4YATA

Crystal structure of trim24 phd-bromodomain complexed with n-(1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl)-4-methoxybenzene-1-sulfonamide (5b)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
173
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 173
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yatA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yatA01
4TT6A 5LJ1A 4OGIA 4TT4A 1WESA 4LYIA 2VPEA 3IU5A 4N4IA 3O34A 5CUEA 5FE7A 4QR4A 4LKAA 4O75A 2JMIA 2KREA 5DKCA 2KWOA 3LXJA 1U6GB 3HMHA 5I1QA 5IBNA 4O76A 4UITA 4YH3A 3P1CA 2ECTA 2MT5A 3SOUA 5DW1A 4LADB 4A0CD 4NRBA 4YYNA 5FE0A 5G05B 2AN6A 5ENBA 1RMDA 5TABA 4QC3A 3P1DA 5DKDA 4QZSA 2YSMA 3GV4A 4BW1A 5HQ6A 1X4IA 2JMDA 4O78A 4Z6IA 2YDWA 2WP2A 4NS5A 2YHOA 5CQ8A 4A9IA 4QSQA 4ZC9A 4YBSA 2KWJA 5KH9A 3ZPVE 2VJFB 2VPDA 4YY4A 5A5PA 4QSSA 3QZTA 4TU6A 3TLPA 5I86A 4ZDTA 4WZ3B 3ZNIA 5C11A 4CFLA 4LZ2A 5DX4A 4AUQB 3MB4A 5LJ0A 4CL9A 2NXBA 5FH7A 5EPSA 4FK5A 5CQ3A 4NR7A 4A9NA 1MM3A 2QIZA 2DX8A 5LKZA 5E74A 1WEUA 3G0JA 1F68A 3EB6A 4O72A 5CQAA 4BW2A 5L99A 4QEUA 2CSZA 4QBMA 4A9JA 4QYLA 4TTEA 4GB0A 3O70A 5I7XA 5K29A 3JVKA 3V43A 4S3OC 2R0VA 5ENEA 5LCWB 2CKLA 5DYCA 5B76A 5H1TA 4TYLA 4UIVA 3SHBA 5ENGA 1DVPA 5IGNA 5HRXA 4WA6A 2M6MA 4NUEA 5CUBA 5TDRA 5E9MA 4XYAA 5FFYA 1WUGA 3O36A 4BW4A 5TB6A 3C6WA 5ACYA 3P5OA 3DPLR 5FE6A 3N9OA 1E6IA 5FH8A 5CQTA 4CURA 4CUSA 2CSYA 3JVJA 5LKUA 2QJ0A 5HEMA 5HCLA 4MSXA 1N72A 4NYXA 1LDJB 5FE8A 4QSRA 4QSUA 4NYVA 4MR3A 5A5QA 5D3NA 1VYXA 4QNSA 5D3LA 4N3WA 4UYFB 1WEWA 5LJ2A 4UIXA 3G0LA 4BJXA 2LXPC 4QYDA 4CA1A 5C85A 2L80A 2OXQC 4IOQA 4GNGA 2DKWA 5KO4A 2YUCA 1MM2A 5L96A 2MA6A 4TS8A 5FB1A 2LV9A 4YYIA 1WUMA 5BT5A 5E9IA 5D1MB 4XI1A 1WENA 2LGKA 4R7EA 5FG4A 5H1VA 2H0DB 4J3IA 3HMFA 5L98A 4YYJA 3HMEA 4HBXA 2MD8C 5H85A 5COIA 4F3IA 5C4QA 2DVVA 5CQ4A 2Y1NA 2OO1A 5FE2A 4HBYA 2KWNA 5EWDA 4LDFA 5DW2A 4BHWA 3M99A 4PPEA 5D1LB 5A7CA 5FB0A 4IR4A 2XEUA 2ECIA 2L0BA 3ZVZB 4NRAA 4LYSA 4J0SA 4FLPA 3DAIA 2KTBB 5DINA 1WEMA 1WE9A 4WHWA 5A5NA 4A9KA 2MIQA 3M63A 4I7DA 5I3LA 2E7NA 2VJEB 3Q2EA 5CTLA 4NQMA 3T7LA 2GRCA 5I7YA 5ENIA 5F36A 4FIPA 4HXKA 5FERA 4QEVA 4OGJA 3UV5A 2EA6A 3T6RA 4XY8A 5E0RA 3AQAA 2E6SA 4Z1QA 3JVLA 4J1PA 3UW9A 5EWVA 4L7XA 3SVGA 1WEPA 1JM7B 1EQFA 4A9FA 4RVRA 5DFBA 5C7NA 5D0CA 2XB1A 4QSWA 4E96A 2KE1A 2RNYA 2L75A 5FBXA 5LKTA 2UZGA 3P1FA 5HQ7A 2ECGA 5A83A 5AD2A 5EA1A 5ENHA 3N9PA 4NXJA 4QC1A 5IGLA 5G04B 4L58A 4QSTA 2PNXA 5B75A 3U5NA 4YYKA 5FEYA 4LC2A 4BW3A 5KH3A 3S91A 5E9KA 4IR6A 4V3KC 5FFWA 5E73A 5KHMA 4AYCA 4TU4A 4X2IA 5D1KB 4MR4A 3UVDA 4A49A 5DKHA 4PTBA 4PKLA 5TCMA 4CFKA 1IYMA 5C13A 4MR6A 4C9ZA 2DWWA 4TZ8A 2FSAA 5CP5A 4MEPA 5B79A 4UP0A 5E7DA 3LQHA 3ZYQA 2RSDA 4UIWA 5CU8A 2KGIA 5DKAA 5CUGA 5CGPA 2OSSA 4QR5A 4N4FA 3GG3A 3LJWA 5EPBA 3EB5A 5D25A 4A9OA 5CUCA 1ZBDB 2VPBA 2YELA 4WZ0A 2EGPA 2KGGA 1F62A 2YEMA 4YADA 5EU1A 2R0YA 2YHNA 2F6JA 4J0RA 5H1UA 5D3RA 2L43A 3PURA 4GNFA 4DONA 2L84A 4NR5A 3KV5A 4I7BA 4PCEA 4YYGA 4W4UA 4F52B 2RS9B 1WEVA 3D7CA 3N9LA 5II2A 2Y43A 1X0JA 5LVQA 4KCXA 3MULA 2G43A 5J3XA 4TQNA 4AP4A 5F25A 3U5OA 4ALGA 1N87A 4CUPA 2YW5A 1WILA 5F1HA 1FBVA 4QSPA 5FFVA 1CHCA 2KYUA 4IC2A 5FG6A 2K17A 2YURA 3MHSA 4NYWA 5EICA 5DFCA 3MHHA 5I89A 5FE1A 5C89A 5CFWA 4Z6HA 4KV4A 2E6RA 4HBVA 4MR5A 2YW8A 2RNWA 2YU4A 4A9LA 2D8SA 2CKLB 4YABA 3IU6A 5JI8A 3SVHA 3O33A 4A9HA 3ZPV1 1Z2QA 4O7FA 4O77A 5A85A 4IORA 1LDKC 5F3AA 3KV6A 4Q6FA 5ENFA 4NN2A 4QSVA 4AKNA 5EV9A 5D3TA 2VPGA 2VP7A 4UIUA 4O7BA 5IGMA 1T1HA 3NXBA 2KFTA 5CUAA 5HFRA 3MQMA 1X4UA 3HCSA 4N4GA 5D3HA 4HXPA 4WHUA 2OUOA 4PCIA 2KWKA 3GL6A 4HXMA 5AMEA 2ECVA 2L85A 2BAYA 5E9LA 3ZYUA 5DYAA 3ASLA 3ONIA 5HELA 5I83A 4NR6A 4QR3A 2N9GA 4MVTA 5AMFA 5BT4A 5I80A 5EYAF 5D3JA 5JG6A 2R0SA 4P5OB 5KTXA 2ZETC 5B77A 5LKXA 1V87A 2DVRA 5II1A 5F5ZA 3DWYA 4HXSA 4PS5A 4YATA 5C87A 5KU3A 1VFYA 2MNZA 4LLBA 2F6NA 1HYJA 2ECJA 4NR4A 3O35A 5KTWA 4QUTA 5ENCA 5E9YA 1E4UA 4A9EA 2YSJA 2R10A 4GNEA 4CUTA 4XUAA 4LJNA 3QZSA 4X3GA 2LRIC 3N9MA 5DLZA 3L1ZB 2YQMA 5DYXA 5HQ5A 5E3GA 5A5RA 3U5PA 1X4JA 2DVSA 3O37A 3UV2A 5H9MA 1ZS5A 4O64A 4NR8A 5LUUA 4ZW1A 4QUUA 5CRZA 5TDWA 2CT2A 4Z1SA 3L11A 4BBQA 2K1JA 5HLSA 5G0FA 3SVFA 3I3JA 3UVWA 2M1RA 3O7AA 2KIZA 5EK9A 4UYDA 2FUUA 2MA5A 4R8PK 4QEWA 5IG6A 5F2PA 3L1XA 2C2LA 4S3OB 5A81A 4O7CA 3LQJA 5EWWA 2ECWA 5EWCA 5L8TA 4O70A 2E7OA 5BT3A 5B8DA 3MUKA 1WEEA 1WFKA 4NUDA 4MEQA 3RPGB 4V3LC 4HXLA 4Y03A 5D24A 5DLXA 4UI9B 2RI7A 4NR9A 2MJVB 5I29A 2LXHC 3U5JA 3IHPA 3U5LA 5ETBA 2LGLA 2YREA 3Q2FA 2QICA 2VNFA 5TRBA 5EM3A 4ZUXU 4UIZA 2EODA 3C5KA 2KR4A 5AIUA 3ZTGA 1Z60A 3KQIA 2K16A 2I8NA 2FUIA 4FO9A 5DY7A 4B7YC 5J0DA 2VJFA 4CUUA 3NG2A 4UIYA 3I2DA 4GPJA 2LSPB 5A5SA 4TKPB 4TZ2A 4YBMA 2G6QA 2KU3A 5FG5A 5AITA 5F62A 4LR6A 3P1EA 4YYDA 3UVYA 5C8GA 2YQLA 4LK9A 1XWHA 4HXRA 5DBMA 3PHDA 2YYNA 5EVAA 5I88A 2ECNA 2Y1MA 4UP5A 2M3HA 5JWMA 4Z93A 4YYHA 2K4DA 3K2JA 4R2YA 4MENA 5EQ1A 1JSPB 2H60A 4FJCA 4AYCB 4YC9A 4QF2A 3N9NA 5HENA 4NQNA 4LZRA 4UYGA 2DVQA 4WIVA 5HM0A 5KH7A 5CQ5A 3LQIA 5F1LA 2LN0A 4GNDA 1FP0A 5CQ7A 4O7AA 4QB3A 4XY9A 5HRWA 4YAXA 5EISA 3U5MA 3MXFA 5CRMA 4C67A 4IC3A 4UYEA 2I7KA 4KV1A 3HCUA 5D26A 4WZ2A 4QF3A 3RCWA 5DFDA 3HTKC 5CY9A 4A9MA 5HRVA 5F63A 4LZSA 3RTRB 5HFQA 4TT2A 4IOOA 4IR3A 5AD3A 5EP7A 3KNVA 4A4BA 2YYRA 2D9EA 3UVXA 2NAAA 4I7CA 3RPGC 2E3KA 2G45A 3M62A 5B78A 5FH6A 4UYFA 3QZVA 1WEQA 4AVXA 5HJCA 4Q0OA 5EWHA 2I50A 5ETDA 5FE5A 2IDAA 2D82A 4YBTA 5KTUA 2LGVA 5FDZA 2JMJA 4O7EA 4YY6A 3SOWA 1WEOA 2F42A 1WIMA 3FKMX 5ENJA 5F61A 3VK6A 4QY4A 4MEOA 2H0DA 5A82A 5IGKA 5DYUA 4ZQLA 5I40A 4QSXA 3JVMA 3U5KA 2MUMA 5EI4A 4O74A 2WP1A 5D3SA 5E3DA 4NUCA 3ZVYA 5G4SA 5IIDA 2HDPA 4NRCA 2C2VS 2RO1A 5L97A 5CS8A 4PY6A 4ALHA 5CUDA 4CUQA 1JM4B 2L5UA 5L8UA 2DATA 1Z6UA 4HXOA 5FE4A 3AADA 1WGMA 3SOXA 5F60A 3DQVR 4A4CA 4HXNA 5G4RA 1BORA 3N9QA 5A5OA 4YK0A 4YYMA 2YQDA 2VJEA 2G4AA 2HYED 3UV4A 2LGGA 4IR5A 2L5EA 5CZGA 4UYHA 5LVRA 4XUBA 4YH4A 2LDRA 4Q0NA 3PUQA 4OUFA 2YEKA 1JM7A 2RNXA 1K2FA 2M85A 3MB3A 5D3PA 1JOCA 5TBNA 1HYIA 2LQ6A 2RFJA 4N4HA 4O71A 4LYWA 3S92A 2JRJA 3HCTA 3FL2A 5FE3A 5E9VA 4CLBA 2MNYA 1VD4A 4CCGX 2YT5A 4HBWA 4B86C 4LRGA 5EGUA 5FE9A 5EPRA 2MD7B 5D7XA 2PUYA 5CPEA 4C66A 1G25A 5CQ6A 3LRQA
chains in the Genus database with same CATH superfamily
4TT6A 5LJ1A 3FANA 4OGIA 4TT4A 1WESA 4LYIA 2VPEA 3IU5A 4N4IA 3O34A 5CUEA 5FE7A 4QR4A 4LKAA 4O75A 2JMIA 2KREA 5DKCA 2KWOA 3LXJA 1U6GB 2IQJA 3HMHA 5I1QA 5IBNA 4O76A 4UITA 4YH3A 3P1CA 2ECTA 2MT5A 5SVXA 5DW1A 3SOUA 4LADB 4A0CD 4NRBA 4YYNA 5FE0A 2L7PA 3LVQE 5G05B 2AN6A 2EXUA 5ENBA 1RMDA 5TABA 4QC3A 3P1DA 5DKDA 4QZSA 2YSMA 3GV4A 4BW1A 5HQ6A 1X4IA 2JMDA 4O78A 4Z6IA 2YDWA 2WP2A 4NS5A 2YHOA 5CQ8A 4A9IA 2E61A 4QSQA 4ZC9A 4YBSA 2KWJA 5KH9A 3ZPVE 2VJFB 2VPDA 4YY4A 5A5PA 4QSSA 3QZTA 4TU6A 3TLPA 5I86A 2EGMA 4WZ3B 4ZDTA 3ZNIA 5C11A 4CFLA 4LZ2A 5DX4A 4AUQB 3MB4A 5LJ0A 4CL9A 2NXBA 3KDEC 5FH7A 5EPSA 4FK5A 5CQ3A 4NR7A 4A9NA 1MM3A 2QIZA 2D8UA 2DX8A 5LKZA 5E74A 1WEUA 3G0JA 1F68A 3EB6A 4O72A 5CQAA 4BW2A 5L99A 4QEUA 2CSZA 4QBMA 4A9JA 4QYLA 4TTEA 4GB0A 3O70A 5I7XA 5K29A 3JVKA 3V43A 4S3OC 2R0VA 5ENEA 5LCWB 2CKLA 5DYCA 2DJAA 5B76A 3O47A 5H1TA 4TYLA 4UIVA 3SHBA 5ENGA 1DVPA 5IGNA 5HRXA 4WA6A 2M6MA 4NUEA 5CUBA 5TDRA 5E9MA 4XYAA 5FFYA 1WUGA 3O36A 4BW4A 5TB6A 3C6WA 5ACYA 3P5OA 3DPLR 5FE6A 3N9OA 1E6IA 5FH8A 5CQTA 4CURA 4CUSA 2CSYA 3JVJA 5LKUA 2QJ0A 5HEMA 5HCLA 4MSXA 1N72A 4OGEA 4NYXA 1LDJB 5FE8A 4QSRA 4QSUA 4NYVA 4MR3A 5A5QA 5D3NA 1VYXA 4QNSA 5D3LA 4N3WA 1ZKRA 4UYFB 5LJ2A 4UIXA 3G0LA 4BJXA 1WEWA 4QYDA 2LXPC 4CA1A 5C85A 2L80A 2OXQC 4IOQA 4GNGA 2DKWA 5KO4A 2YUCA 3FJUB 1MM2A 5L96A 2MA6A 4TS8A 5FB1A 2LV9A 4YYIA 1WUMA 5BT5A 5E9IA 5D1MB 2JUNA 4XI1A 3H7HA 1WENA 2LGKA 4R7EA 5FG4A 5H1VA 2H0DB 4J3IA 3HMFA 5L98A 4YYJA 3HMEA 4HBXA 2MD8C 5H85A 5COIA 4F3IA 5C4QA 2DVVA 5CQ4A 2CRWA 2Y1NA 2OO1A 5FE2A 4HBYA 4H9DA 2KWNA 5EWDA 4LDFA 5DW2A 4BHWA 3M99A 4PPEA 5D1LB 5A7CA 5FB0A 4IR4A 2XEUA 2ECIA 2L0BA 3ZVZB 4NRAA 4LYSA 4J0SA 4FLPA 3DAIA 2KTBB 2FD4A 5DINA 1WEMA 1WE9A 4WHWA 5A5NA 4A9KA 2MIQA 3M63A 4I7DA 5I3LA 2E7NA 2VJEB 5B78A 3Q2EA 5CTLA 4NQMA 3T7LA 2GRCA 5I7YA 5ENIA 5F36A 4FIPA 4HXKA 5FERA 4QEVA 4OGJA 3UV5A 2EA6A 3T6RA 4XY8A 5E0RA 3AQAA 4AKIA 4Z0OA 2E6SA 2XOYA 4Z1QA 3JVLA 4J1PA 3UW9A 5EWVA 4L7XA 3SVGA 1WEPA 1JM7B 1EQFA 4A9FA 4RVRA 5DFBA 5C7NA 5D0CA 2XB1A 4QSWA 4E96A 2KE1A 2RNYA 4AKGA 2L75A 5FBXA 5LKTA 2UZGA 3P1FA 5HQ7A 2ECGA 5A83A 5AD2A 5EA1A 5ENHA 3N9PA 4NXJA 4QC1A 5IGLA 5G04B 4L58A 3LVRE 4QSTA 2PNXA 5SVYA 5B75A 3U5NA 4YYKA 5FEYA 4LC2A 4BW3A 5KH3A 4O62A 3S91A 5E9KA 4IR6A 4V3KC 5FFWA 5E73A 5KHMA 4AYCA 4TU4A 4X2IA 5D1KB 4MR4A 3UVDA 4A49A 5DKHA 4PTBA 4PKLA 5TCMA 4CFKA 3DDTA 1IYMA 5C13A 2LAUA 4MR6A 4C9ZA 2DWWA 4TZ8A 2FSAA 5CP5A 4MEPA 5B79A 4UP0A 5E7DA 3LQHA 3ZYQA 2RSDA 4UIWA 5CU8A 2KGIA 2XOCA 3LJUX 5DKAA 5CUGA 5CGPA 2OSSA 4QR5A 4N4FA 3GG3A 3LJWA 5EPBA 3EB5A 4OGCA 5D25A 4A9OA 5CUCA 1ZBDB 2FFWA 2VPBA 2YELA 4WZ0A 2EGPA 2KGGA 1F62A 5K3QA 3E2DA 2YEMA 4YADA 5EU1A 2R0YA 2YHNA 2F6JA 4J0RA 5H1UA 5D3RA 2L43A 3PURA 4GNFA 4DONA 2L84A 4NR5A 3KV5A 4I7BA 4PCEA 4YYGA 4W4UA 4F52B 2RS9B 1WEVA 3D7CA 3N9LA 5II2A 2Y43A 1X0JA 5LVQA 4KCXA 3MULA 2G43A 5J3XA 4TQNA 4AP4A 5F25A 3U5OA 4ALGA 1N87A 4CUPA 2YW5A 1WILA 5F1HA 1FBVA 4QSPA 5FFVA 1CHCA 2KYUA 4IC2A 5FG6A 2K17A 2YURA 3MHSA 4NYWA 5EICA 5DFCA 3MHHA 5I89A 5FE1A 5C89A 5CFWA 4Z6HA 4KV4A 2E6RA 4HBVA 4MR5A 2YW8A 2RNWA 2YU4A 4A9LA 2D8SA 3DWDA 2CKLB 4YABA 3IU6A 5JI8A 3SVHA 3O33A 4A9HA 3ZPV1 1Z2QA 4O7FA 4O77A 5A85A 4IORA 1LDKC 2OWAA 5F3AA 3KV6A 4Q6FA 5ENFA 4NN2A 4QSVA 4AKNA 5EV9A 5D3TA 2VPGA 2VP7A 4UIUA 4O7BA 5IGMA 1T1HA 3NXBA 2KFTA 5CUAA 5HFRA 3MQMA 1X4UA 1PUOA 3HCSA 4N4GA 5D3HA 4HXPA 4WHUA 2OUOA 4PCIA 2KWKA 3GL6A 4HXMA 5AMEA 2ECVA 2L85A 2BAYA 5E9LA 3D1BA 3ZYUA 5DYAA 3ASLA 3ONIA 5HELA 5I83A 4NR6A 3FM8C 4QR3A 2N9GA 4MVTA 5AMFA 5BT4A 5I80A 5EYAF 5D3JA 5JG6A 2R0SA 4P5OB 5KTXA 2ZETC 5B77A 5LKXA 1V87A 2DVRA 5II1A 5F5ZA 3DWYA 4HXSA 4PS5A 4YATA 5C87A 5KU3A 1VFYA 2MNZA 4LLBA 2F6NA 1HYJA 2ECJA 4NR4A 2B0OE 3O35A 5KTWA 4QUTA 5ENCA 5E9YA 1E4UA 4A9EA 2YSJA 2R10A 4GNEA 4CUTA 4XUAA 4LJNA 3FEHA 3QZSA 4X3GA 2DSMA 2LRIC 2CONA 3N9MA 5DLZA 3L1ZB 2YQMA 5DYXA 5HQ5A 5E3GA 5A5RA 3U5PA 1X4JA 2DVSA 3O37A 3UV2A 2KKXA 2MKEA 5H9MA 1ZS5A 4O64A 4NR8A 5LUUA 4ZW1A 4QUUA 5CRZA 5TDWA 5SVIA 2CT2A 4Z1SA 3L11A 4BBQA 2K1JA 5HLSA 5G0FA 3SVFA 3I3JA 3UVWA 2M1RA 3O7AA 2KIZA 5EK9A 4UYDA 2FUUA 2MA5A 4R8PK 4QEWA 3JUEA 5IG6A 5F2PA 3L1XA 2C2LA 4S3OB 5A81A 4O7CA 3LQJA 5EWWA 2ECWA 5EWCA 5L8TA 4O70A 2E7OA 5BT3A 1DCQA 3T9KA 3MUKA 5B8DA 1WEEA 1WFKA 4AI6A 4NUDA 4MEQA 3RPGB 4V3LC 4HXLA 4Y03A 5D24A 5DLXA 4UI9B 2RI7A 4NR9A 2MJVB 5I29A 2LXHC 3U5JA 3IHPA 3U5LA 5ETBA 2LGLA 2YREA 3Q2FA 2QICA 2VNFA 5TRBA 5EM3A 4ZUXU 4UIZA 2EODA 3C5KA 2KR4A 5AIUA 3ZTGA 1Z60A 3KQIA 2K16A 2I8NA 2FUIA 4FO9A 5DY7A 4B7YC 5J0DA 2VJFA 4CUUA 3NG2A 4UIYA 3I2DA 4GPJA 2LSPB 5A5SA 4TKPB 4TZ2A 4YBMA 2G6QA 2XP0A 2KU3A 5FG5A 5AITA 5F62A 4LR6A 2YVRA 3P1EA 4YYDA 3UVYA 5C8GA 2YQLA 4LK9A 1XWHA 4HXRA 5DBMA 3PHDA 2YYNA 5EVAA 5I88A 2ECNA 2Y1MA 4UP5A 2M3HA 5JWMA 4Z93A 4YYHA 2K4DA 3K2JA 4R2YA 4MENA 5EQ1A 1JSPB 2H60A 4FJCA 4AYCB 4YC9A 4QF2A 3N9NA 5HENA 4NQNA 4LZRA 4UYGA 2DVQA 4WIVA 5HM0A 3ERRA 5KH7A 5CQ5A 3LQIA 5F1LA 2LN0A 4GNDA 1FP0A 5CQ7A 3Q1DA 3LDYA 4O7AA 4QB3A 4XY9A 5HRWA 3M7KA 4YAXA 5EISA 3U5MA 3MXFA 5CRMA 4C67A 4IC3A 4UYEA 2I7KA 4KV1A 3HCUA 5D26A 4WZ2A 4QF3A 3RCWA 2KKYA 5DFDA 3HTKC 5CY9A 4A9MA 5HRVA 5F63A 4LZSA 3RTRB 5HFQA 4TT2A 4QQ4A 4IOOA 4IR3A 5AD3A 2M13A 5EP7A 3KNVA 4Z0RA 4A4BA 2YYRA 2D9EA 3UVXA 2NAAA 2JM3A 4I7CA 2E3KA 4AKHA 2G45A 2P57A 3M62A 3RPGC 5FH6A 4UYFA 3QZVA 1WEQA 4AVXA 5HJCA 4Q0OA 5EWHA 2I50A 5ETDA 5FE5A 2IDAA 2D82A 4YBTA 3D1DA 5KTUA 2LGVA 5FDZA 2JMJA 4O7EA 4YY6A 3SOWA 1WEOA 2F42A 1WIMA 3FKMX 5ENJA 5F61A 3VK6A 4QY4A 4MEOA 2H0DA 5A82A 5IGKA 5DYUA 4ZQLA 5I40A 4QSXA 3JVMA 3U5KA 2MUMA 5EI4A 2EJNA 4O74A 2WP1A 5D3SA 5E3DA 4NUCA 3ZVYA 5G4SA 5IIDA 2HDPA 4NRCA 2C2VS 2RO1A 5L97A 5CS8A 4PY6A 4ALHA 3MDBC 5CUDA 4CUQA 1JM4B 2L5UA 5L8UA 2DATA 1Z6UA 4HXOA 2XOZA 5FE4A 3AADA 1WGMA 3PLWA 3SOXA 5F60A 3DQVR 4A4CA 4HXNA 5G4RA 1BORA 3N9QA 5A5OA 4YK0A 4YYMA 2YQDA 2VJEA 2G4AA 2HYED 3UV4A 2LGGA 4IR5A 2L5EA 1MBMA 5CZGA 4UYHA 5LVRA 4XUBA 4YH4A 2LDRA 4Q0NA 3PUQA 3VKGA 4OUFA 3FAOA 4F1PA 2YEKA 1JM7A 2RNXA 1K2FA 2M85A 3MB3A 5D3PA 1JOCA 5TBNA 1HYIA 2LQ6A 2RFJA 4N4HA 4O71A 4LYWA 3S92A 2JRJA 3HCTA 3FL2A 5FE3A 5E9VA 4CLBA 2MNYA 1VD4A 4CCGX 2YT5A 4HBWA 4B86C 4LRGA 5EGUA 5FE9A 5EPRA 2CSVA 2CRRA 5D7XA 2MD7B 2RR4A 2PUYA 3VKHA 5CPEA 5SVIB 4C66A 1G25A 5CQ6A 3SUBA 3LRQA
chains in the Genus database with same CATH topology
4TT6A 5LJ1A 4OGIA 4TT4A 1WESA 4LYIA 2VPEA 3IU5A 4N4IA 3O34A 5CUEA 5FE7A 4QR4A 4LKAA 4O75A 2JMIA 2KREA 5DKCA 2KWOA 3LXJA 1U6GB 3HMHA 5I1QA 5IBNA 4O76A 4UITA 4YH3A 3P1CA 2ECTA 2MT5A 3SOUA 5DW1A 4LADB 4A0CD 4NRBA 4YYNA 5FE0A 5G05B 2AN6A 5ENBA 1RMDA 5TABA 4QC3A 3P1DA 5DKDA 4QZSA 2YSMA 3GV4A 4BW1A 5HQ6A 1X4IA 2JMDA 4O78A 4Z6IA 2YDWA 2WP2A 4NS5A 2YHOA 5CQ8A 4A9IA 4QSQA 4ZC9A 4YBSA 2KWJA 5KH9A 3ZPVE 2VJFB 2VPDA 4YY4A 5A5PA 4QSSA 3QZTA 4TU6A 3TLPA 5I86A 4ZDTA 4WZ3B 3ZNIA 5C11A 4CFLA 4LZ2A 5DX4A 4AUQB 3MB4A 5LJ0A 4CL9A 2NXBA 5FH7A 5EPSA 4FK5A 5CQ3A 4NR7A 4A9NA 1MM3A 2QIZA 2DX8A 5LKZA 5E74A 1WEUA 3G0JA 1F68A 3EB6A 4O72A 5CQAA 4BW2A 5L99A 4QEUA 2CSZA 4QBMA 4A9JA 4QYLA 4TTEA 4GB0A 3O70A 5I7XA 5K29A 3JVKA 3V43A 4S3OC 2R0VA 5ENEA 5LCWB 2CKLA 5DYCA 5B76A 5H1TA 4TYLA 4UIVA 3SHBA 5ENGA 1DVPA 5IGNA 5HRXA 4WA6A 2M6MA 4NUEA 5CUBA 5TDRA 5E9MA 4XYAA 5FFYA 1WUGA 3O36A 4BW4A 5TB6A 3C6WA 5ACYA 3P5OA 3DPLR 5FE6A 3N9OA 1E6IA 5FH8A 5CQTA 4CURA 4CUSA 2CSYA 3JVJA 5LKUA 2QJ0A 5HEMA 5HCLA 4MSXA 1N72A 4NYXA 1LDJB 5FE8A 4QSRA 4QSUA 4NYVA 4MR3A 5A5QA 5D3NA 1VYXA 4QNSA 5D3LA 4N3WA 4UYFB 1WEWA 5LJ2A 4UIXA 3G0LA 4BJXA 2LXPC 4QYDA 4CA1A 5C85A 2L80A 2OXQC 4IOQA 4GNGA 2DKWA 5KO4A 2YUCA 1MM2A 5L96A 2MA6A 4TS8A 5FB1A 2LV9A 4YYIA 1WUMA 5BT5A 5E9IA 5D1MB 4XI1A 1WENA 2LGKA 4R7EA 5FG4A 5H1VA 2H0DB 4J3IA 3HMFA 5L98A 4YYJA 3HMEA 4HBXA 2MD8C 5H85A 5COIA 4F3IA 5C4QA 2DVVA 5CQ4A 2Y1NA 2OO1A 5FE2A 4HBYA 2KWNA 5EWDA 4LDFA 5DW2A 4BHWA 3M99A 4PPEA 5D1LB 5A7CA 5FB0A 4IR4A 2XEUA 2ECIA 2L0BA 3ZVZB 4NRAA 4LYSA 4J0SA 4FLPA 3DAIA 2KTBB 5DINA 1WEMA 1WE9A 4WHWA 5A5NA 4A9KA 2MIQA 3M63A 4I7DA 5I3LA 2E7NA 2VJEB 3Q2EA 5CTLA 4NQMA 3T7LA 2GRCA 5I7YA 5ENIA 5F36A 4FIPA 4HXKA 5FERA 4QEVA 4OGJA 3UV5A 2EA6A 3T6RA 4XY8A 5E0RA 3AQAA 2E6SA 4Z1QA 3JVLA 4J1PA 3UW9A 5EWVA 4L7XA 3SVGA 1WEPA 1JM7B 1EQFA 4A9FA 4RVRA 5DFBA 5C7NA 5D0CA 2XB1A 4QSWA 4E96A 2KE1A 2RNYA 2L75A 5FBXA 5LKTA 2UZGA 3P1FA 5HQ7A 2ECGA 5A83A 5AD2A 5EA1A 5ENHA 3N9PA 4NXJA 4QC1A 5IGLA 5G04B 4L58A 4QSTA 2PNXA 5B75A 3U5NA 4YYKA 5FEYA 4LC2A 4BW3A 5KH3A 3S91A 5E9KA 4IR6A 4V3KC 5FFWA 5E73A 5KHMA 4AYCA 4TU4A 4X2IA 5D1KB 4MR4A 3UVDA 4A49A 5DKHA 4PTBA 4PKLA 5TCMA 4CFKA 1IYMA 5C13A 4MR6A 4C9ZA 2DWWA 4TZ8A 2FSAA 5CP5A 4MEPA 5B79A 4UP0A 5E7DA 3LQHA 3ZYQA 2RSDA 4UIWA 5CU8A 2KGIA 5DKAA 5CUGA 5CGPA 2OSSA 4QR5A 4N4FA 3GG3A 3LJWA 5EPBA 3EB5A 5D25A 4A9OA 5CUCA 1ZBDB 2VPBA 2YELA 4WZ0A 2EGPA 2KGGA 1F62A 2YEMA 4YADA 5EU1A 2R0YA 2YHNA 2F6JA 4J0RA 5H1UA 5D3RA 2L43A 3PURA 4GNFA 4DONA 2L84A 4NR5A 3KV5A 4I7BA 4PCEA 4YYGA 4W4UA 4F52B 2RS9B 1WEVA 3D7CA 3N9LA 5II2A 2Y43A 1X0JA 5LVQA 4KCXA 3MULA 2G43A 5J3XA 4TQNA 4AP4A 5F25A 3U5OA 4ALGA 1N87A 4CUPA 2YW5A 1WILA 5F1HA 1FBVA 4QSPA 5FFVA 1CHCA 2KYUA 4IC2A 5FG6A 2K17A 2YURA 3MHSA 4NYWA 5EICA 5DFCA 3MHHA 5I89A 5FE1A 5C89A 5CFWA 4Z6HA 4KV4A 2E6RA 4HBVA 4MR5A 2YW8A 2RNWA 2YU4A 4A9LA 2D8SA 2CKLB 4YABA 3IU6A 5JI8A 3SVHA 3O33A 4A9HA 3ZPV1 1Z2QA 4O7FA 4O77A 5A85A 4IORA 1LDKC 5F3AA 3KV6A 4Q6FA 5ENFA 4NN2A 4QSVA 4AKNA 5EV9A 5D3TA 2VPGA 2VP7A 4UIUA 4O7BA 5IGMA 1T1HA 3NXBA 2KFTA 5CUAA 5HFRA 3MQMA 1X4UA 3HCSA 4N4GA 5D3HA 4HXPA 4WHUA 2OUOA 4PCIA 2KWKA 3GL6A 4HXMA 5AMEA 2ECVA 2L85A 2BAYA 5E9LA 3ZYUA 5DYAA 3ASLA 3ONIA 5HELA 5I83A 4NR6A 4QR3A 2N9GA 4MVTA 5AMFA 5BT4A 5I80A 5EYAF 5D3JA 5JG6A 2R0SA 4P5OB 5KTXA 2ZETC 5B77A 5LKXA 1V87A 2DVRA 5II1A 5F5ZA 3DWYA 4HXSA 4PS5A 4YATA 5C87A 5KU3A 1VFYA 2MNZA 4LLBA 2F6NA 1HYJA 2ECJA 4NR4A 3O35A 5KTWA 4QUTA 5ENCA 5E9YA 1E4UA 4A9EA 2YSJA 2R10A 4GNEA 4CUTA 4XUAA 4LJNA 3QZSA 4X3GA 2LRIC 3N9MA 5DLZA 3L1ZB 2YQMA 5DYXA 5HQ5A 5E3GA 5A5RA 3U5PA 1X4JA 2DVSA 3O37A 3UV2A 5H9MA 1ZS5A 4O64A 4NR8A 5LUUA 4ZW1A 4QUUA 5CRZA 5TDWA 2CT2A 4Z1SA 3L11A 4BBQA 2K1JA 5HLSA 5G0FA 3SVFA 3I3JA 3UVWA 2M1RA 3O7AA 2KIZA 5EK9A 4UYDA 2FUUA 2MA5A 4R8PK 4QEWA 5IG6A 5F2PA 3L1XA 2C2LA 4S3OB 5A81A 4O7CA 3LQJA 5EWWA 2ECWA 5EWCA 5L8TA 4O70A 2E7OA 5BT3A 5B8DA 3MUKA 1WEEA 1WFKA 4NUDA 4MEQA 3RPGB 4V3LC 4HXLA 4Y03A 5D24A 5DLXA 4UI9B 2RI7A 4NR9A 2MJVB 5I29A 2LXHC 3U5JA 3IHPA 3U5LA 5ETBA 2LGLA 2YREA 3Q2FA 2QICA 2VNFA 5TRBA 5EM3A 4ZUXU 4UIZA 2EODA 3C5KA 2KR4A 5AIUA 3ZTGA 1Z60A 3KQIA 2K16A 2I8NA 2FUIA 4FO9A 5DY7A 4B7YC 5J0DA 2VJFA 4CUUA 3NG2A 4UIYA 3I2DA 4GPJA 2LSPB 5A5SA 4TKPB 4TZ2A 4YBMA 2G6QA 2KU3A 5FG5A 5AITA 5F62A 4LR6A 3P1EA 4YYDA 3UVYA 5C8GA 2YQLA 4LK9A 1XWHA 4HXRA 5DBMA 3PHDA 2YYNA 5EVAA 5I88A 2ECNA 2Y1MA 4UP5A 2M3HA 5JWMA 4Z93A 4YYHA 2K4DA 3K2JA 4R2YA 4MENA 5EQ1A 1JSPB 2H60A 4FJCA 4AYCB 4YC9A 4QF2A 3N9NA 5HENA 4NQNA 4LZRA 4UYGA 2DVQA 4WIVA 5HM0A 5KH7A 5CQ5A 3LQIA 5F1LA 2LN0A 4GNDA 1FP0A 5CQ7A 4O7AA 4QB3A 4XY9A 5HRWA 4YAXA 5EISA 3U5MA 3MXFA 5CRMA 4C67A 4IC3A 4UYEA 2I7KA 4KV1A 3HCUA 5D26A 4WZ2A 4QF3A 3RCWA 5DFDA 3HTKC 5CY9A 4A9MA 5HRVA 5F63A 4LZSA 3RTRB 5HFQA 4TT2A 4IOOA 4IR3A 5AD3A 5EP7A 3KNVA 4A4BA 2YYRA 2D9EA 3UVXA 2NAAA 4I7CA 3RPGC 2E3KA 2G45A 3M62A 5B78A 5FH6A 4UYFA 3QZVA 1WEQA 4AVXA 5HJCA 4Q0OA 5EWHA 2I50A 5ETDA 5FE5A 2IDAA 2D82A 4YBTA 5KTUA 2LGVA 5FDZA 2JMJA 4O7EA 4YY6A 3SOWA 1WEOA 2F42A 1WIMA 3FKMX 5ENJA 5F61A 3VK6A 4QY4A 4MEOA 2H0DA 5A82A 5IGKA 5DYUA 4ZQLA 5I40A 4QSXA 3JVMA 3U5KA 2MUMA 5EI4A 4O74A 2WP1A 5D3SA 5E3DA 4NUCA 3ZVYA 5G4SA 5IIDA 2HDPA 4NRCA 2C2VS 2RO1A 5L97A 5CS8A 4PY6A 4ALHA 5CUDA 4CUQA 1JM4B 2L5UA 5L8UA 2DATA 1Z6UA 4HXOA 5FE4A 3AADA 1WGMA 3SOXA 5F60A 3DQVR 4A4CA 4HXNA 5G4RA 1BORA 3N9QA 5A5OA 4YK0A 4YYMA 2YQDA 2VJEA 2G4AA 2HYED 3UV4A 2LGGA 4IR5A 2L5EA 5CZGA 4UYHA 5LVRA 4XUBA 4YH4A 2LDRA 4Q0NA 3PUQA 4OUFA 2YEKA 1JM7A 2RNXA 1K2FA 2M85A 3MB3A 5D3PA 1JOCA 5TBNA 1HYIA 2LQ6A 2RFJA 4N4HA 4O71A 4LYWA 3S92A 2JRJA 3HCTA 3FL2A 5FE3A 5E9VA 4CLBA 2MNYA 1VD4A 4CCGX 2YT5A 4HBWA 4B86C 4LRGA 5EGUA 5FE9A 5EPRA 2MD7B 5D7XA 2PUYA 5CPEA 4C66A 1G25A 5CQ6A 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TT6 A;  5LJ1 A;  4OGI A;  4TT4 A;  1WES A;  4LYI A;  2VPE A;  3IU5 A;  4N4I A;  3O34 A;  5CUE A;  5FE7 A;  4QR4 A;  4LKA A;  4O75 A;  2JMI A;  2KRE A;  5DKC A;  2KWO A;  3LXJ A;  1U6G B;  3HMH A;  5I1Q A;  5IBN A;  4O76 A;  4UIT A;  4YH3 A;  3P1C A;  2ECT A;  2MT5 A;  3SOU A;  5DW1 A;  4LAD B;  4A0C D;  4NRB A;  4YYN A;  5FE0 A;  5G05 B;  2AN6 A;  5ENB A;  1RMD A;  5TAB A;  4QC3 A;  3P1D A;  5DKD A;  4QZS A;  2YSM A;  3GV4 A;  4BW1 A;  5HQ6 A;  1X4I A;  2JMD A;  4O78 A;  4Z6I A;  2YDW A;  2WP2 A;  4NS5 A;  2YHO A;  5CQ8 A;  4A9I A;  4QSQ A;  4ZC9 A;  4YBS A;  2KWJ A;  5KH9 A;  3ZPV E;  2VJF B;  2VPD A;  4YY4 A;  5A5P A;  4QSS A;  3QZT A;  4TU6 A;  3TLP A;  5I86 A;  4ZDT A;  4WZ3 B;  3ZNI A;  5C11 A;  4CFL A;  4LZ2 A;  5DX4 A;  4AUQ B;  3MB4 A;  5LJ0 A;  4CL9 A;  2NXB A;  5FH7 A;  5EPS A;  4FK5 A;  5CQ3 A;  4NR7 A;  4A9N A;  1MM3 A;  2QIZ A;  2DX8 A;  5LKZ A;  5E74 A;  1WEU A;  3G0J A;  1F68 A;  3EB6 A;  4O72 A;  5CQA A;  4BW2 A;  5L99 A;  4QEU A;  2CSZ A;  4QBM A;  4A9J A;  4QYL A;  4TTE A;  4GB0 A;  3O70 A;  5I7X A;  5K29 A;  3JVK A;  3V43 A;  4S3O C;  2R0V A;  5ENE A;  5LCW B;  2CKL A;  5DYC A;  5B76 A;  5H1T A;  4TYL A;  4UIV A;  3SHB A;  5ENG A;  1DVP A;  5IGN A;  5HRX A;  4WA6 A;  2M6M A;  4NUE A;  5CUB A;  5TDR A;  5E9M A;  4XYA A;  5FFY A;  1WUG A;  3O36 A;  4BW4 A;  5TB6 A;  3C6W A;  5ACY A;  3P5O A;  3DPL R;  5FE6 A;  3N9O A;  1E6I A;  5FH8 A;  5CQT A;  4CUR A;  4CUS A;  2CSY A;  3JVJ A;  5LKU A;  2QJ0 A;  5HEM A;  5HCL A;  4MSX A;  1N72 A;  4NYX A;  1LDJ B;  5FE8 A;  4QSR A;  4QSU A;  4NYV A;  4MR3 A;  5A5Q A;  5D3N A;  1VYX A;  4QNS A;  5D3L A;  4N3W A;  4UYF B;  1WEW A;  5LJ2 A;  4UIX A;  3G0L A;  4BJX A;  2LXP C;  4QYD A;  4CA1 A;  5C85 A;  2L80 A;  2OXQ C;  4IOQ A;  4GNG A;  2DKW A;  5KO4 A;  2YUC A;  1MM2 A;  5L96 A;  2MA6 A;  4TS8 A;  5FB1 A;  2LV9 A;  4YYI A;  1WUM A;  5BT5 A;  5E9I A;  5D1M B;  4XI1 A;  1WEN A;  2LGK A;  4R7E A;  5FG4 A;  5H1V A;  2H0D B;  4J3I A;  3HMF A;  5L98 A;  4YYJ A;  3HME A;  4HBX A;  2MD8 C;  5H85 A;  5COI A;  4F3I A;  5C4Q A;  2DVV A;  5CQ4 A;  2Y1N A;  2OO1 A;  5FE2 A;  4HBY A;  2KWN A;  5EWD A;  4LDF A;  5DW2 A;  4BHW A;  3M99 A;  4PPE A;  5D1L B;  5A7C A;  5FB0 A;  4IR4 A;  2XEU A;  2ECI A;  2L0B A;  3ZVZ B;  4NRA A;  4LYS A;  4J0S A;  4FLP A;  3DAI A;  2KTB B;  5DIN A;  1WEM A;  1WE9 A;  4WHW A;  5A5N A;  4A9K A;  2MIQ A;  3M63 A;  4I7D A;  5I3L A;  2E7N A;  2VJE B;  3Q2E A;  5CTL A;  4NQM A;  3T7L A;  2GRC A;  5I7Y A;  5ENI A;  5F36 A;  4FIP A;  4HXK A;  5FER A;  4QEV A;  4OGJ A;  3UV5 A;  2EA6 A;  3T6R A;  4XY8 A;  5E0R A;  3AQA A;  2E6S A;  4Z1Q A;  3JVL A;  4J1P A;  3UW9 A;  5EWV A;  4L7X A;  3SVG A;  1WEP A;  1JM7 B;  1EQF A;  4A9F A;  4RVR A;  5DFB A;  5C7N A;  5D0C A;  2XB1 A;  4QSW A;  4E96 A;  2KE1 A;  2RNY A;  2L75 A;  5FBX A;  5LKT A;  2UZG A;  3P1F A;  5HQ7 A;  2ECG A;  5A83 A;  5AD2 A;  5EA1 A;  5ENH A;  3N9P A;  4NXJ A;  4QC1 A;  5IGL A;  5G04 B;  4L58 A;  4QST A;  2PNX A;  5B75 A;  3U5N A;  4YYK A;  5FEY A;  4LC2 A;  4BW3 A;  5KH3 A;  3S91 A;  5E9K A;  4IR6 A;  4V3K C;  5FFW A;  5E73 A;  5KHM A;  4AYC A;  4TU4 A;  4X2I A;  5D1K B;  4MR4 A;  3UVD A;  4A49 A;  5DKH A;  4PTB A;  4PKL A;  5TCM A;  4CFK A;  1IYM A;  5C13 A;  4MR6 A;  4C9Z A;  2DWW A;  4TZ8 A;  2FSA A;  5CP5 A;  4MEP A;  5B79 A;  4UP0 A;  5E7D A;  3LQH A;  3ZYQ A;  2RSD A;  4UIW A;  5CU8 A;  2KGI A;  5DKA A;  5CUG A;  5CGP A;  2OSS A;  4QR5 A;  4N4F A;  3GG3 A;  3LJW A;  5EPB A;  3EB5 A;  5D25 A;  4A9O A;  5CUC A;  1ZBD B;  2VPB A;  2YEL A;  4WZ0 A;  2EGP A;  2KGG A;  1F62 A;  2YEM A;  4YAD A;  5EU1 A;  2R0Y A;  2YHN A;  2F6J A;  4J0R A;  5H1U A;  5D3R A;  2L43 A;  3PUR A;  4GNF A;  4DON A;  2L84 A;  4NR5 A;  3KV5 A;  4I7B A;  4PCE A;  4YYG A;  4W4U A;  4F52 B;  2RS9 B;  1WEV A;  3D7C A;  3N9L A;  5II2 A;  2Y43 A;  1X0J A;  5LVQ A;  4KCX A;  3MUL A;  2G43 A;  5J3X A;  4TQN A;  4AP4 A;  5F25 A;  3U5O A;  4ALG A;  1N87 A;  4CUP A;  2YW5 A;  1WIL A;  5F1H A;  1FBV A;  4QSP A;  5FFV A;  1CHC A;  2KYU A;  4IC2 A;  5FG6 A;  2K17 A;  2YUR A;  3MHS A;  4NYW A;  5EIC A;  5DFC A;  3MHH A;  5I89 A;  5FE1 A;  5C89 A;  5CFW A;  4Z6H A;  4KV4 A;  2E6R A;  4HBV A;  4MR5 A;  2YW8 A;  2RNW A;  2YU4 A;  4A9L A;  2D8S A;  2CKL B;  4YAB A;  3IU6 A;  5JI8 A;  3SVH A;  3O33 A;  4A9H A;  3ZPV 1;  1Z2Q A;  4O7F A;  4O77 A;  5A85 A;  4IOR A;  1LDK C;  5F3A A;  3KV6 A;  4Q6F A;  5ENF A;  4NN2 A;  4QSV A;  4AKN A;  5EV9 A;  5D3T A;  2VPG A;  2VP7 A;  4UIU A;  4O7B A;  5IGM A;  1T1H A;  3NXB A;  2KFT A;  5CUA A;  5HFR A;  3MQM A;  1X4U A;  3HCS A;  4N4G A;  5D3H A;  4HXP A;  4WHU A;  2OUO A;  4PCI A;  2KWK A;  3GL6 A;  4HXM A;  5AME A;  2ECV A;  2L85 A;  2BAY A;  5E9L A;  3ZYU A;  5DYA A;  3ASL A;  3ONI A;  5HEL A;  5I83 A;  4NR6 A;  4QR3 A;  2N9G A;  4MVT A;  5AMF A;  5BT4 A;  5I80 A;  5EYA F;  5D3J A;  5JG6 A;  2R0S A;  4P5O B;  5KTX A;  2ZET C;  5B77 A;  5LKX A;  1V87 A;  2DVR A;  5II1 A;  5F5Z A;  3DWY A;  4HXS A;  4PS5 A;  4YAT A;  5C87 A;  5KU3 A;  1VFY A;  2MNZ A;  4LLB A;  2F6N A;  1HYJ A;  2ECJ A;  4NR4 A;  3O35 A;  5KTW A;  4QUT A;  5ENC A;  5E9Y A;  1E4U A;  4A9E A;  2YSJ A;  2R10 A;  4GNE A;  4CUT A;  4XUA A;  4LJN A;  3QZS A;  4X3G A;  2LRI C;  3N9M A;  5DLZ A;  3L1Z B;  2YQM A;  5DYX A;  5HQ5 A;  5E3G A;  5A5R A;  3U5P A;  1X4J A;  2DVS A;  3O37 A;  3UV2 A;  5H9M A;  1ZS5 A;  4O64 A;  4NR8 A;  5LUU A;  4ZW1 A;  4QUU A;  5CRZ A;  5TDW A;  2CT2 A;  4Z1S A;  3L11 A;  4BBQ A;  2K1J A;  5HLS A;  5G0F A;  3SVF A;  3I3J A;  3UVW A;  2M1R A;  3O7A A;  2KIZ A;  5EK9 A;  4UYD A;  2FUU A;  2MA5 A;  4R8P K;  4QEW A;  5IG6 A;  5F2P A;  3L1X A;  2C2L A;  4S3O B;  5A81 A;  4O7C A;  3LQJ A;  5EWW A;  2ECW A;  5EWC A;  5L8T A;  4O70 A;  2E7O A;  5BT3 A;  5B8D A;  3MUK A;  1WEE A;  1WFK A;  4NUD A;  4MEQ A;  3RPG B;  4V3L C;  4HXL A;  4Y03 A;  5D24 A;  5DLX A;  4UI9 B;  2RI7 A;  4NR9 A;  2MJV B;  5I29 A;  2LXH C;  3U5J A;  3IHP A;  3U5L A;  5ETB A;  2LGL A;  2YRE A;  3Q2F A;  2QIC A;  2VNF A;  5TRB A;  5EM3 A;  4ZUX U;  4UIZ A;  2EOD A;  3C5K A;  2KR4 A;  5AIU A;  3ZTG A;  1Z60 A;  3KQI A;  2K16 A;  2I8N A;  2FUI A;  4FO9 A;  5DY7 A;  4B7Y C;  5J0D A;  2VJF A;  4CUU A;  3NG2 A;  4UIY A;  3I2D A;  4GPJ A;  2LSP B;  5A5S A;  4TKP B;  4TZ2 A;  4YBM A;  2G6Q A;  2KU3 A;  5FG5 A;  5AIT A;  5F62 A;  4LR6 A;  3P1E A;  4YYD A;  3UVY A;  5C8G A;  2YQL A;  4LK9 A;  1XWH A;  4HXR A;  5DBM A;  3PHD A;  2YYN A;  5EVA A;  5I88 A;  2ECN A;  2Y1M A;  4UP5 A;  2M3H A;  5JWM A;  4Z93 A;  4YYH A;  2K4D A;  3K2J A;  4R2Y A;  4MEN A;  5EQ1 A;  1JSP B;  2H60 A;  4FJC A;  4AYC B;  4YC9 A;  4QF2 A;  3N9N A;  5HEN A;  4NQN A;  4LZR A;  4UYG A;  2DVQ A;  4WIV A;  5HM0 A;  5KH7 A;  5CQ5 A;  3LQI A;  5F1L A;  2LN0 A;  4GND A;  1FP0 A;  5CQ7 A;  4O7A A;  4QB3 A;  4XY9 A;  5HRW A;  4YAX A;  5EIS A;  3U5M A;  3MXF A;  5CRM A;  4C67 A;  4IC3 A;  4UYE A;  2I7K A;  4KV1 A;  3HCU A;  5D26 A;  4WZ2 A;  4QF3 A;  3RCW A;  5DFD A;  3HTK C;  5CY9 A;  4A9M A;  5HRV A;  5F63 A;  4LZS A;  3RTR B;  5HFQ A;  4TT2 A;  4IOO A;  4IR3 A;  5AD3 A;  5EP7 A;  3KNV A;  4A4B A;  2YYR A;  2D9E A;  3UVX A;  2NAA A;  4I7C A;  3RPG C;  2E3K A;  2G45 A;  3M62 A;  5B78 A;  5FH6 A;  4UYF A;  3QZV A;  1WEQ A;  4AVX A;  5HJC A;  4Q0O A;  5EWH A;  2I50 A;  5ETD A;  5FE5 A;  2IDA A;  2D82 A;  4YBT A;  5KTU A;  2LGV A;  5FDZ A;  2JMJ A;  4O7E A;  4YY6 A;  3SOW A;  1WEO A;  2F42 A;  1WIM A;  3FKM X;  5ENJ A;  5F61 A;  3VK6 A;  4QY4 A;  4MEO A;  2H0D A;  5A82 A;  5IGK A;  5DYU A;  4ZQL A;  5I40 A;  4QSX A;  3JVM A;  3U5K A;  2MUM A;  5EI4 A;  4O74 A;  2WP1 A;  5D3S A;  5E3D A;  4NUC A;  3ZVY A;  5G4S A;  5IID A;  2HDP A;  4NRC A;  2C2V S;  2RO1 A;  5L97 A;  5CS8 A;  4PY6 A;  4ALH A;  5CUD A;  4CUQ A;  1JM4 B;  2L5U A;  5L8U A;  2DAT A;  1Z6U A;  4HXO A;  5FE4 A;  3AAD A;  1WGM A;  3SOX A;  5F60 A;  3DQV R;  4A4C A;  4HXN A;  5G4R A;  1BOR A;  3N9Q A;  5A5O A;  4YK0 A;  4YYM A;  2YQD A;  2VJE A;  2G4A A;  2HYE D;  3UV4 A;  2LGG A;  4IR5 A;  2L5E A;  5CZG A;  4UYH A;  5LVR A;  4XUB A;  4YH4 A;  2LDR A;  4Q0N A;  3PUQ A;  4OUF A;  2YEK A;  1JM7 A;  2RNX A;  1K2F A;  2M85 A;  3MB3 A;  5D3P A;  1JOC A;  5TBN A;  1HYI A;  2LQ6 A;  2RFJ A;  4N4H A;  4O71 A;  4LYW A;  3S92 A;  2JRJ A;  3HCT A;  3FL2 A;  5FE3 A;  5E9V A;  4CLB A;  2MNY A;  1VD4 A;  4CCG X;  2YT5 A;  4HBW A;  4B86 C;  4LRG A;  5EGU A;  5FE9 A;  5EPR A;  2MD7 B;  5D7X A;  2PUY A;  5CPE A;  4C66 A;  1G25 A;  5CQ6 A;  3LRQ A; 
#chains in the Genus database with same CATH topology
 4TT6 A;  5LJ1 A;  3FAN A;  4OGI A;  4TT4 A;  1WES A;  4LYI A;  2VPE A;  3IU5 A;  4N4I A;  3O34 A;  5CUE A;  5FE7 A;  4QR4 A;  4LKA A;  4O75 A;  2JMI A;  2KRE A;  5DKC A;  2KWO A;  3LXJ A;  1U6G B;  2IQJ A;  3HMH A;  5I1Q A;  5IBN A;  4O76 A;  4UIT A;  4YH3 A;  3P1C A;  2ECT A;  2MT5 A;  5SVX A;  5DW1 A;  3SOU A;  4LAD B;  4A0C D;  4NRB A;  4YYN A;  5FE0 A;  2L7P A;  3LVQ E;  5G05 B;  2AN6 A;  2EXU A;  5ENB A;  1RMD A;  5TAB A;  4QC3 A;  3P1D A;  5DKD A;  4QZS A;  2YSM A;  3GV4 A;  4BW1 A;  5HQ6 A;  1X4I A;  2JMD A;  4O78 A;  4Z6I A;  2YDW A;  2WP2 A;  4NS5 A;  2YHO A;  5CQ8 A;  4A9I A;  2E61 A;  4QSQ A;  4ZC9 A;  4YBS A;  2KWJ A;  5KH9 A;  3ZPV E;  2VJF B;  2VPD A;  4YY4 A;  5A5P A;  4QSS A;  3QZT A;  4TU6 A;  3TLP A;  5I86 A;  2EGM A;  4WZ3 B;  4ZDT A;  3ZNI A;  5C11 A;  4CFL A;  4LZ2 A;  5DX4 A;  4AUQ B;  3MB4 A;  5LJ0 A;  4CL9 A;  2NXB A;  3KDE C;  5FH7 A;  5EPS A;  4FK5 A;  5CQ3 A;  4NR7 A;  4A9N A;  1MM3 A;  2QIZ A;  2D8U A;  2DX8 A;  5LKZ A;  5E74 A;  1WEU A;  3G0J A;  1F68 A;  3EB6 A;  4O72 A;  5CQA A;  4BW2 A;  5L99 A;  4QEU A;  2CSZ A;  4QBM A;  4A9J A;  4QYL A;  4TTE A;  4GB0 A;  3O70 A;  5I7X A;  5K29 A;  3JVK A;  3V43 A;  4S3O C;  2R0V A;  5ENE A;  5LCW B;  2CKL A;  5DYC A;  2DJA A;  5B76 A;  3O47 A;  5H1T A;  4TYL A;  4UIV A;  3SHB A;  5ENG A;  1DVP A;  5IGN A;  5HRX A;  4WA6 A;  2M6M A;  4NUE A;  5CUB A;  5TDR A;  5E9M A;  4XYA A;  5FFY A;  1WUG A;  3O36 A;  4BW4 A;  5TB6 A;  3C6W A;  5ACY A;  3P5O A;  3DPL R;  5FE6 A;  3N9O A;  1E6I A;  5FH8 A;  5CQT A;  4CUR A;  4CUS A;  2CSY A;  3JVJ A;  5LKU A;  2QJ0 A;  5HEM A;  5HCL A;  4MSX A;  1N72 A;  4OGE A;  4NYX A;  1LDJ B;  5FE8 A;  4QSR A;  4QSU A;  4NYV A;  4MR3 A;  5A5Q A;  5D3N A;  1VYX A;  4QNS A;  5D3L A;  4N3W A;  1ZKR A;  4UYF B;  5LJ2 A;  4UIX A;  3G0L A;  4BJX A;  1WEW A;  4QYD A;  2LXP C;  4CA1 A;  5C85 A;  2L80 A;  2OXQ C;  4IOQ A;  4GNG A;  2DKW A;  5KO4 A;  2YUC A;  3FJU B;  1MM2 A;  5L96 A;  2MA6 A;  4TS8 A;  5FB1 A;  2LV9 A;  4YYI A;  1WUM A;  5BT5 A;  5E9I A;  5D1M B;  2JUN A;  4XI1 A;  3H7H A;  1WEN A;  2LGK A;  4R7E A;  5FG4 A;  5H1V A;  2H0D B;  4J3I A;  3HMF A;  5L98 A;  4YYJ A;  3HME A;  4HBX A;  2MD8 C;  5H85 A;  5COI A;  4F3I A;  5C4Q A;  2DVV A;  5CQ4 A;  2CRW A;  2Y1N A;  2OO1 A;  5FE2 A;  4HBY A;  4H9D A;  2KWN A;  5EWD A;  4LDF A;  5DW2 A;  4BHW A;  3M99 A;  4PPE A;  5D1L B;  5A7C A;  5FB0 A;  4IR4 A;  2XEU A;  2ECI A;  2L0B A;  3ZVZ B;  4NRA A;  4LYS A;  4J0S A;  4FLP A;  3DAI A;  2KTB B;  2FD4 A;  5DIN A;  1WEM A;  1WE9 A;  4WHW A;  5A5N A;  4A9K A;  2MIQ A;  3M63 A;  4I7D A;  5I3L A;  2E7N A;  2VJE B;  5B78 A;  3Q2E A;  5CTL A;  4NQM A;  3T7L A;  2GRC A;  5I7Y A;  5ENI A;  5F36 A;  4FIP A;  4HXK A;  5FER A;  4QEV A;  4OGJ A;  3UV5 A;  2EA6 A;  3T6R A;  4XY8 A;  5E0R A;  3AQA A;  4AKI A;  4Z0O A;  2E6S A;  2XOY A;  4Z1Q A;  3JVL A;  4J1P A;  3UW9 A;  5EWV A;  4L7X A;  3SVG A;  1WEP A;  1JM7 B;  1EQF A;  4A9F A;  4RVR A;  5DFB A;  5C7N A;  5D0C A;  2XB1 A;  4QSW A;  4E96 A;  2KE1 A;  2RNY A;  4AKG A;  2L75 A;  5FBX A;  5LKT A;  2UZG A;  3P1F A;  5HQ7 A;  2ECG A;  5A83 A;  5AD2 A;  5EA1 A;  5ENH A;  3N9P A;  4NXJ A;  4QC1 A;  5IGL A;  5G04 B;  4L58 A;  3LVR E;  4QST A;  2PNX A;  5SVY A;  5B75 A;  3U5N A;  4YYK A;  5FEY A;  4LC2 A;  4BW3 A;  5KH3 A;  4O62 A;  3S91 A;  5E9K A;  4IR6 A;  4V3K C;  5FFW A;  5E73 A;  5KHM A;  4AYC A;  4TU4 A;  4X2I A;  5D1K B;  4MR4 A;  3UVD A;  4A49 A;  5DKH A;  4PTB A;  4PKL A;  5TCM A;  4CFK A;  3DDT A;  1IYM A;  5C13 A;  2LAU A;  4MR6 A;  4C9Z A;  2DWW A;  4TZ8 A;  2FSA A;  5CP5 A;  4MEP A;  5B79 A;  4UP0 A;  5E7D A;  3LQH A;  3ZYQ A;  2RSD A;  4UIW A;  5CU8 A;  2KGI A;  2XOC A;  3LJU X;  5DKA A;  5CUG A;  5CGP A;  2OSS A;  4QR5 A;  4N4F A;  3GG3 A;  3LJW A;  5EPB A;  3EB5 A;  4OGC A;  5D25 A;  4A9O A;  5CUC A;  1ZBD B;  2FFW A;  2VPB A;  2YEL A;  4WZ0 A;  2EGP A;  2KGG A;  1F62 A;  5K3Q A;  3E2D A;  2YEM A;  4YAD A;  5EU1 A;  2R0Y A;  2YHN A;  2F6J A;  4J0R A;  5H1U A;  5D3R A;  2L43 A;  3PUR A;  4GNF A;  4DON A;  2L84 A;  4NR5 A;  3KV5 A;  4I7B A;  4PCE A;  4YYG A;  4W4U A;  4F52 B;  2RS9 B;  1WEV A;  3D7C A;  3N9L A;  5II2 A;  2Y43 A;  1X0J A;  5LVQ A;  4KCX A;  3MUL A;  2G43 A;  5J3X A;  4TQN A;  4AP4 A;  5F25 A;  3U5O A;  4ALG A;  1N87 A;  4CUP A;  2YW5 A;  1WIL A;  5F1H A;  1FBV A;  4QSP A;  5FFV A;  1CHC A;  2KYU A;  4IC2 A;  5FG6 A;  2K17 A;  2YUR A;  3MHS A;  4NYW A;  5EIC A;  5DFC A;  3MHH A;  5I89 A;  5FE1 A;  5C89 A;  5CFW A;  4Z6H A;  4KV4 A;  2E6R A;  4HBV A;  4MR5 A;  2YW8 A;  2RNW A;  2YU4 A;  4A9L A;  2D8S A;  3DWD A;  2CKL B;  4YAB A;  3IU6 A;  5JI8 A;  3SVH A;  3O33 A;  4A9H A;  3ZPV 1;  1Z2Q A;  4O7F A;  4O77 A;  5A85 A;  4IOR A;  1LDK C;  2OWA A;  5F3A A;  3KV6 A;  4Q6F A;  5ENF A;  4NN2 A;  4QSV A;  4AKN A;  5EV9 A;  5D3T A;  2VPG A;  2VP7 A;  4UIU A;  4O7B A;  5IGM A;  1T1H A;  3NXB A;  2KFT A;  5CUA A;  5HFR A;  3MQM A;  1X4U A;  1PUO A;  3HCS A;  4N4G A;  5D3H A;  4HXP A;  4WHU A;  2OUO A;  4PCI A;  2KWK A;  3GL6 A;  4HXM A;  5AME A;  2ECV A;  2L85 A;  2BAY A;  5E9L A;  3D1B A;  3ZYU A;  5DYA A;  3ASL A;  3ONI A;  5HEL A;  5I83 A;  4NR6 A;  3FM8 C;  4QR3 A;  2N9G A;  4MVT A;  5AMF A;  5BT4 A;  5I80 A;  5EYA F;  5D3J A;  5JG6 A;  2R0S A;  4P5O B;  5KTX A;  2ZET C;  5B77 A;  5LKX A;  1V87 A;  2DVR A;  5II1 A;  5F5Z A;  3DWY A;  4HXS A;  4PS5 A;  4YAT A;  5C87 A;  5KU3 A;  1VFY A;  2MNZ A;  4LLB A;  2F6N A;  1HYJ A;  2ECJ A;  4NR4 A;  2B0O E;  3O35 A;  5KTW A;  4QUT A;  5ENC A;  5E9Y A;  1E4U A;  4A9E A;  2YSJ A;  2R10 A;  4GNE A;  4CUT A;  4XUA A;  4LJN A;  3FEH A;  3QZS A;  4X3G A;  2DSM A;  2LRI C;  2CON A;  3N9M A;  5DLZ A;  3L1Z B;  2YQM A;  5DYX A;  5HQ5 A;  5E3G A;  5A5R A;  3U5P A;  1X4J A;  2DVS A;  3O37 A;  3UV2 A;  2KKX A;  2MKE A;  5H9M A;  1ZS5 A;  4O64 A;  4NR8 A;  5LUU A;  4ZW1 A;  4QUU A;  5CRZ A;  5TDW A;  5SVI A;  2CT2 A;  4Z1S A;  3L11 A;  4BBQ A;  2K1J A;  5HLS A;  5G0F A;  3SVF A;  3I3J A;  3UVW A;  2M1R A;  3O7A A;  2KIZ A;  5EK9 A;  4UYD A;  2FUU A;  2MA5 A;  4R8P K;  4QEW A;  3JUE A;  5IG6 A;  5F2P A;  3L1X A;  2C2L A;  4S3O B;  5A81 A;  4O7C A;  3LQJ A;  5EWW A;  2ECW A;  5EWC A;  5L8T A;  4O70 A;  2E7O A;  5BT3 A;  1DCQ A;  3T9K A;  3MUK A;  5B8D A;  1WEE A;  1WFK A;  4AI6 A;  4NUD A;  4MEQ A;  3RPG B;  4V3L C;  4HXL A;  4Y03 A;  5D24 A;  5DLX A;  4UI9 B;  2RI7 A;  4NR9 A;  2MJV B;  5I29 A;  2LXH C;  3U5J A;  3IHP A;  3U5L A;  5ETB A;  2LGL A;  2YRE A;  3Q2F A;  2QIC A;  2VNF A;  5TRB A;  5EM3 A;  4ZUX U;  4UIZ A;  2EOD A;  3C5K A;  2KR4 A;  5AIU A;  3ZTG A;  1Z60 A;  3KQI A;  2K16 A;  2I8N A;  2FUI A;  4FO9 A;  5DY7 A;  4B7Y C;  5J0D A;  2VJF A;  4CUU A;  3NG2 A;  4UIY A;  3I2D A;  4GPJ A;  2LSP B;  5A5S A;  4TKP B;  4TZ2 A;  4YBM A;  2G6Q A;  2XP0 A;  2KU3 A;  5FG5 A;  5AIT A;  5F62 A;  4LR6 A;  2YVR A;  3P1E A;  4YYD A;  3UVY A;  5C8G A;  2YQL A;  4LK9 A;  1XWH A;  4HXR A;  5DBM A;  3PHD A;  2YYN A;  5EVA A;  5I88 A;  2ECN A;  2Y1M A;  4UP5 A;  2M3H A;  5JWM A;  4Z93 A;  4YYH A;  2K4D A;  3K2J A;  4R2Y A;  4MEN A;  5EQ1 A;  1JSP B;  2H60 A;  4FJC A;  4AYC B;  4YC9 A;  4QF2 A;  3N9N A;  5HEN A;  4NQN A;  4LZR A;  4UYG A;  2DVQ A;  4WIV A;  5HM0 A;  3ERR A;  5KH7 A;  5CQ5 A;  3LQI A;  5F1L A;  2LN0 A;  4GND A;  1FP0 A;  5CQ7 A;  3Q1D A;  3LDY A;  4O7A A;  4QB3 A;  4XY9 A;  5HRW A;  3M7K A;  4YAX A;  5EIS A;  3U5M A;  3MXF A;  5CRM A;  4C67 A;  4IC3 A;  4UYE A;  2I7K A;  4KV1 A;  3HCU A;  5D26 A;  4WZ2 A;  4QF3 A;  3RCW A;  2KKY A;  5DFD A;  3HTK C;  5CY9 A;  4A9M A;  5HRV A;  5F63 A;  4LZS A;  3RTR B;  5HFQ A;  4TT2 A;  4QQ4 A;  4IOO A;  4IR3 A;  5AD3 A;  2M13 A;  5EP7 A;  3KNV A;  4Z0R A;  4A4B A;  2YYR A;  2D9E A;  3UVX A;  2NAA A;  2JM3 A;  4I7C A;  2E3K A;  4AKH A;  2G45 A;  2P57 A;  3M62 A;  3RPG C;  5FH6 A;  4UYF A;  3QZV A;  1WEQ A;  4AVX A;  5HJC A;  4Q0O A;  5EWH A;  2I50 A;  5ETD A;  5FE5 A;  2IDA A;  2D82 A;  4YBT A;  3D1D A;  5KTU A;  2LGV A;  5FDZ A;  2JMJ A;  4O7E A;  4YY6 A;  3SOW A;  1WEO A;  2F42 A;  1WIM A;  3FKM X;  5ENJ A;  5F61 A;  3VK6 A;  4QY4 A;  4MEO A;  2H0D A;  5A82 A;  5IGK A;  5DYU A;  4ZQL A;  5I40 A;  4QSX A;  3JVM A;  3U5K A;  2MUM A;  5EI4 A;  2EJN A;  4O74 A;  2WP1 A;  5D3S A;  5E3D A;  4NUC A;  3ZVY A;  5G4S A;  5IID A;  2HDP A;  4NRC A;  2C2V S;  2RO1 A;  5L97 A;  5CS8 A;  4PY6 A;  4ALH A;  3MDB C;  5CUD A;  4CUQ A;  1JM4 B;  2L5U A;  5L8U A;  2DAT A;  1Z6U A;  4HXO A;  2XOZ A;  5FE4 A;  3AAD A;  1WGM A;  3PLW A;  3SOX A;  5F60 A;  3DQV R;  4A4C A;  4HXN A;  5G4R A;  1BOR A;  3N9Q A;  5A5O A;  4YK0 A;  4YYM A;  2YQD A;  2VJE A;  2G4A A;  2HYE D;  3UV4 A;  2LGG A;  4IR5 A;  2L5E A;  1MBM A;  5CZG A;  4UYH A;  5LVR A;  4XUB A;  4YH4 A;  2LDR A;  4Q0N A;  3PUQ A;  3VKG A;  4OUF A;  3FAO A;  4F1P A;  2YEK A;  1JM7 A;  2RNX A;  1K2F A;  2M85 A;  3MB3 A;  5D3P A;  1JOC A;  5TBN A;  1HYI A;  2LQ6 A;  2RFJ A;  4N4H A;  4O71 A;  4LYW A;  3S92 A;  2JRJ A;  3HCT A;  3FL2 A;  5FE3 A;  5E9V A;  4CLB A;  2MNY A;  1VD4 A;  4CCG X;  2YT5 A;  4HBW A;  4B86 C;  4LRG A;  5EGU A;  5FE9 A;  5EPR A;  2CSV A;  2CRR A;  5D7X A;  2MD7 B;  2RR4 A;  2PUY A;  3VKH A;  5CPE A;  5SVI B;  4C66 A;  1G25 A;  5CQ6 A;  3SUB A;  3LRQ A; 
#chains in the Genus database with same CATH homology
 4TT6 A;  5LJ1 A;  4OGI A;  4TT4 A;  1WES A;  4LYI A;  2VPE A;  3IU5 A;  4N4I A;  3O34 A;  5CUE A;  5FE7 A;  4QR4 A;  4LKA A;  4O75 A;  2JMI A;  2KRE A;  5DKC A;  2KWO A;  3LXJ A;  1U6G B;  3HMH A;  5I1Q A;  5IBN A;  4O76 A;  4UIT A;  4YH3 A;  3P1C A;  2ECT A;  2MT5 A;  3SOU A;  5DW1 A;  4LAD B;  4A0C D;  4NRB A;  4YYN A;  5FE0 A;  5G05 B;  2AN6 A;  5ENB A;  1RMD A;  5TAB A;  4QC3 A;  3P1D A;  5DKD A;  4QZS A;  2YSM A;  3GV4 A;  4BW1 A;  5HQ6 A;  1X4I A;  2JMD A;  4O78 A;  4Z6I A;  2YDW A;  2WP2 A;  4NS5 A;  2YHO A;  5CQ8 A;  4A9I A;  4QSQ A;  4ZC9 A;  4YBS A;  2KWJ A;  5KH9 A;  3ZPV E;  2VJF B;  2VPD A;  4YY4 A;  5A5P A;  4QSS A;  3QZT A;  4TU6 A;  3TLP A;  5I86 A;  4ZDT A;  4WZ3 B;  3ZNI A;  5C11 A;  4CFL A;  4LZ2 A;  5DX4 A;  4AUQ B;  3MB4 A;  5LJ0 A;  4CL9 A;  2NXB A;  5FH7 A;  5EPS A;  4FK5 A;  5CQ3 A;  4NR7 A;  4A9N A;  1MM3 A;  2QIZ A;  2DX8 A;  5LKZ A;  5E74 A;  1WEU A;  3G0J A;  1F68 A;  3EB6 A;  4O72 A;  5CQA A;  4BW2 A;  5L99 A;  4QEU A;  2CSZ A;  4QBM A;  4A9J A;  4QYL A;  4TTE A;  4GB0 A;  3O70 A;  5I7X A;  5K29 A;  3JVK A;  3V43 A;  4S3O C;  2R0V A;  5ENE A;  5LCW B;  2CKL A;  5DYC A;  5B76 A;  5H1T A;  4TYL A;  4UIV A;  3SHB A;  5ENG A;  1DVP A;  5IGN A;  5HRX A;  4WA6 A;  2M6M A;  4NUE A;  5CUB A;  5TDR A;  5E9M A;  4XYA A;  5FFY A;  1WUG A;  3O36 A;  4BW4 A;  5TB6 A;  3C6W A;  5ACY A;  3P5O A;  3DPL R;  5FE6 A;  3N9O A;  1E6I A;  5FH8 A;  5CQT A;  4CUR A;  4CUS A;  2CSY A;  3JVJ A;  5LKU A;  2QJ0 A;  5HEM A;  5HCL A;  4MSX A;  1N72 A;  4NYX A;  1LDJ B;  5FE8 A;  4QSR A;  4QSU A;  4NYV A;  4MR3 A;  5A5Q A;  5D3N A;  1VYX A;  4QNS A;  5D3L A;  4N3W A;  4UYF B;  1WEW A;  5LJ2 A;  4UIX A;  3G0L A;  4BJX A;  2LXP C;  4QYD A;  4CA1 A;  5C85 A;  2L80 A;  2OXQ C;  4IOQ A;  4GNG A;  2DKW A;  5KO4 A;  2YUC A;  1MM2 A;  5L96 A;  2MA6 A;  4TS8 A;  5FB1 A;  2LV9 A;  4YYI A;  1WUM A;  5BT5 A;  5E9I A;  5D1M B;  4XI1 A;  1WEN A;  2LGK A;  4R7E A;  5FG4 A;  5H1V A;  2H0D B;  4J3I A;  3HMF A;  5L98 A;  4YYJ A;  3HME A;  4HBX A;  2MD8 C;  5H85 A;  5COI A;  4F3I A;  5C4Q A;  2DVV A;  5CQ4 A;  2Y1N A;  2OO1 A;  5FE2 A;  4HBY A;  2KWN A;  5EWD A;  4LDF A;  5DW2 A;  4BHW A;  3M99 A;  4PPE A;  5D1L B;  5A7C A;  5FB0 A;  4IR4 A;  2XEU A;  2ECI A;  2L0B A;  3ZVZ B;  4NRA A;  4LYS A;  4J0S A;  4FLP A;  3DAI A;  2KTB B;  5DIN A;  1WEM A;  1WE9 A;  4WHW A;  5A5N A;  4A9K A;  2MIQ A;  3M63 A;  4I7D A;  5I3L A;  2E7N A;  2VJE B;  3Q2E A;  5CTL A;  4NQM A;  3T7L A;  2GRC A;  5I7Y A;  5ENI A;  5F36 A;  4FIP A;  4HXK A;  5FER A;  4QEV A;  4OGJ A;  3UV5 A;  2EA6 A;  3T6R A;  4XY8 A;  5E0R A;  3AQA A;  2E6S A;  4Z1Q A;  3JVL A;  4J1P A;  3UW9 A;  5EWV A;  4L7X A;  3SVG A;  1WEP A;  1JM7 B;  1EQF A;  4A9F A;  4RVR A;  5DFB A;  5C7N A;  5D0C A;  2XB1 A;  4QSW A;  4E96 A;  2KE1 A;  2RNY A;  2L75 A;  5FBX A;  5LKT A;  2UZG A;  3P1F A;  5HQ7 A;  2ECG A;  5A83 A;  5AD2 A;  5EA1 A;  5ENH A;  3N9P A;  4NXJ A;  4QC1 A;  5IGL A;  5G04 B;  4L58 A;  4QST A;  2PNX A;  5B75 A;  3U5N A;  4YYK A;  5FEY A;  4LC2 A;  4BW3 A;  5KH3 A;  3S91 A;  5E9K A;  4IR6 A;  4V3K C;  5FFW A;  5E73 A;  5KHM A;  4AYC A;  4TU4 A;  4X2I A;  5D1K B;  4MR4 A;  3UVD A;  4A49 A;  5DKH A;  4PTB A;  4PKL A;  5TCM A;  4CFK A;  1IYM A;  5C13 A;  4MR6 A;  4C9Z A;  2DWW A;  4TZ8 A;  2FSA A;  5CP5 A;  4MEP A;  5B79 A;  4UP0 A;  5E7D A;  3LQH A;  3ZYQ A;  2RSD A;  4UIW A;  5CU8 A;  2KGI A;  5DKA A;  5CUG A;  5CGP A;  2OSS A;  4QR5 A;  4N4F A;  3GG3 A;  3LJW A;  5EPB A;  3EB5 A;  5D25 A;  4A9O A;  5CUC A;  1ZBD B;  2VPB A;  2YEL A;  4WZ0 A;  2EGP A;  2KGG A;  1F62 A;  2YEM A;  4YAD A;  5EU1 A;  2R0Y A;  2YHN A;  2F6J A;  4J0R A;  5H1U A;  5D3R A;  2L43 A;  3PUR A;  4GNF A;  4DON A;  2L84 A;  4NR5 A;  3KV5 A;  4I7B A;  4PCE A;  4YYG A;  4W4U A;  4F52 B;  2RS9 B;  1WEV A;  3D7C A;  3N9L A;  5II2 A;  2Y43 A;  1X0J A;  5LVQ A;  4KCX A;  3MUL A;  2G43 A;  5J3X A;  4TQN A;  4AP4 A;  5F25 A;  3U5O A;  4ALG A;  1N87 A;  4CUP A;  2YW5 A;  1WIL A;  5F1H A;  1FBV A;  4QSP A;  5FFV A;  1CHC A;  2KYU A;  4IC2 A;  5FG6 A;  2K17 A;  2YUR A;  3MHS A;  4NYW A;  5EIC A;  5DFC A;  3MHH A;  5I89 A;  5FE1 A;  5C89 A;  5CFW A;  4Z6H A;  4KV4 A;  2E6R A;  4HBV A;  4MR5 A;  2YW8 A;  2RNW A;  2YU4 A;  4A9L A;  2D8S A;  2CKL B;  4YAB A;  3IU6 A;  5JI8 A;  3SVH A;  3O33 A;  4A9H A;  3ZPV 1;  1Z2Q A;  4O7F A;  4O77 A;  5A85 A;  4IOR A;  1LDK C;  5F3A A;  3KV6 A;  4Q6F A;  5ENF A;  4NN2 A;  4QSV A;  4AKN A;  5EV9 A;  5D3T A;  2VPG A;  2VP7 A;  4UIU A;  4O7B A;  5IGM A;  1T1H A;  3NXB A;  2KFT A;  5CUA A;  5HFR A;  3MQM A;  1X4U A;  3HCS A;  4N4G A;  5D3H A;  4HXP A;  4WHU A;  2OUO A;  4PCI A;  2KWK A;  3GL6 A;  4HXM A;  5AME A;  2ECV A;  2L85 A;  2BAY A;  5E9L A;  3ZYU A;  5DYA A;  3ASL A;  3ONI A;  5HEL A;  5I83 A;  4NR6 A;  4QR3 A;  2N9G A;  4MVT A;  5AMF A;  5BT4 A;  5I80 A;  5EYA F;  5D3J A;  5JG6 A;  2R0S A;  4P5O B;  5KTX A;  2ZET C;  5B77 A;  5LKX A;  1V87 A;  2DVR A;  5II1 A;  5F5Z A;  3DWY A;  4HXS A;  4PS5 A;  4YAT A;  5C87 A;  5KU3 A;  1VFY A;  2MNZ A;  4LLB A;  2F6N A;  1HYJ A;  2ECJ A;  4NR4 A;  3O35 A;  5KTW A;  4QUT A;  5ENC A;  5E9Y A;  1E4U A;  4A9E A;  2YSJ A;  2R10 A;  4GNE A;  4CUT A;  4XUA A;  4LJN A;  3QZS A;  4X3G A;  2LRI C;  3N9M A;  5DLZ A;  3L1Z B;  2YQM A;  5DYX A;  5HQ5 A;  5E3G A;  5A5R A;  3U5P A;  1X4J A;  2DVS A;  3O37 A;  3UV2 A;  5H9M A;  1ZS5 A;  4O64 A;  4NR8 A;  5LUU A;  4ZW1 A;  4QUU A;  5CRZ A;  5TDW A;  2CT2 A;  4Z1S A;  3L11 A;  4BBQ A;  2K1J A;  5HLS A;  5G0F A;  3SVF A;  3I3J A;  3UVW A;  2M1R A;  3O7A A;  2KIZ A;  5EK9 A;  4UYD A;  2FUU A;  2MA5 A;  4R8P K;  4QEW A;  5IG6 A;  5F2P A;  3L1X A;  2C2L A;  4S3O B;  5A81 A;  4O7C A;  3LQJ A;  5EWW A;  2ECW A;  5EWC A;  5L8T A;  4O70 A;  2E7O A;  5BT3 A;  5B8D A;  3MUK A;  1WEE A;  1WFK A;  4NUD A;  4MEQ A;  3RPG B;  4V3L C;  4HXL A;  4Y03 A;  5D24 A;  5DLX A;  4UI9 B;  2RI7 A;  4NR9 A;  2MJV B;  5I29 A;  2LXH C;  3U5J A;  3IHP A;  3U5L A;  5ETB A;  2LGL A;  2YRE A;  3Q2F A;  2QIC A;  2VNF A;  5TRB A;  5EM3 A;  4ZUX U;  4UIZ A;  2EOD A;  3C5K A;  2KR4 A;  5AIU A;  3ZTG A;  1Z60 A;  3KQI A;  2K16 A;  2I8N A;  2FUI A;  4FO9 A;  5DY7 A;  4B7Y C;  5J0D A;  2VJF A;  4CUU A;  3NG2 A;  4UIY A;  3I2D A;  4GPJ A;  2LSP B;  5A5S A;  4TKP B;  4TZ2 A;  4YBM A;  2G6Q A;  2KU3 A;  5FG5 A;  5AIT A;  5F62 A;  4LR6 A;  3P1E A;  4YYD A;  3UVY A;  5C8G A;  2YQL A;  4LK9 A;  1XWH A;  4HXR A;  5DBM A;  3PHD A;  2YYN A;  5EVA A;  5I88 A;  2ECN A;  2Y1M A;  4UP5 A;  2M3H A;  5JWM A;  4Z93 A;  4YYH A;  2K4D A;  3K2J A;  4R2Y A;  4MEN A;  5EQ1 A;  1JSP B;  2H60 A;  4FJC A;  4AYC B;  4YC9 A;  4QF2 A;  3N9N A;  5HEN A;  4NQN A;  4LZR A;  4UYG A;  2DVQ A;  4WIV A;  5HM0 A;  5KH7 A;  5CQ5 A;  3LQI A;  5F1L A;  2LN0 A;  4GND A;  1FP0 A;  5CQ7 A;  4O7A A;  4QB3 A;  4XY9 A;  5HRW A;  4YAX A;  5EIS A;  3U5M A;  3MXF A;  5CRM A;  4C67 A;  4IC3 A;  4UYE A;  2I7K A;  4KV1 A;  3HCU A;  5D26 A;  4WZ2 A;  4QF3 A;  3RCW A;  5DFD A;  3HTK C;  5CY9 A;  4A9M A;  5HRV A;  5F63 A;  4LZS A;  3RTR B;  5HFQ A;  4TT2 A;  4IOO A;  4IR3 A;  5AD3 A;  5EP7 A;  3KNV A;  4A4B A;  2YYR A;  2D9E A;  3UVX A;  2NAA A;  4I7C A;  3RPG C;  2E3K A;  2G45 A;  3M62 A;  5B78 A;  5FH6 A;  4UYF A;  3QZV A;  1WEQ A;  4AVX A;  5HJC A;  4Q0O A;  5EWH A;  2I50 A;  5ETD A;  5FE5 A;  2IDA A;  2D82 A;  4YBT A;  5KTU A;  2LGV A;  5FDZ A;  2JMJ A;  4O7E A;  4YY6 A;  3SOW A;  1WEO A;  2F42 A;  1WIM A;  3FKM X;  5ENJ A;  5F61 A;  3VK6 A;  4QY4 A;  4MEO A;  2H0D A;  5A82 A;  5IGK A;  5DYU A;  4ZQL A;  5I40 A;  4QSX A;  3JVM A;  3U5K A;  2MUM A;  5EI4 A;  4O74 A;  2WP1 A;  5D3S A;  5E3D A;  4NUC A;  3ZVY A;  5G4S A;  5IID A;  2HDP A;  4NRC A;  2C2V S;  2RO1 A;  5L97 A;  5CS8 A;  4PY6 A;  4ALH A;  5CUD A;  4CUQ A;  1JM4 B;  2L5U A;  5L8U A;  2DAT A;  1Z6U A;  4HXO A;  5FE4 A;  3AAD A;  1WGM A;  3SOX A;  5F60 A;  3DQV R;  4A4C A;  4HXN A;  5G4R A;  1BOR A;  3N9Q A;  5A5O A;  4YK0 A;  4YYM A;  2YQD A;  2VJE A;  2G4A A;  2HYE D;  3UV4 A;  2LGG A;  4IR5 A;  2L5E A;  5CZG A;  4UYH A;  5LVR A;  4XUB A;  4YH4 A;  2LDR A;  4Q0N A;  3PUQ A;  4OUF A;  2YEK A;  1JM7 A;  2RNX A;  1K2F A;  2M85 A;  3MB3 A;  5D3P A;  1JOC A;  5TBN A;  1HYI A;  2LQ6 A;  2RFJ A;  4N4H A;  4O71 A;  4LYW A;  3S92 A;  2JRJ A;  3HCT A;  3FL2 A;  5FE3 A;  5E9V A;  4CLB A;  2MNY A;  1VD4 A;  4CCG X;  2YT5 A;  4HBW A;  4B86 C;  4LRG A;  5EGU A;  5FE9 A;  5EPR A;  2MD7 B;  5D7X A;  2PUY A;  5CPE A;  4C66 A;  1G25 A;  5CQ6 A;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...