 A;  1G25 A;  3UVW A;  2WP1 A;  2UZG A;  2RO1 A;  4E96 A;  3HMH A;  4WZ3 B;  5HRV A;  4WHW A;  4QC1 A;  4CUQ A;  3P5O A;  2LQ6 A;  4OGJ A;  5EYA F;  3ZNI A;  5H1U A;  3O34 A;  5C87 A;  2M85 A;  5I89 A;  2G4A A;  5II1 A;  4CFK A;  2EA6 A;  3ASL A;  4NN2 A;  3AQA A;  5I40 A;  5F3A A;  2L84 A;  5KH3 A;  3SOW A;  3RPG C;  4F52 B;  3ONI A;  5CP5 A;  5AIU A;  3N9N A;  2NXB A;  3L1X A;  5C85 A;  5D0C A;  3JVL A;  5FB1 A;  4XY9 A;  5L98 A;  4UIV A;  4PCE A;  5ENH A;  5A83 A;  5ACY A;  2ECW A;  4O76 A;  4I7D A;  5CS8 A;  5BT5 A;  5HRX A;  5ETB A;  3NXB A;  4A49 A;  4TU4 A;  5C7N A;  4TQN A;  2LSP B;  4QST A;  3ZTG A;  5D3R A;  2KRE A;  5E73 A;  5ENI A;  5A81 A;  4LYI A;  5A5N A;  5H1V A;  1WEM A;  2Y43 A;  3M62 A;  3PHD A;  4TKP B;  5TDW A;  5IGN A;  3O37 A;  5F25 A;  4HXN A;  3O70 A;  5LUU A;  5C8G A;  4Q6F A;  4V3K C;  4QF3 A;  5H1T A;  3U5J A;  5FFW A;  4PCI A;  5FBX A;  3EB6 A;  5DIN A;  4BW2 A;  2YSJ A;  2E3K A;  3N9M A;  1WES A;  4A9M A;  4KCX A;  4A9I A;  5BT3 A;  4AKN A;  4L7X A;  2KE1 A;  2R0V A;  4ALG A;  2EOD A;  2L80 A;  4I7B A;  3SVF A;  5A5O A;  4QB3 A;  2LGL A;  5D1K B;  4Y03 A;  5E3G A;  4IOO A;  5EWV A;  5DKA A;  4O72 A;  2XB1 A;  4GNE A;  5TAB A;  5FG6 A;  5TCM A;  3N9Q A;  2KWK A;  3U5O A;  5I1Q A;  5CQ8 A;  5D26 A;  4CL9 A;  5FE9 A;  1WEE A;  1Z2Q A;  3LRQ A;  1MM2 A;  3QZV A;  4FK5 A;  4IR4 A;  5FE0 A;  4IR6 A;  5I80 A;  4NRB A;  4GB0 A;  2DVS A;  4YAT A;  3EB5 A;  4UI9 B;  2I50 A;  1LDK C;  4GND A;  4NUD A;  5CUA A;  1U6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...