4YATA

Crystal structure of trim24 phd-bromodomain complexed with n-(1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl)-4-methoxybenzene-1-sulfonamide (5b)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
173
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 173
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yatA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yatA01
5A7CA 4UIXA 2Y1MA 3ONIA 3IU6A 2RS9B 3LQJA 5A82A 5B78A 4J3IA 2CKLA 4YABA 5KH9A 4HXMA 4GNFA 2HDPA 3UV4A 3RPGB 5F25A 4YYGA 3HMEA 5E9MA 5IGKA 2L0BA 3N9OA 5L8UA 4XUAA 4FK5A 3FL2A 4CL9A 4YK0A 5D1LB 3HCSA 2JMIA 4J1PA 5LKTA 4NUCA 5EISA 4YYNA 2OXQC 2YT5A 5G4RA 3N9PA 2RSDA 3P1FA 5IGNA 2YEMA 2MD7B 1JM7B 5EPSA 5EWVA 4LJNA 4GPJA 3MHHA 3KNVA 5ETBA 3ZYUA 1V87A 5EPBA 4AUQB 4AYCA 3AQAA 2YEKA 4QUTA 3GV4A 4A4BA 4HXRA 1ZBDB 4TT2A 3P1DA 5FE3A 5F62A 2YQMA 3U5OA 4A9EA 2F6NA 4HXLA 5LKXA 5FE5A 1VYXA 2YYNA 4Z6IA 5DBMA 4LZSA 5BT4A 1BORA 3DQVR 4WZ0A 4NQNA 5HQ5A 5EVAA 4HXKA 4UIYA 2JRJA 2MIQA 4LADB 5FG4A 5F63A 5D7XA 4CCGX 4MVTA 5TBNA 4NR8A 3M62A 3P1CA 3ZYQA 1WUGA 4O78A 5CZGA 4XUBA 5KTWA 2XEUA 2DATA 5FE4A 4AP4A 5B77A 5FG6A 1X4JA 5FB1A 5KO4A 2FUIA 3EB5A 4TU6A 4X2IA 1JSPB 4Z6HA 4NRBA 2R0SA 4OUFA 5L8TA 5FH6A 3LJWA 4QEUA 5I40A 2KWKA 2L75A 2YREA 1XWHA 4LLBA 5EU1A 2MUMA 5FE7A 2EODA 5G04B 2DKWA 3QZTA 4TZ2A 2YQLA 5E9VA 4R8PK 5HEMA 2YYRA 5ENHA 4HBVA 5DYAA 3MULA 4QSSA 1WUMA 4YBTA 5HJCA 5COIA 3L1XA 5FFWA 2QIZA 2LQ6A 2C2VS 2LXPC 2WP1A 2OSSA 4NUDA 5CQ8A 5I89A 2ECIA 4CA1A 1MM2A 5FE9A 1WILA 2XB1A 4HBWA 4Y03A 5EM3A 5D25A 5I7XA 1E6IA 2VPEA 5E7DA 5I1QA 3N9LA 3TLPA 5FDZA 5JWMA 1MM3A 1VFYA 2JMJA 5F5ZA 2VP7A 2EGPA 4YH3A 2K4DA 3U5KA 5DKDA 3T6RA 3G0JA 2MA6A 4UIVA 2HYED 4Z1SA 5HFQA 5E9IA 2L5EA 2YQDA 2EA6A 4NN2A 4YBMA 5D3NA 3AADA 4A9FA 5L99A 3HCUA 5CUDA 1HYIA 5DKHA 3KV6A 2CT2A 5KH7A 3L11A 5J0DA 5H1VA 3C6WA 3T7LA 2M85A 3VK6A 1DVPA 1LDKC 5FE6A 5ETDA 4QR3A 5IBNA 4MR6A 5KU3A 5E74A 5EICA 3G0LA 4WHUA 3HTKC 4O64A 2CSZA 5AITA 5F1HA 4O70A 5FH8A 3IHPA 4J0SA 1WEQA 4LYIA 5E9KA 3O37A 3UVXA 1FBVA 5FE0A 1X4IA 4GNEA 3V43A 1Z60A 3ZTGA 3N9MA 4YATA 5LVRA 4UI9B 4I7DA 4UYDA 5DYXA 4O7BA 5A5OA 2ZETC 5H85A 5E0RA 4YYIA 3U5MA 2E6RA 4UYFA 4QSVA 4NUEA 1WIMA 2RNYA 2LDRA 3KQIA 4X3GA 4L58A 2YSJA 2KWJA 4QSQA 4N4IA 3O34A 2LN0A 2KE1A 2DVRA 2NAAA 3PURA 2ECGA 2LGVA 4QSTA 5D3SA 5JI8A 2K17A 5CUEA 2QJ0A 3MB4A 5CRZA 4QEWA 2VPGA 2YELA 4LZRA 2VJEB 5D3HA 5HLSA 5I80A 4UYHA 2H0DA 3U5JA 4QR4A 1WESA 2R0YA 4NYXA 5K29A 2VJFB 5DFDA 4A9HA 1WEPA 3C5KA 3ZPV1 4O71A 2DVVA 5BT5A 4XY9A 5FE8A 5E3DA 4UYEA 4Q0NA 3JVKA 4YYJA 4PCIA 5AD2A 4N4FA 3U5LA 5A5RA 4YY6A 4BW4A 4IOOA 2CKLB 4WZ2A 5C89A 5CS8A 3JVMA 5AMEA 3ZPVE 5HM0A 2F42A 3UVYA 5C7NA 4HXSA 2RO1A 4QC3A 5LVQA 3O7AA 5EPRA 2D9EA 4B7YC 5EK9A 4ZC9A 2FUUA 4NR9A 4QY4A 4MEPA 1Z6UA 3HMFA 5CGPA 2E3KA 5EP7A 3KV5A 2LGLA 2RNWA 3L1ZB 4R7EA 4QSWA 4E96A 2YUCA 3MUKA 1G25A 5DKCA 4NRAA 4QB3A 4AYCB 4C9ZA 3RTRB 4FIPA 4IC2A 5DFBA 5IIDA 4YBSA 1WENA 3LQIA 3MQMA 4NR6A 4YADA 5EWHA 5DFCA 1RMDA 5ENFA 3JVLA 4GB0A 3ZVYA 5E9YA 4FO9A 4MEQA 5EQ1A 5KTXA 4GNGA 4HXOA 5TDRA 5F3AA 2M6MA 1N72A 3U5PA 5E3GA 4MR5A 2VNFA 4ZDTA 4HBXA 2JMDA 4MR4A 3PUQA 4O72A 5TB6A 2I50A 2FSAA 3DAIA 4TYLA 4TTEA 4IR4A 4CURA 5FE2A 4LZ2A 1F68A 1WEWA 1HYJA 4BW2A 2MNYA 5DX4A 3HMHA 4F52B 5ENCA 3P5OA 5E9LA 2QICA 2KYUA 2G4AA 4I7BA 4O75A 5A85A 3O35A 1E4UA 5C85A 2VPBA 3Q2FA 3D7CA 3GG3A 3SHBA 4PS5A 4QSXA 4WA6A 5EI4A 4P5OB 4NRCA 3SOWA 3ASLA 5ENGA 5CFWA 1WEVA 5TABA 5CQTA 2RI7A 4C66A 4YYHA 2LRIC 5C13A 5KTUA 5ENJA 5FERA 2KIZA 5BT3A 3LXJA 4RVRA 4A9KA 3RCWA 5AIUA 5FE1A 4TT4A 4YYKA 2WP2A 5HFRA 5FG5A 4A9NA 4PKLA 3SVFA 4NS5A 4BW3A 2I8NA 4NYWA 1JOCA 2M1RA 5G05B 5D3LA 5FBXA 4QF3A 4KV1A 3FKMX 4YAXA 2M3HA 2E6SA 5F2PA 4CFLA 5I29A 4AKNA 5IGLA 3N9QA 4A0CD 4Q0OA 3O70A 4QNSA 5LJ2A 5LJ0A 4YY4A 5KH3A 3S91A 5D24A 4QBMA 5DW2A 4MSXA 4QEVA 4L7XA 2L85A 2LSPB 4KV4A 5CP5A 5DLZA 2E7OA 4HXNA 3O33A 5CQAA 5I88A 4CLBA 2YW5A 2ECVA 2PNXA 2ECNA 4TQNA 2ECWA 5LUUA 2H60A 4V3LC 2YHOA 2OO1A 3M99A 4IR3A 3I2DA 2D82A 3MHSA 4BHWA 2R10A 5DYUA 4O7EA 3JVJA 5D26A 3UVDA 1WFKA 4LK9A 2G45A 4CUSA 4NXJA 3LRQA 5TRBA 4MEOA 3U5NA 1IYMA 2VPDA 4IC3A 4UYGA 1WEOA 3K2JA 4WZ3B 5DKAA 4MR3A 4AVXA 2DWWA 2N9GA 3UW9A 4UP5A 5LJ1A 4N3WA 5C4QA 3SVHA 1K2FA 2G6QA 2YU4A 5DY7A 4YH4A 4GNDA 5TDWA 2MNZA 5CQ7A 4XY8A 5CY9A 3QZVA 1VD4A 5HCLA 1X4UA 1Z2QA 5H1UA 1F62A 2Y43A 5J3XA 4ZUXU 1JM4B 4DONA 2ECTA 5CQ4A 2RFJA 5CQ6A 2UZGA 5FEYA 4C67A 1T1HA 4QYDA 5DLXA 2KGIA 4UYFB 2YURA 4S3OB 1WEEA 2YHNA 4LRGA 5L97A 4QSUA 5H9MA 1WGMA 4A9IA 4YYDA 5F36A 5HRXA 1JM7A 4N4GA 2LXHC 5EWWA 5B79A 2H0DB 4B86C 5G4SA 4A9LA 2LGKA 4TKPB 2RNXA 4J0RA 4Q6FA 2MA5A 3IU5A 4BBQA 5ENIA 5D3JA 5I7YA 4XYAA 4QF2A 3UV2A 5E73A 4PY6A 2L5UA 2CSYA 4O77A 5B75A 4W4UA 4O7AA 5AD3A 3NXBA 3SOUA 4O7FA 3I3JA 5FH7A 4QSRA 3UVWA 5L98A 4LKAA 4QZSA 5HQ7A 5LKZA 4LDFA 2YDWA 5FFYA 5HELA 5D0CA 5HRVA 5HQ6A 3HCTA 3LQHA 3MB3A 4OGIA 5JG6A 4NR7A 4QUUA 2G43A 4NR5A 4CFKA 2PUYA 5CU8A 4LC2A 2K16A 2ECJA 4UIZA 4V3KC 2KREA 2DX8A 2BAYA 4TS8A 3P1EA 4IR5A 5EA1A 5IG6A 4WHWA 4N4HA 5CUGA 4TT6A 5A5QA 5LKUA 4FLPA 2C2LA 4UIUA 5CTLA 5ENEA 4NQMA 4ALGA 2K1JA 4QSPA 4CUTA 4YC9A 3PHDA 4A9JA 2YSMA 5EV9A 3O36A 4UIWA 5CQ5A 4PPEA 5DYCA 1WEMA 4OGJA 4Z1QA 3N9NA 3SVGA 4XI1A 5I86A 2AN6A 4CUUA 3S92A 3NG2A 5HENA 2YW8A 3EB6A 4Z93A 4UP0A 3DPLR 5G0FA 5A5NA 2LV9A 5C11A 5D1MB 3SOXA 4LYSA 4R2YA 2D8SA 5D3RA 5A83A 5H1TA 2E7NA 5CUAA 1CHCA 4HXPA 5EWDA 5A5SA 2MD8C 5L96A 4KCXA 3UV5A 4O7CA 4ZW1A 2Y1NA 5B8DA 3QZSA 5DW1A 4CUPA 1X0JA 4IORA 4IOQA 4LR6A 4A9OA 4IR6A 5A5PA 5DINA 5II2A 1LDJB 4MENA 5II1A 4QYLA 5FFVA 5IGMA 2GRCA 5F1LA 5KHMA 2L43A 4TU4A 4WIVA 2R0VA 5CRMA 4F3IA 4A9MA 4BJXA 4BW1A 4HBYA 2IDAA 1EQFA 3ZNIA 5F61A 4O76A 2KTBB 2NXBA 3Q2EA 5CUBA 2KWOA 2LGGA 5C87A 4QR5A 4QC1A 5D3PA 5C8GA 4TZ8A 4A49A 4CUQA 4S3OC 1N87A 5HRWA 2OUOA 4ALHA 2L84A 5EGUA 2KFTA 5I83A 2F6JA 4FJCA 4LYWA 4A4CA 2KGGA 3M63A 1WE9A 2KWNA 2KR4A 1U6GB 4PTBA 5ENBA 4ZQLA 1FP0A 3RPGC 4NYVA 4UITA 5D3TA 4YYMA 5CPEA 5TCMA 5B76A 2DVSA 1WEUA 2I7KA 5ACYA 3DWYA 3GL6A 2VJEA 4I7CA 5LCWB 5FB0A 2L80A 3ZVZB 2VJFA 4PCEA 2MT5A 5I3LA 5D1KB 5F60A 1ZS5A 3MXFA 4O74A 5A81A 4NR4A 5CQ3A 2KU3A 2DVQA 2MJVB 5EWCA 5AMFA 5EYAF 5CUCA
chains in the Genus database with same CATH superfamily
5A7CA 4UIXA 2Y1MA 3ONIA 3IU6A 2RS9B 3LQJA 5A82A 5B78A 4J3IA 2CKLA 4YABA 5KH9A 4HXMA 5SVYA 4GNFA 2HDPA 3UV4A 3RPGB 5F25A 4YYGA 3HMEA 5TBNA 5E9MA 5IGKA 2L0BA 3N9OA 5L8UA 4XUAA 4FK5A 3FL2A 4CL9A 3MDBC 4YK0A 5D1LB 3HCSA 2JMIA 4J1PA 5LKTA 4NUCA 5EISA 4YYNA 2OXQC 2YT5A 5G4RA 3N9PA 2RSDA 3P1FA 5IGNA 2YEMA 2MD7B 2XOYA 2L7PA 1JM7B 5EPSA 5EWVA 4LJNA 4GPJA 2EXUA 3MHHA 3KNVA 5ETBA 3ZYUA 1V87A 5EPBA 4AUQB 4AYCA 3AQAA 2YEKA 4QUTA 3GV4A 4A4BA 4HXRA 1ZBDB 4TT2A 3P1DA 5FE3A 5F62A 2YQMA 3U5OA 4A9EA 2F6NA 4HXLA 5LKXA 2JM3A 5FE5A 1VYXA 2YYNA 4Z6IA 4LZSA 5DBMA 5BT4A 1BORA 3DQVR 4WZ0A 4NQNA 3E2DA 5HQ5A 5EVAA 4HXKA 4UIYA 2JRJA 2JUNA 2MIQA 5FG4A 5F63A 5D7XA 2RR4A 4LADB 4MVTA 4NR8A 3FJUB 3M62A 4CCGX 3P1CA 3ZYQA 1WUGA 4O78A 5CZGA 4XUBA 5KTWA 2XEUA 2DATA 5FE4A 4AP4A 4Z0RA 5FG6A 1X4JA 5FB1A 5KO4A 2FUIA 3EB5A 5B77A 4TU6A 4X2IA 1JSPB 4Z6HA 4NRBA 2R0SA 1MBMA 4OUFA 5L8TA 3O47A 5FH6A 3LJWA 2EJNA 4QEUA 5I40A 2KWKA 2L75A 2YREA 1XWHA 4LLBA 5EU1A 2MUMA 5FE7A 2EODA 3DWDA 2DKWA 3QZTA 4TZ2A 5G04B 5SVIA 2YQLA 5E9VA 4R8PK 5HEMA 4H9DA 2YYRA 5ENHA 4HBVA 5DYAA 3MULA 4QSSA 1WUMA 4YBTA 5HJCA 5COIA 3L1XA 5FFWA 2QIZA 2LQ6A 4O62A 2C2VS 2LXPC 2WP1A 2OSSA 4NUDA 5CQ8A 5I89A 2ECIA 2EGMA 4CA1A 1MM2A 5FE9A 4OGCA 1WILA 2XB1A 4HBWA 4Y03A 5EM3A 5D25A 5I7XA 1E6IA 2VPEA 5E7DA 5I1QA 3N9LA 3TLPA 5FDZA 5JWMA 1MM3A 1VFYA 2E61A 2JMJA 5F5ZA 2XP0A 2VP7A 2EGPA 4YH3A 2K4DA 3U5KA 5DKDA 3T6RA 3G0JA 2MA6A 4UIVA 2HYED 4Z1SA 5HFQA 5E9IA 2L5EA 2YQDA 4AI6A 2EA6A 3PLWA 4YBMA 4NN2A 5D3NA 3AADA 4A9FA 5L99A 2CRWA 3HCUA 5CUDA 5K3QA 5DKHA 3KV6A 2CT2A 2YVRA 1HYIA 5KH7A 3L11A 5J0DA 5H1VA 3C6WA 3T7LA 2M85A 3VK6A 1DVPA 1LDKC 5FE6A 5ETDA 4QR3A 5IBNA 4MR6A 5KU3A 5E74A 5EICA 3G0LA 4WHUA 3HTKC 4O64A 3SUBA 2CSZA 5AITA 5F1HA 4O70A 5FH8A 3IHPA 4J0SA 2CONA 1WEQA 4LYIA 5E9KA 3O37A 3UVXA 1FBVA 5FE0A 1X4IA 3FM8C 4GNEA 3V43A 1Z60A 3ZTGA 3N9MA 4YATA 5LVRA 4UI9B 4I7DA 4QQ4A 4UYDA 5DYXA 3M7KA 4O7BA 5A5OA 2ZETC 5H85A 5E0RA 4YYIA 2KKYA 3U5MA 2E6RA 4UYFA 2OWAA 4QSVA 4NUEA 1WIMA 2RNYA 2LDRA 3KQIA 4X3GA 4L58A 2YSJA 2KWJA 4QSQA 4N4IA 3O34A 2LN0A 2KE1A 2DVRA 2NAAA 3PURA 2ECGA 2LGVA 4QSTA 5D3SA 5JI8A 2D8UA 2FD4A 5CUEA 2K17A 2QJ0A 3MB4A 5CRZA 4QEWA 2VPGA 2YELA 4LZRA 2VJEB 5D3HA 5HLSA 5I80A 4UYHA 2H0DA 3U5JA 4QR4A 1WESA 2R0YA 4NYXA 5K29A 2VJFB 5DFDA 4A9HA 1WEPA 3C5KA 3ZPV1 2M13A 4O71A 2DVVA 5BT5A 4XY9A 5FE8A 2FFWA 5E3DA 4UYEA 4Q0NA 3JVKA 4YYJA 4PCIA 5AD2A 3FEHA 4N4FA 3U5LA 5A5RA 4YY6A 4BW4A 4IOOA 2CKLB 4WZ2A 5C89A 5CS8A 3JVMA 5AMEA 3ZPVE 5HM0A 2F42A 3UVYA 3D1DA 5C7NA 4HXSA 2RO1A 4QC3A 5LVQA 3O7AA 5EPRA 2D9EA 4B7YC 5EK9A 4ZC9A 2FUUA 4NR9A 4QY4A 4MEPA 1Z6UA 3HMFA 5CGPA 2E3KA 5EP7A 3KV5A 2LGLA 2RNWA 3L1ZB 4R7EA 4QSWA 4E96A 2YUCA 3MUKA 1G25A 5DKCA 4NRAA 4QB3A 4AYCB 4C9ZA 3RTRB 4FIPA 4IC2A 5DFBA 5IIDA 4YBSA 1WENA 3LQIA 3MQMA 4NR6A 4YADA 3D1BA 5EWHA 5DFCA 1RMDA 5ENFA 3JVLA 4GB0A 3ZVYA 5E9YA 4FO9A 4MEQA 5EQ1A 5KTXA 4GNGA 4HXOA 5TDRA 5F3AA 2M6MA 1N72A 3U5PA 3Q1DA 5E3GA 4MR5A 2VNFA 4ZDTA 4HBXA 2JMDA 4MR4A 3PUQA 4O72A 5TB6A 2I50A 2FSAA 3DAIA 4TYLA 4TTEA 4IR4A 4CURA 5FE2A 4LZ2A 1F68A 1WEWA 1DCQA 4BW2A 2MNYA 5DX4A 3HMHA 4F52B 1HYJA 5ENCA 3P5OA 5E9LA 2QICA 2KYUA 2G4AA 4I7BA 4O75A 5A85A 3O35A 1E4UA 5C85A 2VPBA 3Q2FA 3D7CA 3GG3A 3SHBA 4PS5A 4Z0OA 4QSXA 4WA6A 3FAOA 1PUOA 5EI4A 4P5OB 4NRCA 3SOWA 4AKIA 3ASLA 5SVIB 5ENGA 5CFWA 1WEVA 5TABA 5CQTA 2RI7A 4C66A 4YYHA 2LRIC 5C13A 5KTUA 5ENJA 5FERA 2KIZA 5BT3A 5SVXA 3LXJA 4RVRA 4A9KA 2MKEA 3RCWA 5AIUA 5FE1A 4TT4A 4YYKA 2WP2A 5HFRA 5FG5A 4A9NA 4PKLA 3SVFA 4NS5A 4BW3A 2I8NA 4NYWA 1JOCA 2M1RA 5G05B 5D3LA 5FBXA 4QF3A 4KV1A 3FKMX 4YAXA 4AKHA 2E6SA 5F2PA 2M3HA 3DDTA 4CFLA 5I29A 4AKNA 5IGLA 3N9QA 4A0CD 4Q0OA 3O70A 4QNSA 5LJ2A 5LJ0A 3LVQE 3T9KA 4YY4A 5KH3A 3S91A 5D24A 4QBMA 5DW2A 4MSXA 4QEVA 4L7XA 2P57A 2L85A 2LSPB 4KV4A 5CP5A 5DLZA 2E7OA 4HXNA 3O33A 5CQAA 5I88A 4CLBA 2YW5A 2ECVA 2PNXA 2ECNA 4TQNA 2ECWA 5LUUA 2H60A 4V3LC 2YHOA 2OO1A 3M99A 4IR3A 3I2DA 2D82A 3MHSA 4BHWA 2R10A 5DYUA 4O7EA 3JVJA 5D26A 3UVDA 1WFKA 4LK9A 2G45A 4CUSA 4NXJA 3LJUX 3LRQA 2IQJA 5TRBA 4MEOA 3U5NA 1IYMA 2VPDA 4IC3A 4UYGA 1WEOA 3K2JA 4WZ3B 5DKAA 4MR3A 4AVXA 2DWWA 2N9GA 3UW9A 2B0OE 4UP5A 5LJ1A 4N3WA 5C4QA 3SVHA 1K2FA 2G6QA 2YU4A 5DY7A 4YH4A 4GNDA 5TDWA 2MNZA 5CQ7A 4XY8A 5CY9A 3QZVA 1VD4A 5HCLA 1X4UA 1Z2QA 5H1UA 1F62A 2Y43A 5J3XA 4ZUXU 1JM4B 4DONA 2ECTA 5CQ4A 2RFJA 5CQ6A 2UZGA 5FEYA 4C67A 1T1HA 4QYDA 5DLXA 2KGIA 4UYFB 2YURA 4S3OB 1WEEA 2YHNA 4LRGA 3ERRA 3JUEA 5L97A 4QSUA 5H9MA 1WGMA 4A9IA 4YYDA 5F36A 5HRXA 1JM7A 4N4GA 2LXHC 5EWWA 5B79A 2H0DB 4B86C 5G4SA 4A9LA 2LGKA 1ZKRA 4TKPB 2RNXA 4J0RA 4Q6FA 2MA5A 3IU5A 4BBQA 5ENIA 5D3JA 5I7YA 4XYAA 4QF2A 3UV2A 5E73A 4PY6A 2L5UA 2CSYA 4O77A 5B75A 4W4UA 4O7AA 5AD3A 3NXBA 3SOUA 2DSMA 4O7FA 3I3JA 5FH7A 4QSRA 3UVWA 5L98A 3KDEC 4LKAA 4QZSA 5HQ7A 5LKZA 4LDFA 2KKXA 2YDWA 5FFYA 5HELA 5D0CA 5HRVA 5HQ6A 3HCTA 3LQHA 3MB3A 4OGIA 5JG6A 4NR7A 4QUUA 2G43A 4NR5A 4CFKA 2PUYA 5CU8A 4LC2A 2K16A 2ECJA 4UIZA 4V3KC 2KREA 2DX8A 2BAYA 4TS8A 3P1EA 4IR5A 5EA1A 5IG6A 4WHWA 4N4HA 5CUGA 4TT6A 5A5QA 5LKUA 4FLPA 2C2LA 4UIUA 5CTLA 5ENEA 4NQMA 4ALGA 2K1JA 4QSPA 4CUTA 4YC9A 3PHDA 4A9JA 2YSMA 5EV9A 3O36A 4UIWA 5CQ5A 4PPEA 5DYCA 1WEMA 3VKGA 4OGJA 4Z1QA 3N9NA 3SVGA 4OGEA 4XI1A 5I86A 2AN6A 2XOZA 4CUUA 3S92A 3NG2A 5HENA 2YW8A 3EB6A 4Z93A 4UP0A 4AKGA 3DPLR 5G0FA 4F1PA 5A5NA 3VKHA 2LV9A 5C11A 5D1MB 3SOXA 4LYSA 4R2YA 2D8SA 5D3RA 5A83A 5H1TA 2E7NA 5CUAA 1CHCA 4HXPA 5EWDA 5A5SA 2MD8C 5L96A 4KCXA 3UV5A 4O7CA 4ZW1A 2Y1NA 5B8DA 3QZSA 5DW1A 4CUPA 2XOCA 1X0JA 4IORA 4IOQA 4LR6A 4A9OA 4IR6A 5A5PA 5DINA 5II2A 2LAUA 1LDJB 4MENA 5II1A 4QYLA 5FFVA 5IGMA 2GRCA 5F1LA 5KHMA 2L43A 4TU4A 4WIVA 2R0VA 5CRMA 4F3IA 4A9MA 4BJXA 4BW1A 4HBYA 2IDAA 1EQFA 3ZNIA 5F61A 2CSVA 4O76A 2KTBB 2NXBA 3Q2EA 5CUBA 2KWOA 2LGGA 3H7HA 5C87A 4QR5A 4QC1A 2CRRA 5D3PA 5C8GA 4TZ8A 4A49A 4CUQA 4S3OC 1N87A 5HRWA 2OUOA 4ALHA 2L84A 5EGUA 2KFTA 5I83A 2F6JA 4FJCA 4LYWA 4A4CA 2KGGA 3FANA 3M63A 2DJAA 1WE9A 2KWNA 2KR4A 1U6GB 4PTBA 5ENBA 4ZQLA 1FP0A 3RPGC 4NYVA 4UITA 5D3TA 4YYMA 5CPEA 5TCMA 5B76A 2DVSA 1WEUA 2I7KA 5ACYA 3DWYA 3GL6A 2VJEA 4I7CA 5LCWB 5FB0A 2L80A 3ZVZB 3LVRE 2VJFA 4PCEA 2MT5A 5I3LA 5D1KB 5F60A 1ZS5A 3MXFA 4O74A 5A81A 4NR4A 5CQ3A 2KU3A 2DVQA 2MJVB 5EWCA 5AMFA 5EYAF 3LDYA 5CUCA
chains in the Genus database with same CATH topology
5A7CA 4UIXA 2Y1MA 3ONIA 3IU6A 2RS9B 3LQJA 5A82A 5B78A 4J3IA 2CKLA 4YABA 5KH9A 4HXMA 4GNFA 2HDPA 3UV4A 3RPGB 5F25A 4YYGA 3HMEA 5E9MA 5IGKA 2L0BA 3N9OA 5L8UA 4XUAA 4FK5A 3FL2A 4CL9A 4YK0A 5D1LB 3HCSA 2JMIA 4J1PA 5LKTA 4NUCA 5EISA 4YYNA 2OXQC 2YT5A 5G4RA 3N9PA 2RSDA 3P1FA 5IGNA 2YEMA 2MD7B 1JM7B 5EPSA 5EWVA 4LJNA 4GPJA 3MHHA 3KNVA 5ETBA 3ZYUA 1V87A 5EPBA 4AUQB 4AYCA 3AQAA 2YEKA 4QUTA 3GV4A 4A4BA 4HXRA 1ZBDB 4TT2A 3P1DA 5FE3A 5F62A 2YQMA 3U5OA 4A9EA 2F6NA 4HXLA 5LKXA 5FE5A 1VYXA 2YYNA 4Z6IA 5DBMA 4LZSA 5BT4A 1BORA 3DQVR 4WZ0A 4NQNA 5HQ5A 5EVAA 4HXKA 4UIYA 2JRJA 2MIQA 4LADB 5FG4A 5F63A 5D7XA 4CCGX 4MVTA 5TBNA 4NR8A 3M62A 3P1CA 3ZYQA 1WUGA 4O78A 5CZGA 4XUBA 5KTWA 2XEUA 2DATA 5FE4A 4AP4A 5B77A 5FG6A 1X4JA 5FB1A 5KO4A 2FUIA 3EB5A 4TU6A 4X2IA 1JSPB 4Z6HA 4NRBA 2R0SA 4OUFA 5L8TA 5FH6A 3LJWA 4QEUA 5I40A 2KWKA 2L75A 2YREA 1XWHA 4LLBA 5EU1A 2MUMA 5FE7A 2EODA 5G04B 2DKWA 3QZTA 4TZ2A 2YQLA 5E9VA 4R8PK 5HEMA 2YYRA 5ENHA 4HBVA 5DYAA 3MULA 4QSSA 1WUMA 4YBTA 5HJCA 5COIA 3L1XA 5FFWA 2QIZA 2LQ6A 2C2VS 2LXPC 2WP1A 2OSSA 4NUDA 5CQ8A 5I89A 2ECIA 4CA1A 1MM2A 5FE9A 1WILA 2XB1A 4HBWA 4Y03A 5EM3A 5D25A 5I7XA 1E6IA 2VPEA 5E7DA 5I1QA 3N9LA 3TLPA 5FDZA 5JWMA 1MM3A 1VFYA 2JMJA 5F5ZA 2VP7A 2EGPA 4YH3A 2K4DA 3U5KA 5DKDA 3T6RA 3G0JA 2MA6A 4UIVA 2HYED 4Z1SA 5HFQA 5E9IA 2L5EA 2YQDA 2EA6A 4NN2A 4YBMA 5D3NA 3AADA 4A9FA 5L99A 3HCUA 5CUDA 1HYIA 5DKHA 3KV6A 2CT2A 5KH7A 3L11A 5J0DA 5H1VA 3C6WA 3T7LA 2M85A 3VK6A 1DVPA 1LDKC 5FE6A 5ETDA 4QR3A 5IBNA 4MR6A 5KU3A 5E74A 5EICA 3G0LA 4WHUA 3HTKC 4O64A 2CSZA 5AITA 5F1HA 4O70A 5FH8A 3IHPA 4J0SA 1WEQA 4LYIA 5E9KA 3O37A 3UVXA 1FBVA 5FE0A 1X4IA 4GNEA 3V43A 1Z60A 3ZTGA 3N9MA 4YATA 5LVRA 4UI9B 4I7DA 4UYDA 5DYXA 4O7BA 5A5OA 2ZETC 5H85A 5E0RA 4YYIA 3U5MA 2E6RA 4UYFA 4QSVA 4NUEA 1WIMA 2RNYA 2LDRA 3KQIA 4X3GA 4L58A 2YSJA 2KWJA 4QSQA 4N4IA 3O34A 2LN0A 2KE1A 2DVRA 2NAAA 3PURA 2ECGA 2LGVA 4QSTA 5D3SA 5JI8A 2K17A 5CUEA 2QJ0A 3MB4A 5CRZA 4QEWA 2VPGA 2YELA 4LZRA 2VJEB 5D3HA 5HLSA 5I80A 4UYHA 2H0DA 3U5JA 4QR4A 1WESA 2R0YA 4NYXA 5K29A 2VJFB 5DFDA 4A9HA 1WEPA 3C5KA 3ZPV1 4O71A 2DVVA 5BT5A 4XY9A 5FE8A 5E3DA 4UYEA 4Q0NA 3JVKA 4YYJA 4PCIA 5AD2A 4N4FA 3U5LA 5A5RA 4YY6A 4BW4A 4IOOA 2CKLB 4WZ2A 5C89A 5CS8A 3JVMA 5AMEA 3ZPVE 5HM0A 2F42A 3UVYA 5C7NA 4HXSA 2RO1A 4QC3A 5LVQA 3O7AA 5EPRA 2D9EA 4B7YC 5EK9A 4ZC9A 2FUUA 4NR9A 4QY4A 4MEPA 1Z6UA 3HMFA 5CGPA 2E3KA 5EP7A 3KV5A 2LGLA 2RNWA 3L1ZB 4R7EA 4QSWA 4E96A 2YUCA 3MUKA 1G25A 5DKCA 4NRAA 4QB3A 4AYCB 4C9ZA 3RTRB 4FIPA 4IC2A 5DFBA 5IIDA 4YBSA 1WENA 3LQIA 3MQMA 4NR6A 4YADA 5EWHA 5DFCA 1RMDA 5ENFA 3JVLA 4GB0A 3ZVYA 5E9YA 4FO9A 4MEQA 5EQ1A 5KTXA 4GNGA 4HXOA 5TDRA 5F3AA 2M6MA 1N72A 3U5PA 5E3GA 4MR5A 2VNFA 4ZDTA 4HBXA 2JMDA 4MR4A 3PUQA 4O72A 5TB6A 2I50A 2FSAA 3DAIA 4TYLA 4TTEA 4IR4A 4CURA 5FE2A 4LZ2A 1F68A 1WEWA 1HYJA 4BW2A 2MNYA 5DX4A 3HMHA 4F52B 5ENCA 3P5OA 5E9LA 2QICA 2KYUA 2G4AA 4I7BA 4O75A 5A85A 3O35A 1E4UA 5C85A 2VPBA 3Q2FA 3D7CA 3GG3A 3SHBA 4PS5A 4QSXA 4WA6A 5EI4A 4P5OB 4NRCA 3SOWA 3ASLA 5ENGA 5CFWA 1WEVA 5TABA 5CQTA 2RI7A 4C66A 4YYHA 2LRIC 5C13A 5KTUA 5ENJA 5FERA 2KIZA 5BT3A 3LXJA 4RVRA 4A9KA 3RCWA 5AIUA 5FE1A 4TT4A 4YYKA 2WP2A 5HFRA 5FG5A 4A9NA 4PKLA 3SVFA 4NS5A 4BW3A 2I8NA 4NYWA 1JOCA 2M1RA 5G05B 5D3LA 5FBXA 4QF3A 4KV1A 3FKMX 4YAXA 2M3HA 2E6SA 5F2PA 4CFLA 5I29A 4AKNA 5IGLA 3N9QA 4A0CD 4Q0OA 3O70A 4QNSA 5LJ2A 5LJ0A 4YY4A 5KH3A 3S91A 5D24A 4QBMA 5DW2A 4MSXA 4QEVA 4L7XA 2L85A 2LSPB 4KV4A 5CP5A 5DLZA 2E7OA 4HXNA 3O33A 5CQAA 5I88A 4CLBA 2YW5A 2ECVA 2PNXA 2ECNA 4TQNA 2ECWA 5LUUA 2H60A 4V3LC 2YHOA 2OO1A 3M99A 4IR3A 3I2DA 2D82A 3MHSA 4BHWA 2R10A 5DYUA 4O7EA 3JVJA 5D26A 3UVDA 1WFKA 4LK9A 2G45A 4CUSA 4NXJA 3LRQA 5TRBA 4MEOA 3U5NA 1IYMA 2VPDA 4IC3A 4UYGA 1WEOA 3K2JA 4WZ3B 5DKAA 4MR3A 4AVXA 2DWWA 2N9GA 3UW9A 4UP5A 5LJ1A 4N3WA 5C4QA 3SVHA 1K2FA 2G6QA 2YU4A 5DY7A 4YH4A 4GNDA 5TDWA 2MNZA 5CQ7A 4XY8A 5CY9A 3QZVA 1VD4A 5HCLA 1X4UA 1Z2QA 5H1UA 1F62A 2Y43A 5J3XA 4ZUXU 1JM4B 4DONA 2ECTA 5CQ4A 2RFJA 5CQ6A 2UZGA 5FEYA 4C67A 1T1HA 4QYDA 5DLXA 2KGIA 4UYFB 2YURA 4S3OB 1WEEA 2YHNA 4LRGA 5L97A 4QSUA 5H9MA 1WGMA 4A9IA 4YYDA 5F36A 5HRXA 1JM7A 4N4GA 2LXHC 5EWWA 5B79A 2H0DB 4B86C 5G4SA 4A9LA 2LGKA 4TKPB 2RNXA 4J0RA 4Q6FA 2MA5A 3IU5A 4BBQA 5ENIA 5D3JA 5I7YA 4XYAA 4QF2A 3UV2A 5E73A 4PY6A 2L5UA 2CSYA 4O77A 5B75A 4W4UA 4O7AA 5AD3A 3NXBA 3SOUA 4O7FA 3I3JA 5FH7A 4QSRA 3UVWA 5L98A 4LKAA 4QZSA 5HQ7A 5LKZA 4LDFA 2YDWA 5FFYA 5HELA 5D0CA 5HRVA 5HQ6A 3HCTA 3LQHA 3MB3A 4OGIA 5JG6A 4NR7A 4QUUA 2G43A 4NR5A 4CFKA 2PUYA 5CU8A 4LC2A 2K16A 2ECJA 4UIZA 4V3KC 2KREA 2DX8A 2BAYA 4TS8A 3P1EA 4IR5A 5EA1A 5IG6A 4WHWA 4N4HA 5CUGA 4TT6A 5A5QA 5LKUA 4FLPA 2C2LA 4UIUA 5CTLA 5ENEA 4NQMA 4ALGA 2K1JA 4QSPA 4CUTA 4YC9A 3PHDA 4A9JA 2YSMA 5EV9A 3O36A 4UIWA 5CQ5A 4PPEA 5DYCA 1WEMA 4OGJA 4Z1QA 3N9NA 3SVGA 4XI1A 5I86A 2AN6A 4CUUA 3S92A 3NG2A 5HENA 2YW8A 3EB6A 4Z93A 4UP0A 3DPLR 5G0FA 5A5NA 2LV9A 5C11A 5D1MB 3SOXA 4LYSA 4R2YA 2D8SA 5D3RA 5A83A 5H1TA 2E7NA 5CUAA 1CHCA 4HXPA 5EWDA 5A5SA 2MD8C 5L96A 4KCXA 3UV5A 4O7CA 4ZW1A 2Y1NA 5B8DA 3QZSA 5DW1A 4CUPA 1X0JA 4IORA 4IOQA 4LR6A 4A9OA 4IR6A 5A5PA 5DINA 5II2A 1LDJB 4MENA 5II1A 4QYLA 5FFVA 5IGMA 2GRCA 5F1LA 5KHMA 2L43A 4TU4A 4WIVA 2R0VA 5CRMA 4F3IA 4A9MA 4BJXA 4BW1A 4HBYA 2IDAA 1EQFA 3ZNIA 5F61A 4O76A 2KTBB 2NXBA 3Q2EA 5CUBA 2KWOA 2LGGA 5C87A 4QR5A 4QC1A 5D3PA 5C8GA 4TZ8A 4A49A 4CUQA 4S3OC 1N87A 5HRWA 2OUOA 4ALHA 2L84A 5EGUA 2KFTA 5I83A 2F6JA 4FJCA 4LYWA 4A4CA 2KGGA 3M63A 1WE9A 2KWNA 2KR4A 1U6GB 4PTBA 5ENBA 4ZQLA 1FP0A 3RPGC 4NYVA 4UITA 5D3TA 4YYMA 5CPEA 5TCMA 5B76A 2DVSA 1WEUA 2I7KA 5ACYA 3DWYA 3GL6A 2VJEA 4I7CA 5LCWB 5FB0A 2L80A 3ZVZB 2VJFA 4PCEA 2MT5A 5I3LA 5D1KB 5F60A 1ZS5A 3MXFA 4O74A 5A81A 4NR4A 5CQ3A 2KU3A 2DVQA 2MJVB 5EWCA 5AMFA 5EYAF 5CUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7C A;  4UIX A;  2Y1M A;  3ONI A;  3IU6 A;  2RS9 B;  3LQJ A;  5A82 A;  5B78 A;  4J3I A;  2CKL A;  4YAB A;  5KH9 A;  4HXM A;  4GNF A;  2HDP A;  3UV4 A;  3RPG B;  5F25 A;  4YYG A;  3HME A;  5E9M A;  5IGK A;  2L0B A;  3N9O A;  5L8U A;  4XUA A;  4FK5 A;  3FL2 A;  4CL9 A;  4YK0 A;  5D1L B;  3HCS A;  2JMI A;  4J1P A;  5LKT A;  4NUC A;  5EIS A;  4YYN A;  2OXQ C;  2YT5 A;  5G4R A;  3N9P A;  2RSD A;  3P1F A;  5IGN A;  2YEM A;  2MD7 B;  1JM7 B;  5EPS A;  5EWV A;  4LJN A;  4GPJ A;  3MHH A;  3KNV A;  5ETB A;  3ZYU A;  1V87 A;  5EPB A;  4AUQ B;  4AYC A;  3AQA A;  2YEK A;  4QUT A;  3GV4 A;  4A4B A;  4HXR A;  1ZBD B;  4TT2 A;  3P1D A;  5FE3 A;  5F62 A;  2YQM A;  3U5O A;  4A9E A;  2F6N A;  4HXL A;  5LKX A;  5FE5 A;  1VYX A;  2YYN A;  4Z6I A;  5DBM A;  4LZS A;  5BT4 A;  1BOR A;  3DQV R;  4WZ0 A;  4NQN A;  5HQ5 A;  5EVA A;  4HXK A;  4UIY A;  2JRJ A;  2MIQ A;  4LAD B;  5FG4 A;  5F63 A;  5D7X A;  4CCG X;  4MVT A;  5TBN A;  4NR8 A;  3M62 A;  3P1C A;  3ZYQ A;  1WUG A;  4O78 A;  5CZG A;  4XUB A;  5KTW A;  2XEU A;  2DAT A;  5FE4 A;  4AP4 A;  5B77 A;  5FG6 A;  1X4J A;  5FB1 A;  5KO4 A;  2FUI A;  3EB5 A;  4TU6 A;  4X2I A;  1JSP B;  4Z6H A;  4NRB A;  2R0S A;  4OUF A;  5L8T A;  5FH6 A;  3LJW A;  4QEU A;  5I40 A;  2KWK A;  2L75 A;  2YRE A;  1XWH A;  4LLB A;  5EU1 A;  2MUM A;  5FE7 A;  2EOD A;  5G04 B;  2DKW A;  3QZT A;  4TZ2 A;  2YQL A;  5E9V A;  4R8P K;  5HEM A;  2YYR A;  5ENH A;  4HBV A;  5DYA A;  3MUL A;  4QSS A;  1WUM A;  4YBT A;  5HJC A;  5COI A;  3L1X A;  5FFW A;  2QIZ A;  2LQ6 A;  2C2V S;  2LXP C;  2WP1 A;  2OSS A;  4NUD A;  5CQ8 A;  5I89 A;  2ECI A;  4CA1 A;  1MM2 A;  5FE9 A;  1WIL A;  2XB1 A;  4HBW A;  4Y03 A;  5EM3 A;  5D25 A;  5I7X A;  1E6I A;  2VPE A;  5E7D A;  5I1Q A;  3N9L A;  3TLP A;  5FDZ A;  5JWM A;  1MM3 A;  1VFY A;  2JMJ A;  5F5Z A;  2VP7 A;  2EGP A;  4YH3 A;  2K4D A;  3U5K A;  5DKD A;  3T6R A;  3G0J A;  2MA6 A;  4UIV A;  2HYE D;  4Z1S A;  5HFQ A;  5E9I A;  2L5E A;  2YQD A;  2EA6 A;  4NN2 A;  4YBM A;  5D3N A;  3AAD A;  4A9F A;  5L99 A;  3HCU A;  5CUD A;  1HYI A;  5DKH A;  3KV6 A;  2CT2 A;  5KH7 A;  3L11 A;  5J0D A;  5H1V A;  3C6W A;  3T7L A;  2M85 A;  3VK6 A;  1DVP A;  1LDK C;  5FE6 A;  5ETD A;  4QR3 A;  5IBN A;  4MR6 A;  5KU3 A;  5E74 A;  5EIC A;  3G0L A;  4WHU A;  3HTK C;  4O64 A;  2CSZ A;  5AIT A;  5F1H A;  4O70 A;  5FH8 A;  3IHP A;  4J0S A;  1WEQ A;  4LYI A;  5E9K A;  3O37 A;  3UVX A;  1FBV A;  5FE0 A;  1X4I A;  4GNE A;  3V43 A;  1Z60 A;  3ZTG A;  3N9M A;  4YAT A;  5LVR A;  4UI9 B;  4I7D A;  4UYD A;  5DYX A;  4O7B A;  5A5O A;  2ZET C;  5H85 A;  5E0R A;  4YYI A;  3U5M A;  2E6R A;  4UYF A;  4QSV A;  4NUE A;  1WIM A;  2RNY A;  2LDR A;  3KQI A;  4X3G A;  4L58 A;  2YSJ A;  2KWJ A;  4QSQ A;  4N4I A;  3O34 A;  2LN0 A;  2KE1 A;  2DVR A;  2NAA A;  3PUR A;  2ECG A;  2LGV A;  4QST A;  5D3S A;  5JI8 A;  2K17 A;  5CUE A;  2QJ0 A;  3MB4 A;  5CRZ A;  4QEW A;  2VPG A;  2YEL A;  4LZR A;  2VJE B;  5D3H A;  5HLS A;  5I80 A;  4UYH A;  2H0D A;  3U5J A;  4QR4 A;  1WES A;  2R0Y A;  4NYX A;  5K29 A;  2VJF B;  5DFD A;  4A9H A;  1WEP A;  3C5K A;  3ZPV 1;  4O71 A;  2DVV A;  5BT5 A;  4XY9 A;  5FE8 A;  5E3D A;  4UYE A;  4Q0N A;  3JVK A;  4YYJ A;  4PCI A;  5AD2 A;  4N4F A;  3U5L A;  5A5R A;  4YY6 A;  4BW4 A;  4IOO A;  2CKL B;  4WZ2 A;  5C89 A;  5CS8 A;  3JVM A;  5AME A;  3ZPV E;  5HM0 A;  2F42 A;  3UVY A;  5C7N A;  4HXS A;  2RO1 A;  4QC3 A;  5LVQ A;  3O7A A;  5EPR A;  2D9E A;  4B7Y C;  5EK9 A;  4ZC9 A;  2FUU A;  4NR9 A;  4QY4 A;  4MEP A;  1Z6U A;  3HMF A;  5CGP A;  2E3K A;  5EP7 A;  3KV5 A;  2LGL A;  2RNW A;  3L1Z B;  4R7E A;  4QSW A;  4E96 A;  2YUC A;  3MUK A;  1G25 A;  5DKC A;  4NRA A;  4QB3 A;  4AYC B;  4C9Z A;  3RTR B;  4FIP A;  4IC2 A;  5DFB A;  5IID A;  4YBS A;  1WEN A;  3LQI A;  3MQM A;  4NR6 A;  4YAD A;  5EWH A;  5DFC A;  1RMD A;  5ENF A;  3JVL A;  4GB0 A;  3ZVY A;  5E9Y A;  4FO9 A;  4MEQ A;  5EQ1 A;  5KTX A;  4GNG A;  4HXO A;  5TDR A;  5F3A A;  2M6M A;  1N72 A;  3U5P A;  5E3G A;  4MR5 A;  2VNF A;  4ZDT A;  4HBX A;  2JMD A;  4MR4 A;  3PUQ A;  4O72 A;  5TB6 A;  2I50 A;  2FSA A;  3DAI A;  4TYL A;  4TTE A;  4IR4 A;  4CUR A;  5FE2 A;  4LZ2 A;  1F68 A;  1WEW A;  1HYJ A;  4BW2 A;  2MNY A;  5DX4 A;  3HMH A;  4F52 B;  5ENC A;  3P5O A;  5E9L A;  2QIC A;  2KYU A;  2G4A A;  4I7B A;  4O75 A;  5A85 A;  3O35 A;  1E4U A;  5C85 A;  2VPB A;  3Q2F A;  3D7C A;  3GG3 A;  3SHB A;  4PS5 A;  4QSX A;  4WA6 A;  5EI4 A;  4P5O B;  4NRC A;  3SOW A;  3ASL A;  5ENG A;  5CFW A;  1WEV A;  5TAB A;  5CQT A;  2RI7 A;  4C66 A;  4YYH A;  2LRI C;  5C13 A;  5KTU A;  5ENJ A;  5FER A;  2KIZ A;  5BT3 A;  3LXJ A;  4RVR A;  4A9K A;  3RCW A;  5AIU A;  5FE1 A;  4TT4 A;  4YYK A;  2WP2 A;  5HFR A;  5FG5 A;  4A9N A;  4PKL A;  3SVF A;  4NS5 A;  4BW3 A;  2I8N A;  4NYW A;  1JOC A;  2M1R A;  5G05 B;  5D3L A;  5FBX A;  4QF3 A;  4KV1 A;  3FKM X;  4YAX A;  2M3H A;  2E6S A;  5F2P A;  4CFL A;  5I29 A;  4AKN A;  5IGL A;  3N9Q A;  4A0C D;  4Q0O A;  3O70 A;  4QNS A;  5LJ2 A;  5LJ0 A;  4YY4 A;  5KH3 A;  3S91 A;  5D24 A;  4QBM A;  5DW2 A;  4MSX A;  4QEV A;  4L7X A;  2L85 A;  2LSP B;  4KV4 A;  5CP5 A;  5DLZ A;  2E7O A;  4HXN A;  3O33 A;  5CQA A;  5I88 A;  4CLB A;  2YW5 A;  2ECV A;  2PNX A;  2ECN A;  4TQN A;  2ECW A;  5LUU A;  2H60 A;  4V3L C;  2YHO A;  2OO1 A;  3M99 A;  4IR3 A;  3I2D A;  2D82 A;  3MHS A;  4BHW A;  2R10 A;  5DYU A;  4O7E A;  3JVJ A;  5D26 A;  3UVD A;  1WFK A;  4LK9 A;  2G45 A;  4CUS A;  4NXJ A;  3LRQ A;  5TRB A;  4MEO A;  3U5N A;  1IYM A;  2VPD A;  4IC3 A;  4UYG A;  1WEO A;  3K2J A;  4WZ3 B;  5DKA A;  4MR3 A;  4AVX A;  2DWW A;  2N9G A;  3UW9 A;  4UP5 A;  5LJ1 A;  4N3W A;  5C4Q A;  3SVH A;  1K2F A;  2G6Q A;  2YU4 A;  5DY7 A;  4YH4 A;  4GND A;  5TDW A;  2MNZ A;  5CQ7 A;  4XY8 A;  5CY9 A;  3QZV A;  1VD4 A;  5HCL A;  1X4U A;  1Z2Q A;  5H1U A;  1F62 A;  2Y43 A;  5J3X A;  4ZUX U;  1JM4 B;  4DON A;  2ECT A;  5CQ4 A;  2RFJ A;  5CQ6 A;  2UZG A;  5FEY A;  4C67 A;  1T1H A;  4QYD A;  5DLX A;  2KGI A;  4UYF B;  2YUR A;  4S3O B;  1WEE A;  2YHN A;  4LRG A;  5L97 A;  4QSU A;  5H9M A;  1WGM A;  4A9I A;  4YYD A;  5F36 A;  5HRX A;  1JM7 A;  4N4G A;  2LXH C;  5EWW A;  5B79 A;  2H0D B;  4B86 C;  5G4S A;  4A9L A;  2LGK A;  4TKP B;  2RNX A;  4J0R A;  4Q6F A;  2MA5 A;  3IU5 A;  4BBQ A;  5ENI A;  5D3J A;  5I7Y A;  4XYA A;  4QF2 A;  3UV2 A;  5E73 A;  4PY6 A;  2L5U A;  2CSY A;  4O77 A;  5B75 A;  4W4U A;  4O7A A;  5AD3 A;  3NXB A;  3SOU A;  4O7F A;  3I3J A;  5FH7 A;  4QSR A;  3UVW A;  5L98 A;  4LKA A;  4QZS A;  5HQ7 A;  5LKZ A;  4LDF A;  2YDW A;  5FFY A;  5HEL A;  5D0C A;  5HRV A;  5HQ6 A;  3HCT A;  3LQH A;  3MB3 A;  4OGI A;  5JG6 A;  4NR7 A;  4QUU A;  2G43 A;  4NR5 A;  4CFK A;  2PUY A;  5CU8 A;  4LC2 A;  2K16 A;  2ECJ A;  4UIZ A;  4V3K C;  2KRE A;  2DX8 A;  2BAY A;  4TS8 A;  3P1E A;  4IR5 A;  5EA1 A;  5IG6 A;  4WHW A;  4N4H A;  5CUG A;  4TT6 A;  5A5Q A;  5LKU A;  4FLP A;  2C2L A;  4UIU A;  5CTL A;  5ENE A;  4NQM A;  4ALG A;  2K1J A;  4QSP A;  4CUT A;  4YC9 A;  3PHD A;  4A9J A;  2YSM A;  5EV9 A;  3O36 A;  4UIW A;  5CQ5 A;  4PPE A;  5DYC A;  1WEM A;  4OGJ A;  4Z1Q A;  3N9N A;  3SVG A;  4XI1 A;  5I86 A;  2AN6 A;  4CUU A;  3S92 A;  3NG2 A;  5HEN A;  2YW8 A;  3EB6 A;  4Z93 A;  4UP0 A;  3DPL R;  5G0F A;  5A5N A;  2LV9 A;  5C11 A;  5D1M B;  3SOX A;  4LYS A;  4R2Y A;  2D8S A;  5D3R A;  5A83 A;  5H1T A;  2E7N A;  5CUA A;  1CHC A;  4HXP A;  5EWD A;  5A5S A;  2MD8 C;  5L96 A;  4KCX A;  3UV5 A;  4O7C A;  4ZW1 A;  2Y1N A;  5B8D A;  3QZS A;  5DW1 A;  4CUP A;  1X0J A;  4IOR A;  4IOQ A;  4LR6 A;  4A9O A;  4IR6 A;  5A5P A;  5DIN A;  5II2 A;  1LDJ B;  4MEN A;  5II1 A;  4QYL A;  5FFV A;  5IGM A;  2GRC A;  5F1L A;  5KHM A;  2L43 A;  4TU4 A;  4WIV A;  2R0V A;  5CRM A;  4F3I A;  4A9M A;  4BJX A;  4BW1 A;  4HBY A;  2IDA A;  1EQF A;  3ZNI A;  5F61 A;  4O76 A;  2KTB B;  2NXB A;  3Q2E A;  5CUB A;  2KWO A;  2LGG A;  5C87 A;  4QR5 A;  4QC1 A;  5D3P A;  5C8G A;  4TZ8 A;  4A49 A;  4CUQ A;  4S3O C;  1N87 A;  5HRW A;  2OUO A;  4ALH A;  2L84 A;  5EGU A;  2KFT A;  5I83 A;  2F6J A;  4FJC A;  4LYW A;  4A4C A;  2KGG A;  3M63 A;  1WE9 A;  2KWN A;  2KR4 A;  1U6G B;  4PTB A;  5ENB A;  4ZQL A;  1FP0 A;  3RPG C;  4NYV A;  4UIT A;  5D3T A;  4YYM A;  5CPE A;  5TCM A;  5B76 A;  2DVS A;  1WEU A;  2I7K A;  5ACY A;  3DWY A;  3GL6 A;  2VJE A;  4I7C A;  5LCW B;  5FB0 A;  2L80 A;  3ZVZ B;  2VJF A;  4PCE A;  2MT5 A;  5I3L A;  5D1K B;  5F60 A;  1ZS5 A;  3MXF A;  4O74 A;  5A81 A;  4NR4 A;  5CQ3 A;  2KU3 A;  2DVQ A;  2MJV B;  5EWC A;  5AMF A;  5EYA F;  5CUC A; 
#chains in the Genus database with same CATH topology
 5A7C A;  4UIX A;  2Y1M A;  3ONI A;  3IU6 A;  2RS9 B;  3LQJ A;  5A82 A;  5B78 A;  4J3I A;  2CKL A;  4YAB A;  5KH9 A;  4HXM A;  5SVY A;  4GNF A;  2HDP A;  3UV4 A;  3RPG B;  5F25 A;  4YYG A;  3HME A;  5TBN A;  5E9M A;  5IGK A;  2L0B A;  3N9O A;  5L8U A;  4XUA A;  4FK5 A;  3FL2 A;  4CL9 A;  3MDB C;  4YK0 A;  5D1L B;  3HCS A;  2JMI A;  4J1P A;  5LKT A;  4NUC A;  5EIS A;  4YYN A;  2OXQ C;  2YT5 A;  5G4R A;  3N9P A;  2RSD A;  3P1F A;  5IGN A;  2YEM A;  2MD7 B;  2XOY A;  2L7P A;  1JM7 B;  5EPS A;  5EWV A;  4LJN A;  4GPJ A;  2EXU A;  3MHH A;  3KNV A;  5ETB A;  3ZYU A;  1V87 A;  5EPB A;  4AUQ B;  4AYC A;  3AQA A;  2YEK A;  4QUT A;  3GV4 A;  4A4B A;  4HXR A;  1ZBD B;  4TT2 A;  3P1D A;  5FE3 A;  5F62 A;  2YQM A;  3U5O A;  4A9E A;  2F6N A;  4HXL A;  5LKX A;  2JM3 A;  5FE5 A;  1VYX A;  2YYN A;  4Z6I A;  4LZS A;  5DBM A;  5BT4 A;  1BOR A;  3DQV R;  4WZ0 A;  4NQN A;  3E2D A;  5HQ5 A;  5EVA A;  4HXK A;  4UIY A;  2JRJ A;  2JUN A;  2MIQ A;  5FG4 A;  5F63 A;  5D7X A;  2RR4 A;  4LAD B;  4MVT A;  4NR8 A;  3FJU B;  3M62 A;  4CCG X;  3P1C A;  3ZYQ A;  1WUG A;  4O78 A;  5CZG A;  4XUB A;  5KTW A;  2XEU A;  2DAT A;  5FE4 A;  4AP4 A;  4Z0R A;  5FG6 A;  1X4J A;  5FB1 A;  5KO4 A;  2FUI A;  3EB5 A;  5B77 A;  4TU6 A;  4X2I A;  1JSP B;  4Z6H A;  4NRB A;  2R0S A;  1MBM A;  4OUF A;  5L8T A;  3O47 A;  5FH6 A;  3LJW A;  2EJN A;  4QEU A;  5I40 A;  2KWK A;  2L75 A;  2YRE A;  1XWH A;  4LLB A;  5EU1 A;  2MUM A;  5FE7 A;  2EOD A;  3DWD A;  2DKW A;  3QZT A;  4TZ2 A;  5G04 B;  5SVI A;  2YQL A;  5E9V A;  4R8P K;  5HEM A;  4H9D A;  2YYR A;  5ENH A;  4HBV A;  5DYA A;  3MUL A;  4QSS A;  1WUM A;  4YBT A;  5HJC A;  5COI A;  3L1X A;  5FFW A;  2QIZ A;  2LQ6 A;  4O62 A;  2C2V S;  2LXP C;  2WP1 A;  2OSS A;  4NUD A;  5CQ8 A;  5I89 A;  2ECI A;  2EGM A;  4CA1 A;  1MM2 A;  5FE9 A;  4OGC A;  1WIL A;  2XB1 A;  4HBW A;  4Y03 A;  5EM3 A;  5D25 A;  5I7X A;  1E6I A;  2VPE A;  5E7D A;  5I1Q A;  3N9L A;  3TLP A;  5FDZ A;  5JWM A;  1MM3 A;  1VFY A;  2E61 A;  2JMJ A;  5F5Z A;  2XP0 A;  2VP7 A;  2EGP A;  4YH3 A;  2K4D A;  3U5K A;  5DKD A;  3T6R A;  3G0J A;  2MA6 A;  4UIV A;  2HYE D;  4Z1S A;  5HFQ A;  5E9I A;  2L5E A;  2YQD A;  4AI6 A;  2EA6 A;  3PLW A;  4YBM A;  4NN2 A;  5D3N A;  3AAD A;  4A9F A;  5L99 A;  2CRW A;  3HCU A;  5CUD A;  5K3Q A;  5DKH A;  3KV6 A;  2CT2 A;  2YVR A;  1HYI A;  5KH7 A;  3L11 A;  5J0D A;  5H1V A;  3C6W A;  3T7L A;  2M85 A;  3VK6 A;  1DVP A;  1LDK C;  5FE6 A;  5ETD A;  4QR3 A;  5IBN A;  4MR6 A;  5KU3 A;  5E74 A;  5EIC A;  3G0L A;  4WHU A;  3HTK C;  4O64 A;  3SUB A;  2CSZ A;  5AIT A;  5F1H A;  4O70 A;  5FH8 A;  3IHP A;  4J0S A;  2CON A;  1WEQ A;  4LYI A;  5E9K A;  3O37 A;  3UVX A;  1FBV A;  5FE0 A;  1X4I A;  3FM8 C;  4GNE A;  3V43 A;  1Z60 A;  3ZTG A;  3N9M A;  4YAT A;  5LVR A;  4UI9 B;  4I7D A;  4QQ4 A;  4UYD A;  5DYX A;  3M7K A;  4O7B A;  5A5O A;  2ZET C;  5H85 A;  5E0R A;  4YYI A;  2KKY A;  3U5M A;  2E6R A;  4UYF A;  2OWA A;  4QSV A;  4NUE A;  1WIM A;  2RNY A;  2LDR A;  3KQI A;  4X3G A;  4L58 A;  2YSJ A;  2KWJ A;  4QSQ A;  4N4I A;  3O34 A;  2LN0 A;  2KE1 A;  2DVR A;  2NAA A;  3PUR A;  2ECG A;  2LGV A;  4QST A;  5D3S A;  5JI8 A;  2D8U A;  2FD4 A;  5CUE A;  2K17 A;  2QJ0 A;  3MB4 A;  5CRZ A;  4QEW A;  2VPG A;  2YEL A;  4LZR A;  2VJE B;  5D3H A;  5HLS A;  5I80 A;  4UYH A;  2H0D A;  3U5J A;  4QR4 A;  1WES A;  2R0Y A;  4NYX A;  5K29 A;  2VJF B;  5DFD A;  4A9H A;  1WEP A;  3C5K A;  3ZPV 1;  2M13 A;  4O71 A;  2DVV A;  5BT5 A;  4XY9 A;  5FE8 A;  2FFW A;  5E3D A;  4UYE A;  4Q0N A;  3JVK A;  4YYJ A;  4PCI A;  5AD2 A;  3FEH A;  4N4F A;  3U5L A;  5A5R A;  4YY6 A;  4BW4 A;  4IOO A;  2CKL B;  4WZ2 A;  5C89 A;  5CS8 A;  3JVM A;  5AME A;  3ZPV E;  5HM0 A;  2F42 A;  3UVY A;  3D1D A;  5C7N A;  4HXS A;  2RO1 A;  4QC3 A;  5LVQ A;  3O7A A;  5EPR A;  2D9E A;  4B7Y C;  5EK9 A;  4ZC9 A;  2FUU A;  4NR9 A;  4QY4 A;  4MEP A;  1Z6U A;  3HMF A;  5CGP A;  2E3K A;  5EP7 A;  3KV5 A;  2LGL A;  2RNW A;  3L1Z B;  4R7E A;  4QSW A;  4E96 A;  2YUC A;  3MUK A;  1G25 A;  5DKC A;  4NRA A;  4QB3 A;  4AYC B;  4C9Z A;  3RTR B;  4FIP A;  4IC2 A;  5DFB A;  5IID A;  4YBS A;  1WEN A;  3LQI A;  3MQM A;  4NR6 A;  4YAD A;  3D1B A;  5EWH A;  5DFC A;  1RMD A;  5ENF A;  3JVL A;  4GB0 A;  3ZVY A;  5E9Y A;  4FO9 A;  4MEQ A;  5EQ1 A;  5KTX A;  4GNG A;  4HXO A;  5TDR A;  5F3A A;  2M6M A;  1N72 A;  3U5P A;  3Q1D A;  5E3G A;  4MR5 A;  2VNF A;  4ZDT A;  4HBX A;  2JMD A;  4MR4 A;  3PUQ A;  4O72 A;  5TB6 A;  2I50 A;  2FSA A;  3DAI A;  4TYL A;  4TTE A;  4IR4 A;  4CUR A;  5FE2 A;  4LZ2 A;  1F68 A;  1WEW A;  1DCQ A;  4BW2 A;  2MNY A;  5DX4 A;  3HMH A;  4F52 B;  1HYJ A;  5ENC A;  3P5O A;  5E9L A;  2QIC A;  2KYU A;  2G4A A;  4I7B A;  4O75 A;  5A85 A;  3O35 A;  1E4U A;  5C85 A;  2VPB A;  3Q2F A;  3D7C A;  3GG3 A;  3SHB A;  4PS5 A;  4Z0O A;  4QSX A;  4WA6 A;  3FAO A;  1PUO A;  5EI4 A;  4P5O B;  4NRC A;  3SOW A;  4AKI A;  3ASL A;  5SVI B;  5ENG A;  5CFW A;  1WEV A;  5TAB A;  5CQT A;  2RI7 A;  4C66 A;  4YYH A;  2LRI C;  5C13 A;  5KTU A;  5ENJ A;  5FER A;  2KIZ A;  5BT3 A;  5SVX A;  3LXJ A;  4RVR A;  4A9K A;  2MKE A;  3RCW A;  5AIU A;  5FE1 A;  4TT4 A;  4YYK A;  2WP2 A;  5HFR A;  5FG5 A;  4A9N A;  4PKL A;  3SVF A;  4NS5 A;  4BW3 A;  2I8N A;  4NYW A;  1JOC A;  2M1R A;  5G05 B;  5D3L A;  5FBX A;  4QF3 A;  4KV1 A;  3FKM X;  4YAX A;  4AKH A;  2E6S A;  5F2P A;  2M3H A;  3DDT A;  4CFL A;  5I29 A;  4AKN A;  5IGL A;  3N9Q A;  4A0C D;  4Q0O A;  3O70 A;  4QNS A;  5LJ2 A;  5LJ0 A;  3LVQ E;  3T9K A;  4YY4 A;  5KH3 A;  3S91 A;  5D24 A;  4QBM A;  5DW2 A;  4MSX A;  4QEV A;  4L7X A;  2P57 A;  2L85 A;  2LSP B;  4KV4 A;  5CP5 A;  5DLZ A;  2E7O A;  4HXN A;  3O33 A;  5CQA A;  5I88 A;  4CLB A;  2YW5 A;  2ECV A;  2PNX A;  2ECN A;  4TQN A;  2ECW A;  5LUU A;  2H60 A;  4V3L C;  2YHO A;  2OO1 A;  3M99 A;  4IR3 A;  3I2D A;  2D82 A;  3MHS A;  4BHW A;  2R10 A;  5DYU A;  4O7E A;  3JVJ A;  5D26 A;  3UVD A;  1WFK A;  4LK9 A;  2G45 A;  4CUS A;  4NXJ A;  3LJU X;  3LRQ A;  2IQJ A;  5TRB A;  4MEO A;  3U5N A;  1IYM A;  2VPD A;  4IC3 A;  4UYG A;  1WEO A;  3K2J A;  4WZ3 B;  5DKA A;  4MR3 A;  4AVX A;  2DWW A;  2N9G A;  3UW9 A;  2B0O E;  4UP5 A;  5LJ1 A;  4N3W A;  5C4Q A;  3SVH A;  1K2F A;  2G6Q A;  2YU4 A;  5DY7 A;  4YH4 A;  4GND A;  5TDW A;  2MNZ A;  5CQ7 A;  4XY8 A;  5CY9 A;  3QZV A;  1VD4 A;  5HCL A;  1X4U A;  1Z2Q A;  5H1U A;  1F62 A;  2Y43 A;  5J3X A;  4ZUX U;  1JM4 B;  4DON A;  2ECT A;  5CQ4 A;  2RFJ A;  5CQ6 A;  2UZG A;  5FEY A;  4C67 A;  1T1H A;  4QYD A;  5DLX A;  2KGI A;  4UYF B;  2YUR A;  4S3O B;  1WEE A;  2YHN A;  4LRG A;  3ERR A;  3JUE A;  5L97 A;  4QSU A;  5H9M A;  1WGM A;  4A9I A;  4YYD A;  5F36 A;  5HRX A;  1JM7 A;  4N4G A;  2LXH C;  5EWW A;  5B79 A;  2H0D B;  4B86 C;  5G4S A;  4A9L A;  2LGK A;  1ZKR A;  4TKP B;  2RNX A;  4J0R A;  4Q6F A;  2MA5 A;  3IU5 A;  4BBQ A;  5ENI A;  5D3J A;  5I7Y A;  4XYA A;  4QF2 A;  3UV2 A;  5E73 A;  4PY6 A;  2L5U A;  2CSY A;  4O77 A;  5B75 A;  4W4U A;  4O7A A;  5AD3 A;  3NXB A;  3SOU A;  2DSM A;  4O7F A;  3I3J A;  5FH7 A;  4QSR A;  3UVW A;  5L98 A;  3KDE C;  4LKA A;  4QZS A;  5HQ7 A;  5LKZ A;  4LDF A;  2KKX A;  2YDW A;  5FFY A;  5HEL A;  5D0C A;  5HRV A;  5HQ6 A;  3HCT A;  3LQH A;  3MB3 A;  4OGI A;  5JG6 A;  4NR7 A;  4QUU A;  2G43 A;  4NR5 A;  4CFK A;  2PUY A;  5CU8 A;  4LC2 A;  2K16 A;  2ECJ A;  4UIZ A;  4V3K C;  2KRE A;  2DX8 A;  2BAY A;  4TS8 A;  3P1E A;  4IR5 A;  5EA1 A;  5IG6 A;  4WHW A;  4N4H A;  5CUG A;  4TT6 A;  5A5Q A;  5LKU A;  4FLP A;  2C2L A;  4UIU A;  5CTL A;  5ENE A;  4NQM A;  4ALG A;  2K1J A;  4QSP A;  4CUT A;  4YC9 A;  3PHD A;  4A9J A;  2YSM A;  5EV9 A;  3O36 A;  4UIW A;  5CQ5 A;  4PPE A;  5DYC A;  1WEM A;  3VKG A;  4OGJ A;  4Z1Q A;  3N9N A;  3SVG A;  4OGE A;  4XI1 A;  5I86 A;  2AN6 A;  2XOZ A;  4CUU A;  3S92 A;  3NG2 A;  5HEN A;  2YW8 A;  3EB6 A;  4Z93 A;  4UP0 A;  4AKG A;  3DPL R;  5G0F A;  4F1P A;  5A5N A;  3VKH A;  2LV9 A;  5C11 A;  5D1M B;  3SOX A;  4LYS A;  4R2Y A;  2D8S A;  5D3R A;  5A83 A;  5H1T A;  2E7N A;  5CUA A;  1CHC A;  4HXP A;  5EWD A;  5A5S A;  2MD8 C;  5L96 A;  4KCX A;  3UV5 A;  4O7C A;  4ZW1 A;  2Y1N A;  5B8D A;  3QZS A;  5DW1 A;  4CUP A;  2XOC A;  1X0J A;  4IOR A;  4IOQ A;  4LR6 A;  4A9O A;  4IR6 A;  5A5P A;  5DIN A;  5II2 A;  2LAU A;  1LDJ B;  4MEN A;  5II1 A;  4QYL A;  5FFV A;  5IGM A;  2GRC A;  5F1L A;  5KHM A;  2L43 A;  4TU4 A;  4WIV A;  2R0V A;  5CRM A;  4F3I A;  4A9M A;  4BJX A;  4BW1 A;  4HBY A;  2IDA A;  1EQF A;  3ZNI A;  5F61 A;  2CSV A;  4O76 A;  2KTB B;  2NXB A;  3Q2E A;  5CUB A;  2KWO A;  2LGG A;  3H7H A;  5C87 A;  4QR5 A;  4QC1 A;  2CRR A;  5D3P A;  5C8G A;  4TZ8 A;  4A49 A;  4CUQ A;  4S3O C;  1N87 A;  5HRW A;  2OUO A;  4ALH A;  2L84 A;  5EGU A;  2KFT A;  5I83 A;  2F6J A;  4FJC A;  4LYW A;  4A4C A;  2KGG A;  3FAN A;  3M63 A;  2DJA A;  1WE9 A;  2KWN A;  2KR4 A;  1U6G B;  4PTB A;  5ENB A;  4ZQL A;  1FP0 A;  3RPG C;  4NYV A;  4UIT A;  5D3T A;  4YYM A;  5CPE A;  5TCM A;  5B76 A;  2DVS A;  1WEU A;  2I7K A;  5ACY A;  3DWY A;  3GL6 A;  2VJE A;  4I7C A;  5LCW B;  5FB0 A;  2L80 A;  3ZVZ B;  3LVR E;  2VJF A;  4PCE A;  2MT5 A;  5I3L A;  5D1K B;  5F60 A;  1ZS5 A;  3MXF A;  4O74 A;  5A81 A;  4NR4 A;  5CQ3 A;  2KU3 A;  2DVQ A;  2MJV B;  5EWC A;  5AMF A;  5EYA F;  3LDY A;  5CUC A; 
#chains in the Genus database with same CATH homology
 5A7C A;  4UIX A;  2Y1M A;  3ONI A;  3IU6 A;  2RS9 B;  3LQJ A;  5A82 A;  5B78 A;  4J3I A;  2CKL A;  4YAB A;  5KH9 A;  4HXM A;  4GNF A;  2HDP A;  3UV4 A;  3RPG B;  5F25 A;  4YYG A;  3HME A;  5E9M A;  5IGK A;  2L0B A;  3N9O A;  5L8U A;  4XUA A;  4FK5 A;  3FL2 A;  4CL9 A;  4YK0 A;  5D1L B;  3HCS A;  2JMI A;  4J1P A;  5LKT A;  4NUC A;  5EIS A;  4YYN A;  2OXQ C;  2YT5 A;  5G4R A;  3N9P A;  2RSD A;  3P1F A;  5IGN A;  2YEM A;  2MD7 B;  1JM7 B;  5EPS A;  5EWV A;  4LJN A;  4GPJ A;  3MHH A;  3KNV A;  5ETB A;  3ZYU A;  1V87 A;  5EPB A;  4AUQ B;  4AYC A;  3AQA A;  2YEK A;  4QUT A;  3GV4 A;  4A4B A;  4HXR A;  1ZBD B;  4TT2 A;  3P1D A;  5FE3 A;  5F62 A;  2YQM A;  3U5O A;  4A9E A;  2F6N A;  4HXL A;  5LKX A;  5FE5 A;  1VYX A;  2YYN A;  4Z6I A;  5DBM A;  4LZS A;  5BT4 A;  1BOR A;  3DQV R;  4WZ0 A;  4NQN A;  5HQ5 A;  5EVA A;  4HXK A;  4UIY A;  2JRJ A;  2MIQ A;  4LAD B;  5FG4 A;  5F63 A;  5D7X A;  4CCG X;  4MVT A;  5TBN A;  4NR8 A;  3M62 A;  3P1C A;  3ZYQ A;  1WUG A;  4O78 A;  5CZG A;  4XUB A;  5KTW A;  2XEU A;  2DAT A;  5FE4 A;  4AP4 A;  5B77 A;  5FG6 A;  1X4J A;  5FB1 A;  5KO4 A;  2FUI A;  3EB5 A;  4TU6 A;  4X2I A;  1JSP B;  4Z6H A;  4NRB A;  2R0S A;  4OUF A;  5L8T A;  5FH6 A;  3LJW A;  4QEU A;  5I40 A;  2KWK A;  2L75 A;  2YRE A;  1XWH A;  4LLB A;  5EU1 A;  2MUM A;  5FE7 A;  2EOD A;  5G04 B;  2DKW A;  3QZT A;  4TZ2 A;  2YQL A;  5E9V A;  4R8P K;  5HEM A;  2YYR A;  5ENH A;  4HBV A;  5DYA A;  3MUL A;  4QSS A;  1WUM A;  4YBT A;  5HJC A;  5COI A;  3L1X A;  5FFW A;  2QIZ A;  2LQ6 A;  2C2V S;  2LXP C;  2WP1 A;  2OSS A;  4NUD A;  5CQ8 A;  5I89 A;  2ECI A;  4CA1 A;  1MM2 A;  5FE9 A;  1WIL A;  2XB1 A;  4HBW A;  4Y03 A;  5EM3 A;  5D25 A;  5I7X A;  1E6I A;  2VPE A;  5E7D A;  5I1Q A;  3N9L A;  3TLP A;  5FDZ A;  5JWM A;  1MM3 A;  1VFY A;  2JMJ A;  5F5Z A;  2VP7 A;  2EGP A;  4YH3 A;  2K4D A;  3U5K A;  5DKD A;  3T6R A;  3G0J A;  2MA6 A;  4UIV A;  2HYE D;  4Z1S A;  5HFQ A;  5E9I A;  2L5E A;  2YQD A;  2EA6 A;  4NN2 A;  4YBM A;  5D3N A;  3AAD A;  4A9F A;  5L99 A;  3HCU A;  5CUD A;  1HYI A;  5DKH A;  3KV6 A;  2CT2 A;  5KH7 A;  3L11 A;  5J0D A;  5H1V A;  3C6W A;  3T7L A;  2M85 A;  3VK6 A;  1DVP A;  1LDK C;  5FE6 A;  5ETD A;  4QR3 A;  5IBN A;  4MR6 A;  5KU3 A;  5E74 A;  5EIC A;  3G0L A;  4WHU A;  3HTK C;  4O64 A;  2CSZ A;  5AIT A;  5F1H A;  4O70 A;  5FH8 A;  3IHP A;  4J0S A;  1WEQ A;  4LYI A;  5E9K A;  3O37 A;  3UVX A;  1FBV A;  5FE0 A;  1X4I A;  4GNE A;  3V43 A;  1Z60 A;  3ZTG A;  3N9M A;  4YAT A;  5LVR A;  4UI9 B;  4I7D A;  4UYD A;  5DYX A;  4O7B A;  5A5O A;  2ZET C;  5H85 A;  5E0R A;  4YYI A;  3U5M A;  2E6R A;  4UYF A;  4QSV A;  4NUE A;  1WIM A;  2RNY A;  2LDR A;  3KQI A;  4X3G A;  4L58 A;  2YSJ A;  2KWJ A;  4QSQ A;  4N4I A;  3O34 A;  2LN0 A;  2KE1 A;  2DVR A;  2NAA A;  3PUR A;  2ECG A;  2LGV A;  4QST A;  5D3S A;  5JI8 A;  2K17 A;  5CUE A;  2QJ0 A;  3MB4 A;  5CRZ A;  4QEW A;  2VPG A;  2YEL A;  4LZR A;  2VJE B;  5D3H A;  5HLS A;  5I80 A;  4UYH A;  2H0D A;  3U5J A;  4QR4 A;  1WES A;  2R0Y A;  4NYX A;  5K29 A;  2VJF B;  5DFD A;  4A9H A;  1WEP A;  3C5K A;  3ZPV 1;  4O71 A;  2DVV A;  5BT5 A;  4XY9 A;  5FE8 A;  5E3D A;  4UYE A;  4Q0N A;  3JVK A;  4YYJ A;  4PCI A;  5AD2 A;  4N4F A;  3U5L A;  5A5R A;  4YY6 A;  4BW4 A;  4IOO A;  2CKL B;  4WZ2 A;  5C89 A;  5CS8 A;  3JVM A;  5AME A;  3ZPV E;  5HM0 A;  2F42 A;  3UVY A;  5C7N A;  4HXS A;  2RO1 A;  4QC3 A;  5LVQ A;  3O7A A;  5EPR A;  2D9E A;  4B7Y C;  5EK9 A;  4ZC9 A;  2FUU A;  4NR9 A;  4QY4 A;  4MEP A;  1Z6U A;  3HMF A;  5CGP A;  2E3K A;  5EP7 A;  3KV5 A;  2LGL A;  2RNW A;  3L1Z B;  4R7E A;  4QSW A;  4E96 A;  2YUC A;  3MUK A;  1G25 A;  5DKC A;  4NRA A;  4QB3 A;  4AYC B;  4C9Z A;  3RTR B;  4FIP A;  4IC2 A;  5DFB A;  5IID A;  4YBS A;  1WEN A;  3LQI A;  3MQM A;  4NR6 A;  4YAD A;  5EWH A;  5DFC A;  1RMD A;  5ENF A;  3JVL A;  4GB0 A;  3ZVY A;  5E9Y A;  4FO9 A;  4MEQ A;  5EQ1 A;  5KTX A;  4GNG A;  4HXO A;  5TDR A;  5F3A A;  2M6M A;  1N72 A;  3U5P A;  5E3G A;  4MR5 A;  2VNF A;  4ZDT A;  4HBX A;  2JMD A;  4MR4 A;  3PUQ A;  4O72 A;  5TB6 A;  2I50 A;  2FSA A;  3DAI A;  4TYL A;  4TTE A;  4IR4 A;  4CUR A;  5FE2 A;  4LZ2 A;  1F68 A;  1WEW A;  1HYJ A;  4BW2 A;  2MNY A;  5DX4 A;  3HMH A;  4F52 B;  5ENC A;  3P5O A;  5E9L A;  2QIC A;  2KYU A;  2G4A A;  4I7B A;  4O75 A;  5A85 A;  3O35 A;  1E4U A;  5C85 A;  2VPB A;  3Q2F A;  3D7C A;  3GG3 A;  3SHB A;  4PS5 A;  4QSX A;  4WA6 A;  5EI4 A;  4P5O B;  4NRC A;  3SOW A;  3ASL A;  5ENG A;  5CFW A;  1WEV A;  5TAB A;  5CQT A;  2RI7 A;  4C66 A;  4YYH A;  2LRI C;  5C13 A;  5KTU A;  5ENJ A;  5FER A;  2KIZ A;  5BT3 A;  3LXJ A;  4RVR A;  4A9K A;  3RCW A;  5AIU A;  5FE1 A;  4TT4 A;  4YYK A;  2WP2 A;  5HFR A;  5FG5 A;  4A9N A;  4PKL A;  3SVF A;  4NS5 A;  4BW3 A;  2I8N A;  4NYW A;  1JOC A;  2M1R A;  5G05 B;  5D3L A;  5FBX A;  4QF3 A;  4KV1 A;  3FKM X;  4YAX A;  2M3H A;  2E6S A;  5F2P A;  4CFL A;  5I29 A;  4AKN A;  5IGL A;  3N9Q A;  4A0C D;  4Q0O A;  3O70 A;  4QNS A;  5LJ2 A;  5LJ0 A;  4YY4 A;  5KH3 A;  3S91 A;  5D24 A;  4QBM A;  5DW2 A;  4MSX A;  4QEV A;  4L7X A;  2L85 A;  2LSP B;  4KV4 A;  5CP5 A;  5DLZ A;  2E7O A;  4HXN A;  3O33 A;  5CQA A;  5I88 A;  4CLB A;  2YW5 A;  2ECV A;  2PNX A;  2ECN A;  4TQN A;  2ECW A;  5LUU A;  2H60 A;  4V3L C;  2YHO A;  2OO1 A;  3M99 A;  4IR3 A;  3I2D A;  2D82 A;  3MHS A;  4BHW A;  2R10 A;  5DYU A;  4O7E A;  3JVJ A;  5D26 A;  3UVD A;  1WFK A;  4LK9 A;  2G45 A;  4CUS A;  4NXJ A;  3LRQ A;  5TRB A;  4MEO A;  3U5N A;  1IYM A;  2VPD A;  4IC3 A;  4UYG A;  1WEO A;  3K2J A;  4WZ3 B;  5DKA A;  4MR3 A;  4AVX A;  2DWW A;  2N9G A;  3UW9 A;  4UP5 A;  5LJ1 A;  4N3W A;  5C4Q A;  3SVH A;  1K2F A;  2G6Q A;  2YU4 A;  5DY7 A;  4YH4 A;  4GND A;  5TDW A;  2MNZ A;  5CQ7 A;  4XY8 A;  5CY9 A;  3QZV A;  1VD4 A;  5HCL A;  1X4U A;  1Z2Q A;  5H1U A;  1F62 A;  2Y43 A;  5J3X A;  4ZUX U;  1JM4 B;  4DON A;  2ECT A;  5CQ4 A;  2RFJ A;  5CQ6 A;  2UZG A;  5FEY A;  4C67 A;  1T1H A;  4QYD A;  5DLX A;  2KGI A;  4UYF B;  2YUR A;  4S3O B;  1WEE A;  2YHN A;  4LRG A;  5L97 A;  4QSU A;  5H9M A;  1WGM A;  4A9I A;  4YYD A;  5F36 A;  5HRX A;  1JM7 A;  4N4G A;  2LXH C;  5EWW A;  5B79 A;  2H0D B;  4B86 C;  5G4S A;  4A9L A;  2LGK A;  4TKP B;  2RNX A;  4J0R A;  4Q6F A;  2MA5 A;  3IU5 A;  4BBQ A;  5ENI A;  5D3J A;  5I7Y A;  4XYA A;  4QF2 A;  3UV2 A;  5E73 A;  4PY6 A;  2L5U A;  2CSY A;  4O77 A;  5B75 A;  4W4U A;  4O7A A;  5AD3 A;  3NXB A;  3SOU A;  4O7F A;  3I3J A;  5FH7 A;  4QSR A;  3UVW A;  5L98 A;  4LKA A;  4QZS A;  5HQ7 A;  5LKZ A;  4LDF A;  2YDW A;  5FFY A;  5HEL A;  5D0C A;  5HRV A;  5HQ6 A;  3HCT A;  3LQH A;  3MB3 A;  4OGI A;  5JG6 A;  4NR7 A;  4QUU A;  2G43 A;  4NR5 A;  4CFK A;  2PUY A;  5CU8 A;  4LC2 A;  2K16 A;  2ECJ A;  4UIZ A;  4V3K C;  2KRE A;  2DX8 A;  2BAY A;  4TS8 A;  3P1E A;  4IR5 A;  5EA1 A;  5IG6 A;  4WHW A;  4N4H A;  5CUG A;  4TT6 A;  5A5Q A;  5LKU A;  4FLP A;  2C2L A;  4UIU A;  5CTL A;  5ENE A;  4NQM A;  4ALG A;  2K1J A;  4QSP A;  4CUT A;  4YC9 A;  3PHD A;  4A9J A;  2YSM A;  5EV9 A;  3O36 A;  4UIW A;  5CQ5 A;  4PPE A;  5DYC A;  1WEM A;  4OGJ A;  4Z1Q A;  3N9N A;  3SVG A;  4XI1 A;  5I86 A;  2AN6 A;  4CUU A;  3S92 A;  3NG2 A;  5HEN A;  2YW8 A;  3EB6 A;  4Z93 A;  4UP0 A;  3DPL R;  5G0F A;  5A5N A;  2LV9 A;  5C11 A;  5D1M B;  3SOX A;  4LYS A;  4R2Y A;  2D8S A;  5D3R A;  5A83 A;  5H1T A;  2E7N A;  5CUA A;  1CHC A;  4HXP A;  5EWD A;  5A5S A;  2MD8 C;  5L96 A;  4KCX A;  3UV5 A;  4O7C A;  4ZW1 A;  2Y1N A;  5B8D A;  3QZS A;  5DW1 A;  4CUP A;  1X0J A;  4IOR A;  4IOQ A;  4LR6 A;  4A9O A;  4IR6 A;  5A5P A;  5DIN A;  5II2 A;  1LDJ B;  4MEN A;  5II1 A;  4QYL A;  5FFV A;  5IGM A;  2GRC A;  5F1L A;  5KHM A;  2L43 A;  4TU4 A;  4WIV A;  2R0V A;  5CRM A;  4F3I A;  4A9M A;  4BJX A;  4BW1 A;  4HBY A;  2IDA A;  1EQF A;  3ZNI A;  5F61 A;  4O76 A;  2KTB B;  2NXB A;  3Q2E A;  5CUB A;  2KWO A;  2LGG A;  5C87 A;  4QR5 A;  4QC1 A;  5D3P A;  5C8G A;  4TZ8 A;  4A49 A;  4CUQ A;  4S3O C;  1N87 A;  5HRW A;  2OUO A;  4ALH A;  2L84 A;  5EGU A;  2KFT A;  5I83 A;  2F6J A;  4FJC A;  4LYW A;  4A4C A;  2KGG A;  3M63 A;  1WE9 A;  2KWN A;  2KR4 A;  1U6G B;  4PTB A;  5ENB A;  4ZQL A;  1FP0 A;  3RPG C;  4NYV A;  4UIT A;  5D3T A;  4YYM A;  5CPE A;  5TCM A;  5B76 A;  2DVS A;  1WEU A;  2I7K A;  5ACY A;  3DWY A;  3GL6 A;  2VJE A;  4I7C A;  5LCW B;  5FB0 A;  2L80 A;  3ZVZ B;  2VJF A;  4PCE A;  2MT5 A;  5I3L A;  5D1K B;  5F60 A;  1ZS5 A;  3MXF A;  4O74 A;  5A81 A;  4NR4 A;  5CQ3 A;  2KU3 A;  2DVQ A;  2MJV B;  5EWC A;  5AMF A;  5EYA F;  5CUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...