4YATA

Crystal structure of trim24 phd-bromodomain complexed with n-(1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl)-4-methoxybenzene-1-sulfonamide (5b)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
173
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 173
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yatA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yatA01
5AMEA 4MEOA 5I7XA 4O75A 5KO4A 2YSJA 5LJ0A 1WEEA 2HYED 2RNXA 5AIUA 3RPGB 4QC3A 5E3DA 5L97A 5DLXA 4O72A 4QYLA 5EK9A 4ZW1A 5A81A 4YABA 2E6SA 4UYGA 2MT5A 4O70A 4O78A 3UVDA 2K1JA 3U5LA 1K2FA 4QSVA 4PPEA 4O7BA 4YYGA 3RCWA 5B77A 2KTBB 4UYDA 4YATA 2OUOA 5F1HA 4YBMA 2MA6A 4WZ3B 4R8PK 2JMIA 4PY6A 1X4IA 5LVRA 4WZ0A 4XUBA 5E73A 5EV9A 5HELA 5J3XA 3ZYQA 4NR7A 2ZETC 3N9LA 3ZNIA 4B86C 5FEYA 1VD4A 5CUBA 4QSTA 4YY6A 3O35A 4QC1A 2CSYA 5BT4A 5AD2A 4GNGA 4BBQA 5C8GA 4UIUA 2YQLA 2I8NA 5CFWA 3HCUA 4UP0A 3VK6A 1MM3A 3ONIA 5DX4A 3UV5A 5I3LA 5EA1A 5C13A 5HRXA 1DVPA 5LUUA 1LDKC 4IOOA 4YY4A 4QEWA 2VJEB 4AP4A 4A9LA 4NR8A 4A4BA 4TQNA 4Q6FA 5C87A 3UW9A 5LKUA 5A5RA 3P1FA 2L80A 3M99A 4QZSA 5D3PA 3K2JA 4Z93A 3MULA 4MR4A 4YYKA 4NYXA 5CZGA 5CY9A 5HQ6A 4KV1A 5DKHA 5G4RA 5FE3A 5I7YA 5CQ6A 1IYMA 5D26A 4YH3A 2ECGA 2ECNA 3L1XA 5IGNA 4A49A 5FE9A 5ENIA 3HCSA 5B79A 4MR5A 4YAXA 4IR3A 4ALGA 2EODA 4Q0NA 3LRQA 2VJEA 3HCTA 4Y03A 5D1LB 4YBSA 2LQ6A 1JSPB 5E9YA 4A9OA 3KV6A 5K29A 5E9VA 4WHUA 5ENGA 5H1UA 4TYLA 5LKTA 1FP0A 4UYFB 2K4DA 4LRGA 3N9MA 4FLPA 2L5UA 4YYDA 4I7BA 5E9IA 3HTKC 3O37A 5A83A 4YYIA 5AITA 2PUYA 3FL2A 4XY9A 5CU8A 3C6WA 5E74A 2F6NA 5HLSA 4HXPA 2DVSA 3JVMA 5G04B 2RNYA 5B8DA 4A9IA 5DFCA 4LZSA 3LXJA 4NS5A 4QSRA 4RVRA 4TT4A 5CP5A 3MB3A 5L8TA 3P1DA 2LGKA 4HXRA 3LJWA 5FE5A 2KE1A 5JI8A 4V3KC 5IBNA 2ECTA 4LYIA 4PCEA 2YU4A 4YBTA 5ENEA 3NXBA 4XYAA 4TKPB 3U5MA 4F3IA 4O7CA 5FE0A 1V87A 2YDWA 4IR4A 4NR4A 2JMJA 5A85A 2LDRA 4MSXA 1WEUA 5CUGA 1LDJB 4AYCA 2VPEA 5CUDA 2RSDA 5II2A 4LC2A 4ALHA 3IHPA 2KREA 5L98A 4CFKA 5IGKA 1ZBDB 2M1RA 4QSXA 5DYUA 4CCGX 4UIXA 5CQ5A 4YH4A 2LSPB 5LVQA 3O70A 3DWYA 4FIPA 5DY7A 2MNYA 2JRJA 4HBVA 2YYNA 2DX8A 3P1CA 3AQAA 3KV5A 3KQIA 5G4SA 4NN2A 3SVGA 4NUDA 5ENCA 5D3JA 5DFDA 2L75A 4UITA 2LGVA 2MNZA 1N72A 4O77A 4OUFA 5FG5A 5FG4A 4GNDA 4HXKA 4O74A 5LKZA 5F60A 5HQ5A 4AKNA 1WUMA 2YELA 3FKMX 5H85A 4BJXA 4NXJA 4GNEA 2DKWA 4E96A 4UYEA 5DBMA 2EGPA 2NAAA 5F1LA 4AYCB 5FFWA 4N4IA 5EPBA 2KWJA 4XUAA 2G4AA 4HBWA 5TABA 2CSZA 1WFKA 1HYIA 4P5OB 2C2LA 4QR5A 3UV2A 5CQTA 4A9MA 5E7DA 2D9EA 4QUUA 5F3AA 2YURA 5FH7A 2ECVA 3GV4A 4NRAA 5CQ8A 1F62A 2H60A 5ENJA 4CUQA 4LZRA 5FB0A 5H9MA 5EI4A 2YYRA 4TU4A 5B78A 4QF3A 4TZ8A 5EWWA 4YYJA 2BAYA 4IC2A 5C4QA 4J3IA 5E3GA 4LLBA 5CUCA 5A5PA 5KH7A 2E7NA 2KYUA 5LJ2A 5DKCA 3D7CA 2M6MA 3L1ZB 5EM3A 5HQ7A 2CT2A 5C89A 3PURA 5AMFA 1WENA 4UYHA 3N9NA 4L58A 5DKDA 3MHSA 1JOCA 2R10A 4GB0A 2KWOA 5F2PA 2YHNA 2OO1A 5CQ3A 2E6RA 2WP1A 5I1QA 3P1EA 5CTLA 5HEMA 3N9PA 5CQ7A 5F63A 4MR3A 2KIZA 2IDAA 5KTXA 2G45A 1WILA 4A0CD 4HXSA 1JM7B 2KWKA 5CGPA 1CHCA 3JVJA 4J1PA 4YYNA 4NR5A 5FH8A 3U5KA 4QSQA 4A9NA 1U6GB 4OGJA 3UVWA 5D7XA 4LR6A 5EISA 5EWCA 4XY8A 4QSWA 3U5NA 5H1TA 4PTBA 3LQHA 5IG6A 3NG2A 3GL6A 3I3JA 4WHWA 4FJCA 5F36A 3ZVYA 1WIMA 4FK5A 2PNXA 3C5KA 3T6RA 4X3GA 3ZPVE 2Y43A 4X2IA 4QF2A 4QR3A 3ZVZB 3LQIA 3SVFA 2FUUA 5TRBA 2I50A 3G0JA 4Z6IA 5D25A 5D3SA 5JWMA 3GG3A 2L85A 4QNSA 4O76A 3JVLA 5KTWA 4S3OC 4HBYA 5EU1A 5F61A 1WEWA 5G0FA 4QSSA 5CQ4A 4FO9A 4QBMA 4BW1A 3MB4A 3UVXA 1VFYA 1Z6UA 4NRBA 2LV9A 4HXMA 5DYXA 3M63A 5FERA 2YEKA 5L99A 2MIQA 4A9FA 4YYMA 1G25A 1MM2A 5D24A 4KV4A 3O34A 4CA1A 3MQMA 5IGLA 2I7KA 4L7XA 1JM4B 2MJVB 2K16A 1VYXA 4ZC9A 5EYAF 4MR6A 5FB1A 4AVXA 4ZDTA 2ECWA 4GPJA 4CLBA 4O7EA 3RPGC 3LQJA 1WESA 2FUIA 5E9MA 5A7CA 3MHHA 5TCMA 5TBNA 4CUTA 3Q2EA 3MUKA 2JMDA 2Y1MA 4PS5A 4XI1A 5FG6A 4WIVA 5A5QA 3SOWA 5DYCA 4Q0OA 4BHWA 2XEUA 4J0RA 4QSPA 4MENA 5KHMA 5C85A 2F42A 4QR4A 4TS8A 4YADA 4LZ2A 2R0YA 4BW2A 4HXLA 5HCLA 5LCWB 2CKLB 1RMDA 5EWVA 4PKLA 2MA5A 5JG6A 5I89A 3QZVA 5ENHA 5EQ1A 2VPBA 4QUTA 5FDZA 4IR5A 5FE2A 3U5PA 2H0DA 2L43A 2VJFA 2LXHC 4S3OB 5FE7A 2VP7A 3DPLR 2G6QA 1XWHA 3P5OA 3O36A 3HMEA 5I29A 2VPDA 4UP5A 5KTUA 4MEQA 3HMHA 2YW8A 4CUUA 5CUEA 2DVRA 4WA6A 1Z2QA 2MD8C 2RO1A 4AUQB 5HRWA 3Q2FA 5D1MB 5DW2A 4BW4A 1N87A 3DQVR 4J0SA 4QYDA 4IR6A 5EWDA 4ZUXU 5DLZA 2WP2A 4DONA 5FE1A 4LYWA 4NRCA 1FBVA 2LRIC 2YHOA 5A82A 2E7OA 5FE4A 5I88A 3HMFA 4I7DA 5J0DA 2H0DB 4TU6A 2R0VA 4KCXA 2RI7A 2KGIA 5EGUA 3EB5A 3S91A 4TTEA 5BT3A 1T1HA 5EICA 3SHBA 1WEOA 3KNVA 4A9KA 1WEQA 5TB6A 4BW3A 2HDPA 2YREA 4WZ2A 1E4UA 4NYVA 2YSMA 3IU5A 4CUPA 5D3NA 3UV4A 2L0BA 2YQMA 4O64A 1WEVA 4C67A 5H1VA 4N4GA 4LYSA 2ECIA 2KR4A 5DFBA 1HYJA 3SOUA 5ACYA 3ASLA 4I7CA 1WGMA 3O33A 2YUCA 4TT2A 5CRMA 3ZTGA 1WEPA 4TT6A 4NUEA 2DVVA 5IGMA 3MXFA 4IORA 2RS9B 5LKXA 3T7LA 4GNFA 5BT5A 5HFQA 2OSSA 4OGIA 2M85A 1BORA 2MD7B 2LGGA 5FBXA 4MVTA 4Z1QA 2G43A 2EA6A 5E9KA 5G05B 4LDFA 3V43A 2LGLA 3DAIA 1EQFA 2YQDA 3JVKA 4LK9A 5EP7A 4R7EA 2YT5A 5A5SA 2DWWA 2Y1NA 2NXBA 5CUAA 4LKAA 3QZTA 1Z60A 5TDWA 5L96A 5FE6A 4A4CA 5FH6A 2C2VS 4B7YC 4UYFA 5HRVA 4HXOA 5D1KB 5EWHA 4O7AA 2E3KA 2K17A 2L84A 2KFTA 4UI9B 5C11A 2YW5A 5B76A 3EB6A 2OXQC 1WEMA 4R2YA 4UIVA 4CUSA 5L8UA 1JM7A 1WUGA 2R0SA 4UIYA 3N9QA 3N9OA 5A5OA 3M62A 2L5EA 2LXPC 4HBXA 2GRCA 3O7AA 4V3LC 5FE8A 3U5OA 5HFRA 2KGGA 5EVAA 5I86A 5COIA 5F25A 4O7FA 5F62A 2MUMA 2KU3A 2QIZA 5D3LA 2QICA 5F5ZA 4QSUA 5D3TA 5KU3A 1WE9A 4LJNA 3SVHA 3RTRB 5ETBA 5DKAA 1E6IA 2VPGA 5CRZA 5DYAA 5HJCA 2DVQA 2N9GA 5EPSA 3UVYA 5DINA 4LADB 4QB3A 4A9JA 3TLPA 4YK0A 1X4UA 4NYWA 5C7NA 4YYHA 4QY4A 4IOQA 5D3HA 5HENA 4QEUA 2CKLA 5CPEA 2QJ0A 3L11A 5TDRA 3SOXA 4N4HA 4NQNA 4C9ZA 5FFYA 2RFJA 2RNWA 4C66A 4CFLA 4O71A 1X0JA 5E9LA 4F52B 4QEVA 4A9EA 2VJFB 2AN6A 5A5NA 2ECJA 5I80A 4TZ2A 2UZGA 4IC3A 3PHDA 4NUCA 2KWNA 4Z1SA 1X4JA 5AD3A 5DW1A 5CS8A 4N4FA 5CQAA 3ZPV1 4NR9A 4UIWA 2YEMA 4CL9A 5I40A 5ENFA 1F68A 5EPRA 2F6JA 2VNFA 5LJ1A 5HM0A 4UIZA 4N3WA 2LN0A 5KH9A 5D0CA 1ZS5A 3QZSA 4A9HA 5ETDA 3IU6A 3U5JA 3ZYUA 2M3HA 2D82A 5E0RA 4MEPA 4Z6HA 4ZQLA 5FFVA 5KH3A 2DATA 4CURA 2FSAA 5I83A 2D8SA 3S92A 5II1A 2XB1A 5ENBA 5IIDA 5B75A 4NQMA 3G0LA 3PUQA 3AADA 4HXNA 4PCIA 5D3RA 4W4UA 3I2DA 4NR6A 4YC9A
chains in the Genus database with same CATH superfamily
5AMEA 4MEOA 5I7XA 4O75A 5KO4A 2YSJA 5LJ0A 1WEEA 2HYED 2RNXA 5AIUA 3RPGB 4QC3A 5E3DA 5L97A 5DLXA 4O72A 4QYLA 5EK9A 4ZW1A 5A81A 4YABA 2E6SA 4UYGA 2MT5A 4O70A 4O78A 3UVDA 2K1JA 3U5LA 1K2FA 4QSVA 4PPEA 4O7BA 4YYGA 3RCWA 5B77A 3LVRE 2KTBB 4UYDA 4YATA 2OUOA 5F1HA 4YBMA 2MA6A 4WZ3B 3FM8C 4R8PK 2JMIA 4PY6A 1X4IA 2L7PA 5LVRA 2DSMA 4XUBA 5E73A 5EV9A 5HELA 4WZ0A 5J3XA 4NR7A 4AKHA 2ZETC 3LJUX 3N9LA 3ZNIA 4B86C 5FEYA 1VD4A 5CUBA 3SUBA 4QSTA 4YY6A 3O35A 4QC1A 2CSYA 5BT4A 5AD2A 4GNGA 4BBQA 5C8GA 3D1BA 4UIUA 2YQLA 2I8NA 5CFWA 3FANA 3HCUA 4UP0A 3VK6A 1MM3A 3ONIA 5DX4A 3UV5A 5I3LA 5EA1A 5C13A 5HRXA 1DVPA 5LUUA 1LDKC 2XOZA 5SVXA 3E2DA 2E61A 4IOOA 4YY4A 4QEWA 2VJEB 4AP4A 4A9LA 4NR8A 4A4BA 4TQNA 4Q6FA 5C87A 3UW9A 5LKUA 5A5RA 3P1FA 2L80A 3M99A 4QZSA 5D3PA 3K2JA 4Z93A 3MULA 4MR4A 4YYKA 4NYXA 5CZGA 5CY9A 5HQ6A 4KV1A 5DKHA 5G4RA 5FE3A 5I7YA 5CQ6A 1IYMA 5D26A 4YH3A 2ECGA 2ECNA 3L1XA 5IGNA 4A49A 5FE9A 5ENIA 3HCSA 5B79A 4MR5A 4YAXA 4IR3A 4ALGA 2EODA 4Q0NA 3LRQA 3VKGA 2VJEA 3HCTA 4Y03A 2DJAA 5D1LB 4YBSA 2LQ6A 1JSPB 5E9YA 4A9OA 3KV6A 5K29A 5E9VA 2CONA 4WHUA 5ENGA 5H1UA 4TYLA 5LKTA 1FP0A 2OWAA 4UYFB 2K4DA 4LRGA 3N9MA 4FLPA 2L5UA 4YYDA 4I7BA 5E9IA 2LAUA 3HTKC 3O37A 5A83A 4YYIA 5AITA 2PUYA 3DWDA 3FL2A 4XY9A 5CU8A 3C6WA 5E74A 2F6NA 5HLSA 4Z0OA 4HXPA 5K3QA 2DVSA 3JVMA 2RR4A 5G04B 2RNYA 5B8DA 4A9IA 5DFCA 2XOCA 4LZSA 3LXJA 4NS5A 4QSRA 4RVRA 4TT4A 5CP5A 3MB3A 5L8TA 3P1DA 2B0OE 2LGKA 4HXRA 3LJWA 5FE5A 2KE1A 5JI8A 4V3KC 5IBNA 2ECTA 4LYIA 4PCEA 2YU4A 4YBTA 5ENEA 3NXBA 4XYAA 4TKPB 3U5MA 4F3IA 4O7CA 5FE0A 1V87A 2YDWA 4IR4A 4NR4A 3D1DA 2JMJA 5A85A 2LDRA 4MSXA 1WEUA 5CUGA 1LDJB 4AYCA 2VPEA 5CUDA 2RSDA 5II2A 4LC2A 4ALHA 3IHPA 2KREA 5L98A 4CFKA 5IGKA 1ZBDB 2M1RA 4QSXA 5DYUA 4CCGX 3O47A 4UIXA 5CQ5A 4YH4A 2LSPB 5LVQA 3O70A 3DWYA 4FIPA 5DY7A 2MNYA 2JRJA 4HBVA 2YYNA 2DX8A 3P1CA 3AQAA 3KV5A 3KQIA 5G4SA 4NN2A 3SVGA 4NUDA 5ENCA 5D3JA 5DFDA 2L75A 4UITA 2LGVA 2MNZA 1N72A 4O77A 4OUFA 5FG5A 4OGEA 5FG4A 4GNDA 4HXKA 4O74A 5LKZA 5F60A 5HQ5A 4AKNA 1WUMA 2YELA 4AI6A 3MDBC 3FKMX 5H85A 4BJXA 4NXJA 4GNEA 2DKWA 4E96A 4UYEA 5DBMA 2EGPA 2NAAA 5F1LA 3JUEA 5FFWA 4AYCB 4N4IA 5EPBA 2KWJA 4XUAA 2G4AA 4HBWA 5TABA 2CSZA 1WFKA 1HYIA 4P5OB 2C2LA 4QR5A 3UV2A 5CQTA 4A9MA 5E7DA 2YVRA 2D9EA 4QUUA 5F3AA 2YURA 5FH7A 2ECVA 3GV4A 4NRAA 5CQ8A 1F62A 2H60A 5ENJA 4CUQA 4LZRA 5FB0A 5H9MA 5EI4A 2YYRA 4TU4A 2XOYA 4Z0RA 5B78A 4QF3A 4TZ8A 5EWWA 4YYJA 2BAYA 4IC2A 5C4QA 4J3IA 5E3GA 4LLBA 5CUCA 5A5PA 5KH7A 2E7NA 2KYUA 5LJ2A 5DKCA 3D7CA 2M6MA 3H7HA 3L1ZB 5EM3A 5HQ7A 2CT2A 5C89A 3PURA 5AMFA 1WENA 4UYHA 3N9NA 4H9DA 4L58A 5DKDA 3MHSA 1JOCA 2R10A 4GB0A 2KWOA 5F2PA 2YHNA 2OO1A 5CQ3A 2E6RA 2WP1A 5I1QA 3P1EA 5CTLA 5HEMA 3N9PA 5CQ7A 5F63A 4MR3A 2KIZA 2IDAA 5KTXA 2G45A 1WILA 4A0CD 4HXSA 1JM7B 2KWKA 3KDEC 5CGPA 1CHCA 3JVJA 3LVQE 4J1PA 4YYNA 4NR5A 5FH8A 3U5KA 4QSQA 4A9NA 1U6GB 2EGMA 3FAOA 4OGJA 3UVWA 5D7XA 4LR6A 5EISA 5EWCA 4XY8A 4QSWA 3U5NA 5H1TA 3LQHA 4PTBA 5IG6A 3NG2A 3GL6A 3I3JA 4WHWA 4FJCA 5F36A 3ZVYA 1WIMA 4FK5A 2PNXA 3C5KA 3PLWA 3T6RA 4QQ4A 4X3GA 3ZPVE 2Y43A 4X2IA 4QF2A 4QR3A 3ZVZB 3LQIA 3SVFA 2FUUA 5TRBA 2I50A 3G0JA 4Z6IA 5D25A 5D3SA 5JWMA 3GG3A 2L85A 4QNSA 4O76A 3JVLA 5KTWA 4S3OC 4HBYA 5EU1A 5F61A 1WEWA 5G0FA 4QSSA 5CQ4A 4FO9A 4QBMA 4BW1A 3MB4A 3UVXA 1VFYA 1Z6UA 4NRBA 2LV9A 4HXMA 5DYXA 3M63A 5FERA 2YEKA 5L99A 2MIQA 4A9FA 4YYMA 1G25A 2CSVA 1MM2A 2FD4A 5D24A 4KV4A 3O34A 4CA1A 3MQMA 5IGLA 2I7KA 4L7XA 1JM4B 2MJVB 2K16A 1VYXA 4ZC9A 5EYAF 4MR6A 5FB1A 2CRWA 4ZDTA 4AVXA 2ECWA 2FFWA 4GPJA 4CLBA 4O7EA 3RPGC 3LQJA 1WESA 2FUIA 5E9MA 5A7CA 3MHHA 5TCMA 5TBNA 4CUTA 3Q2EA 1MBMA 3MUKA 2JMDA 2Y1MA 4PS5A 4XI1A 5FG6A 4WIVA 5A5QA 3SOWA 5DYCA 4Q0OA 4BHWA 2XEUA 4J0RA 4QSPA 4MENA 5KHMA 5C85A 3VKHA 2F42A 4QR4A 4TS8A 4YADA 4LZ2A 2R0YA 4BW2A 3T9KA 4HXLA 5HCLA 2KKXA 5LCWB 2CKLB 1RMDA 5EWVA 4PKLA 2MA5A 5JG6A 5I89A 3QZVA 5ENHA 5EQ1A 2VPBA 4QUTA 5FDZA 4IR5A 5FE2A 3U5PA 2H0DA 2L43A 2VJFA 2LXHC 4S3OB 5FE7A 2VP7A 3DPLR 2G6QA 1XWHA 3P5OA 3O36A 3HMEA 5I29A 2VPDA 4UP5A 5KTUA 4MEQA 3HMHA 2JUNA 2YW8A 4CUUA 5CUEA 2DVRA 4WA6A 1Z2QA 2MD8C 2RO1A 4AUQB 5HRWA 4O62A 3Q2FA 5D1MB 5DW2A 4BW4A 1N87A 3DQVR 4J0SA 4QYDA 4IR6A 5EWDA 4ZUXU 5DLZA 2WP2A 4DONA 3DDTA 5FE1A 4LYWA 4NRCA 1FBVA 2LRIC 2YHOA 5A82A 2E7OA 5FE4A 5I88A 3HMFA 4I7DA 5J0DA 2H0DB 4TU6A 2R0VA 4KCXA 2RI7A 2KGIA 3Q1DA 5EGUA 3EB5A 3S91A 4TTEA 5BT3A 1T1HA 5EICA 3SHBA 1WEOA 3KNVA 4A9KA 1WEQA 5TB6A 4BW3A 2HDPA 2YREA 4WZ2A 1E4UA 4NYVA 2YSMA 3IU5A 2M13A 4CUPA 5D3NA 4AKGA 3UV4A 2L0BA 2YQMA 4O64A 3ERRA 4C67A 1WEVA 4OGCA 5H1VA 2CRRA 4N4GA 4LYSA 2ECIA 2KKYA 2KR4A 5DFBA 1HYJA 3SOUA 5ACYA 3ASLA 4I7CA 1WGMA 3O33A 2YUCA 4TT2A 5CRMA 3ZTGA 1WEPA 4TT6A 4NUEA 2DVVA 5IGMA 3MXFA 4IORA 2RS9B 5LKXA 2EXUA 3T7LA 2D8UA 4GNFA 5BT5A 5HFQA 2OSSA 4OGIA 2M85A 1BORA 2MD7B 2LGGA 5FBXA 4MVTA 4Z1QA 2G43A 2EA6A 5E9KA 5G05B 4LDFA 3V43A 2LGLA 3DAIA 1EQFA 2YQDA 3JVKA 4LK9A 5EP7A 4R7EA 2YT5A 2JM3A 5A5SA 2DWWA 2Y1NA 2NXBA 3ZYQA 5CUAA 4LKAA 3QZTA 5SVIB 2IQJA 1PUOA 1Z60A 5TDWA 5L96A 5FE6A 4A4CA 5FH6A 2C2VS 4B7YC 4UYFA 5HRVA 4HXOA 5D1KB 5SVYA 5EWHA 4O7AA 2E3KA 2K17A 2L84A 2KFTA 2P57A 2XP0A 4UI9B 5C11A 2YW5A 5B76A 3EB6A 3M7KA 2OXQC 1ZKRA 1WEMA 4R2YA 4UIVA 4CUSA 5L8UA 1JM7A 1WUGA 2R0SA 4UIYA 3N9QA 3N9OA 5A5OA 3M62A 2L5EA 2LXPC 4HBXA 2GRCA 3O7AA 4V3LC 5FE8A 3U5OA 5HFRA 2KGGA 5EVAA 5I86A 5COIA 5F25A 4O7FA 5F62A 3FEHA 2MUMA 2KU3A 2QIZA 5D3LA 2QICA 5F5ZA 4QSUA 5D3TA 5KU3A 1WE9A 4LJNA 3SVHA 3RTRB 5ETBA 5DKAA 1E6IA 2VPGA 5CRZA 5DYAA 5HJCA 4F1PA 2DVQA 2N9GA 5EPSA 3UVYA 5DINA 4LADB 4QB3A 4A9JA 3TLPA 4YK0A 1DCQA 1X4UA 4NYWA 5C7NA 4YYHA 4QY4A 3FJUB 4IOQA 5D3HA 5HENA 4QEUA 2CKLA 5CPEA 2QJ0A 3L11A 5TDRA 3SOXA 4N4HA 4NQNA 4C9ZA 5FFYA 2RFJA 2RNWA 4C66A 4CFLA 4O71A 1X0JA 5E9LA 4F52B 4QEVA 4A9EA 2VJFB 2AN6A 5A5NA 2ECJA 5I80A 4AKIA 4TZ2A 2UZGA 4IC3A 3PHDA 4NUCA 2KWNA 4Z1SA 1X4JA 5AD3A 5DW1A 5CS8A 4N4FA 5CQAA 3ZPV1 4NR9A 4UIWA 2YEMA 4CL9A 5I40A 5ENFA 1F68A 5EPRA 2F6JA 2VNFA 5LJ1A 5HM0A 4UIZA 4N3WA 2LN0A 5KH9A 5D0CA 1ZS5A 3QZSA 4A9HA 5SVIA 2MKEA 3LDYA 5ETDA 3IU6A 3U5JA 3ZYUA 2M3HA 2D82A 5E0RA 4MEPA 4Z6HA 4ZQLA 5FFVA 5KH3A 2DATA 4CURA 2FSAA 5I83A 2D8SA 3S92A 5II1A 2XB1A 5ENBA 5IIDA 5B75A 4NQMA 3G0LA 3PUQA 3AADA 4HXNA 4PCIA 5D3RA 4W4UA 3I2DA 4NR6A 2EJNA 4YC9A
chains in the Genus database with same CATH topology
5AMEA 4MEOA 5I7XA 4O75A 5KO4A 2YSJA 5LJ0A 1WEEA 2HYED 2RNXA 5AIUA 3RPGB 4QC3A 5E3DA 5L97A 5DLXA 4O72A 4QYLA 5EK9A 4ZW1A 5A81A 4YABA 2E6SA 4UYGA 2MT5A 4O70A 4O78A 3UVDA 2K1JA 3U5LA 1K2FA 4QSVA 4PPEA 4O7BA 4YYGA 3RCWA 5B77A 2KTBB 4UYDA 4YATA 2OUOA 5F1HA 4YBMA 2MA6A 4WZ3B 4R8PK 2JMIA 4PY6A 1X4IA 5LVRA 4WZ0A 4XUBA 5E73A 5EV9A 5HELA 5J3XA 3ZYQA 4NR7A 2ZETC 3N9LA 3ZNIA 4B86C 5FEYA 1VD4A 5CUBA 4QSTA 4YY6A 3O35A 4QC1A 2CSYA 5BT4A 5AD2A 4GNGA 4BBQA 5C8GA 4UIUA 2YQLA 2I8NA 5CFWA 3HCUA 4UP0A 3VK6A 1MM3A 3ONIA 5DX4A 3UV5A 5I3LA 5EA1A 5C13A 5HRXA 1DVPA 5LUUA 1LDKC 4IOOA 4YY4A 4QEWA 2VJEB 4AP4A 4A9LA 4NR8A 4A4BA 4TQNA 4Q6FA 5C87A 3UW9A 5LKUA 5A5RA 3P1FA 2L80A 3M99A 4QZSA 5D3PA 3K2JA 4Z93A 3MULA 4MR4A 4YYKA 4NYXA 5CZGA 5CY9A 5HQ6A 4KV1A 5DKHA 5G4RA 5FE3A 5I7YA 5CQ6A 1IYMA 5D26A 4YH3A 2ECGA 2ECNA 3L1XA 5IGNA 4A49A 5FE9A 5ENIA 3HCSA 5B79A 4MR5A 4YAXA 4IR3A 4ALGA 2EODA 4Q0NA 3LRQA 2VJEA 3HCTA 4Y03A 5D1LB 4YBSA 2LQ6A 1JSPB 5E9YA 4A9OA 3KV6A 5K29A 5E9VA 4WHUA 5ENGA 5H1UA 4TYLA 5LKTA 1FP0A 4UYFB 2K4DA 4LRGA 3N9MA 4FLPA 2L5UA 4YYDA 4I7BA 5E9IA 3HTKC 3O37A 5A83A 4YYIA 5AITA 2PUYA 3FL2A 4XY9A 5CU8A 3C6WA 5E74A 2F6NA 5HLSA 4HXPA 2DVSA 3JVMA 5G04B 2RNYA 5B8DA 4A9IA 5DFCA 4LZSA 3LXJA 4NS5A 4QSRA 4RVRA 4TT4A 5CP5A 3MB3A 5L8TA 3P1DA 2LGKA 4HXRA 3LJWA 5FE5A 2KE1A 5JI8A 4V3KC 5IBNA 2ECTA 4LYIA 4PCEA 2YU4A 4YBTA 5ENEA 3NXBA 4XYAA 4TKPB 3U5MA 4F3IA 4O7CA 5FE0A 1V87A 2YDWA 4IR4A 4NR4A 2JMJA 5A85A 2LDRA 4MSXA 1WEUA 5CUGA 1LDJB 4AYCA 2VPEA 5CUDA 2RSDA 5II2A 4LC2A 4ALHA 3IHPA 2KREA 5L98A 4CFKA 5IGKA 1ZBDB 2M1RA 4QSXA 5DYUA 4CCGX 4UIXA 5CQ5A 4YH4A 2LSPB 5LVQA 3O70A 3DWYA 4FIPA 5DY7A 2MNYA 2JRJA 4HBVA 2YYNA 2DX8A 3P1CA 3AQAA 3KV5A 3KQIA 5G4SA 4NN2A 3SVGA 4NUDA 5ENCA 5D3JA 5DFDA 2L75A 4UITA 2LGVA 2MNZA 1N72A 4O77A 4OUFA 5FG5A 5FG4A 4GNDA 4HXKA 4O74A 5LKZA 5F60A 5HQ5A 4AKNA 1WUMA 2YELA 3FKMX 5H85A 4BJXA 4NXJA 4GNEA 2DKWA 4E96A 4UYEA 5DBMA 2EGPA 2NAAA 5F1LA 4AYCB 5FFWA 4N4IA 5EPBA 2KWJA 4XUAA 2G4AA 4HBWA 5TABA 2CSZA 1WFKA 1HYIA 4P5OB 2C2LA 4QR5A 3UV2A 5CQTA 4A9MA 5E7DA 2D9EA 4QUUA 5F3AA 2YURA 5FH7A 2ECVA 3GV4A 4NRAA 5CQ8A 1F62A 2H60A 5ENJA 4CUQA 4LZRA 5FB0A 5H9MA 5EI4A 2YYRA 4TU4A 5B78A 4QF3A 4TZ8A 5EWWA 4YYJA 2BAYA 4IC2A 5C4QA 4J3IA 5E3GA 4LLBA 5CUCA 5A5PA 5KH7A 2E7NA 2KYUA 5LJ2A 5DKCA 3D7CA 2M6MA 3L1ZB 5EM3A 5HQ7A 2CT2A 5C89A 3PURA 5AMFA 1WENA 4UYHA 3N9NA 4L58A 5DKDA 3MHSA 1JOCA 2R10A 4GB0A 2KWOA 5F2PA 2YHNA 2OO1A 5CQ3A 2E6RA 2WP1A 5I1QA 3P1EA 5CTLA 5HEMA 3N9PA 5CQ7A 5F63A 4MR3A 2KIZA 2IDAA 5KTXA 2G45A 1WILA 4A0CD 4HXSA 1JM7B 2KWKA 5CGPA 1CHCA 3JVJA 4J1PA 4YYNA 4NR5A 5FH8A 3U5KA 4QSQA 4A9NA 1U6GB 4OGJA 3UVWA 5D7XA 4LR6A 5EISA 5EWCA 4XY8A 4QSWA 3U5NA 5H1TA 4PTBA 3LQHA 5IG6A 3NG2A 3GL6A 3I3JA 4WHWA 4FJCA 5F36A 3ZVYA 1WIMA 4FK5A 2PNXA 3C5KA 3T6RA 4X3GA 3ZPVE 2Y43A 4X2IA 4QF2A 4QR3A 3ZVZB 3LQIA 3SVFA 2FUUA 5TRBA 2I50A 3G0JA 4Z6IA 5D25A 5D3SA 5JWMA 3GG3A 2L85A 4QNSA 4O76A 3JVLA 5KTWA 4S3OC 4HBYA 5EU1A 5F61A 1WEWA 5G0FA 4QSSA 5CQ4A 4FO9A 4QBMA 4BW1A 3MB4A 3UVXA 1VFYA 1Z6UA 4NRBA 2LV9A 4HXMA 5DYXA 3M63A 5FERA 2YEKA 5L99A 2MIQA 4A9FA 4YYMA 1G25A 1MM2A 5D24A 4KV4A 3O34A 4CA1A 3MQMA 5IGLA 2I7KA 4L7XA 1JM4B 2MJVB 2K16A 1VYXA 4ZC9A 5EYAF 4MR6A 5FB1A 4AVXA 4ZDTA 2ECWA 4GPJA 4CLBA 4O7EA 3RPGC 3LQJA 1WESA 2FUIA 5E9MA 5A7CA 3MHHA 5TCMA 5TBNA 4CUTA 3Q2EA 3MUKA 2JMDA 2Y1MA 4PS5A 4XI1A 5FG6A 4WIVA 5A5QA 3SOWA 5DYCA 4Q0OA 4BHWA 2XEUA 4J0RA 4QSPA 4MENA 5KHMA 5C85A 2F42A 4QR4A 4TS8A 4YADA 4LZ2A 2R0YA 4BW2A 4HXLA 5HCLA 5LCWB 2CKLB 1RMDA 5EWVA 4PKLA 2MA5A 5JG6A 5I89A 3QZVA 5ENHA 5EQ1A 2VPBA 4QUTA 5FDZA 4IR5A 5FE2A 3U5PA 2H0DA 2L43A 2VJFA 2LXHC 4S3OB 5FE7A 2VP7A 3DPLR 2G6QA 1XWHA 3P5OA 3O36A 3HMEA 5I29A 2VPDA 4UP5A 5KTUA 4MEQA 3HMHA 2YW8A 4CUUA 5CUEA 2DVRA 4WA6A 1Z2QA 2MD8C 2RO1A 4AUQB 5HRWA 3Q2FA 5D1MB 5DW2A 4BW4A 1N87A 3DQVR 4J0SA 4QYDA 4IR6A 5EWDA 4ZUXU 5DLZA 2WP2A 4DONA 5FE1A 4LYWA 4NRCA 1FBVA 2LRIC 2YHOA 5A82A 2E7OA 5FE4A 5I88A 3HMFA 4I7DA 5J0DA 2H0DB 4TU6A 2R0VA 4KCXA 2RI7A 2KGIA 5EGUA 3EB5A 3S91A 4TTEA 5BT3A 1T1HA 5EICA 3SHBA 1WEOA 3KNVA 4A9KA 1WEQA 5TB6A 4BW3A 2HDPA 2YREA 4WZ2A 1E4UA 4NYVA 2YSMA 3IU5A 4CUPA 5D3NA 3UV4A 2L0BA 2YQMA 4O64A 1WEVA 4C67A 5H1VA 4N4GA 4LYSA 2ECIA 2KR4A 5DFBA 1HYJA 3SOUA 5ACYA 3ASLA 4I7CA 1WGMA 3O33A 2YUCA 4TT2A 5CRMA 3ZTGA 1WEPA 4TT6A 4NUEA 2DVVA 5IGMA 3MXFA 4IORA 2RS9B 5LKXA 3T7LA 4GNFA 5BT5A 5HFQA 2OSSA 4OGIA 2M85A 1BORA 2MD7B 2LGGA 5FBXA 4MVTA 4Z1QA 2G43A 2EA6A 5E9KA 5G05B 4LDFA 3V43A 2LGLA 3DAIA 1EQFA 2YQDA 3JVKA 4LK9A 5EP7A 4R7EA 2YT5A 5A5SA 2DWWA 2Y1NA 2NXBA 5CUAA 4LKAA 3QZTA 1Z60A 5TDWA 5L96A 5FE6A 4A4CA 5FH6A 2C2VS 4B7YC 4UYFA 5HRVA 4HXOA 5D1KB 5EWHA 4O7AA 2E3KA 2K17A 2L84A 2KFTA 4UI9B 5C11A 2YW5A 5B76A 3EB6A 2OXQC 1WEMA 4R2YA 4UIVA 4CUSA 5L8UA 1JM7A 1WUGA 2R0SA 4UIYA 3N9QA 3N9OA 5A5OA 3M62A 2L5EA 2LXPC 4HBXA 2GRCA 3O7AA 4V3LC 5FE8A 3U5OA 5HFRA 2KGGA 5EVAA 5I86A 5COIA 5F25A 4O7FA 5F62A 2MUMA 2KU3A 2QIZA 5D3LA 2QICA 5F5ZA 4QSUA 5D3TA 5KU3A 1WE9A 4LJNA 3SVHA 3RTRB 5ETBA 5DKAA 1E6IA 2VPGA 5CRZA 5DYAA 5HJCA 2DVQA 2N9GA 5EPSA 3UVYA 5DINA 4LADB 4QB3A 4A9JA 3TLPA 4YK0A 1X4UA 4NYWA 5C7NA 4YYHA 4QY4A 4IOQA 5D3HA 5HENA 4QEUA 2CKLA 5CPEA 2QJ0A 3L11A 5TDRA 3SOXA 4N4HA 4NQNA 4C9ZA 5FFYA 2RFJA 2RNWA 4C66A 4CFLA 4O71A 1X0JA 5E9LA 4F52B 4QEVA 4A9EA 2VJFB 2AN6A 5A5NA 2ECJA 5I80A 4TZ2A 2UZGA 4IC3A 3PHDA 4NUCA 2KWNA 4Z1SA 1X4JA 5AD3A 5DW1A 5CS8A 4N4FA 5CQAA 3ZPV1 4NR9A 4UIWA 2YEMA 4CL9A 5I40A 5ENFA 1F68A 5EPRA 2F6JA 2VNFA 5LJ1A 5HM0A 4UIZA 4N3WA 2LN0A 5KH9A 5D0CA 1ZS5A 3QZSA 4A9HA 5ETDA 3IU6A 3U5JA 3ZYUA 2M3HA 2D82A 5E0RA 4MEPA 4Z6HA 4ZQLA 5FFVA 5KH3A 2DATA 4CURA 2FSAA 5I83A 2D8SA 3S92A 5II1A 2XB1A 5ENBA 5IIDA 5B75A 4NQMA 3G0LA 3PUQA 3AADA 4HXNA 4PCIA 5D3RA 4W4UA 3I2DA 4NR6A 4YC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AME A;  4MEO A;  5I7X A;  4O75 A;  5KO4 A;  2YSJ A;  5LJ0 A;  1WEE A;  2HYE D;  2RNX A;  5AIU A;  3RPG B;  4QC3 A;  5E3D A;  5L97 A;  5DLX A;  4O72 A;  4QYL A;  5EK9 A;  4ZW1 A;  5A81 A;  4YAB A;  2E6S A;  4UYG A;  2MT5 A;  4O70 A;  4O78 A;  3UVD A;  2K1J A;  3U5L A;  1K2F A;  4QSV A;  4PPE A;  4O7B A;  4YYG A;  3RCW A;  5B77 A;  2KTB B;  4UYD A;  4YAT A;  2OUO A;  5F1H A;  4YBM A;  2MA6 A;  4WZ3 B;  4R8P K;  2JMI A;  4PY6 A;  1X4I A;  5LVR A;  4WZ0 A;  4XUB A;  5E73 A;  5EV9 A;  5HEL A;  5J3X A;  3ZYQ A;  4NR7 A;  2ZET C;  3N9L A;  3ZNI A;  4B86 C;  5FEY A;  1VD4 A;  5CUB A;  4QST A;  4YY6 A;  3O35 A;  4QC1 A;  2CSY A;  5BT4 A;  5AD2 A;  4GNG A;  4BBQ A;  5C8G A;  4UIU A;  2YQL A;  2I8N A;  5CFW A;  3HCU A;  4UP0 A;  3VK6 A;  1MM3 A;  3ONI A;  5DX4 A;  3UV5 A;  5I3L A;  5EA1 A;  5C13 A;  5HRX A;  1DVP A;  5LUU A;  1LDK C;  4IOO A;  4YY4 A;  4QEW A;  2VJE B;  4AP4 A;  4A9L A;  4NR8 A;  4A4B A;  4TQN A;  4Q6F A;  5C87 A;  3UW9 A;  5LKU A;  5A5R A;  3P1F A;  2L80 A;  3M99 A;  4QZS A;  5D3P A;  3K2J A;  4Z93 A;  3MUL A;  4MR4 A;  4YYK A;  4NYX A;  5CZG A;  5CY9 A;  5HQ6 A;  4KV1 A;  5DKH A;  5G4R A;  5FE3 A;  5I7Y A;  5CQ6 A;  1IYM A;  5D26 A;  4YH3 A;  2ECG A;  2ECN A;  3L1X A;  5IGN A;  4A49 A;  5FE9 A;  5ENI A;  3HCS A;  5B79 A;  4MR5 A;  4YAX A;  4IR3 A;  4ALG A;  2EOD A;  4Q0N A;  3LRQ A;  2VJE A;  3HCT A;  4Y03 A;  5D1L B;  4YBS A;  2LQ6 A;  1JSP B;  5E9Y A;  4A9O A;  3KV6 A;  5K29 A;  5E9V A;  4WHU A;  5ENG A;  5H1U A;  4TYL A;  5LKT A;  1FP0 A;  4UYF B;  2K4D A;  4LRG A;  3N9M A;  4FLP A;  2L5U A;  4YYD A;  4I7B A;  5E9I A;  3HTK C;  3O37 A;  5A83 A;  4YYI A;  5AIT A;  2PUY A;  3FL2 A;  4XY9 A;  5CU8 A;  3C6W A;  5E74 A;  2F6N A;  5HLS A;  4HXP A;  2DVS A;  3JVM A;  5G04 B;  2RNY A;  5B8D A;  4A9I A;  5DFC A;  4LZS A;  3LXJ A;  4NS5 A;  4QSR A;  4RVR A;  4TT4 A;  5CP5 A;  3MB3 A;  5L8T A;  3P1D A;  2LGK A;  4HXR A;  3LJW A;  5FE5 A;  2KE1 A;  5JI8 A;  4V3K C;  5IBN A;  2ECT A;  4LYI A;  4PCE A;  2YU4 A;  4YBT A;  5ENE A;  3NXB A;  4XYA A;  4TKP B;  3U5M A;  4F3I A;  4O7C A;  5FE0 A;  1V87 A;  2YDW A;  4IR4 A;  4NR4 A;  2JMJ A;  5A85 A;  2LDR A;  4MSX A;  1WEU A;  5CUG A;  1LDJ B;  4AYC A;  2VPE A;  5CUD A;  2RSD A;  5II2 A;  4LC2 A;  4ALH A;  3IHP A;  2KRE A;  5L98 A;  4CFK A;  5IGK A;  1ZBD B;  2M1R A;  4QSX A;  5DYU A;  4CCG X;  4UIX A;  5CQ5 A;  4YH4 A;  2LSP B;  5LVQ A;  3O70 A;  3DWY A;  4FIP A;  5DY7 A;  2MNY A;  2JRJ A;  4HBV A;  2YYN A;  2DX8 A;  3P1C A;  3AQA A;  3KV5 A;  3KQI A;  5G4S A;  4NN2 A;  3SVG A;  4NUD A;  5ENC A;  5D3J A;  5DFD A;  2L75 A;  4UIT A;  2LGV A;  2MNZ A;  1N72 A;  4O77 A;  4OUF A;  5FG5 A;  5FG4 A;  4GND A;  4HXK A;  4O74 A;  5LKZ A;  5F60 A;  5HQ5 A;  4AKN A;  1WUM A;  2YEL A;  3FKM X;  5H85 A;  4BJX A;  4NXJ A;  4GNE A;  2DKW A;  4E96 A;  4UYE A;  5DBM A;  2EGP A;  2NAA A;  5F1L A;  4AYC B;  5FFW A;  4N4I A;  5EPB A;  2KWJ A;  4XUA A;  2G4A A;  4HBW A;  5TAB A;  2CSZ A;  1WFK A;  1HYI A;  4P5O B;  2C2L A;  4QR5 A;  3UV2 A;  5CQT A;  4A9M A;  5E7D A;  2D9E A;  4QUU A;  5F3A A;  2YUR A;  5FH7 A;  2ECV A;  3GV4 A;  4NRA A;  5CQ8 A;  1F62 A;  2H60 A;  5ENJ A;  4CUQ A;  4LZR A;  5FB0 A;  5H9M A;  5EI4 A;  2YYR A;  4TU4 A;  5B78 A;  4QF3 A;  4TZ8 A;  5EWW A;  4YYJ A;  2BAY A;  4IC2 A;  5C4Q A;  4J3I A;  5E3G A;  4LLB A;  5CUC A;  5A5P A;  5KH7 A;  2E7N A;  2KYU A;  5LJ2 A;  5DKC A;  3D7C A;  2M6M A;  3L1Z B;  5EM3 A;  5HQ7 A;  2CT2 A;  5C89 A;  3PUR A;  5AMF A;  1WEN A;  4UYH A;  3N9N A;  4L58 A;  5DKD A;  3MHS A;  1JOC A;  2R10 A;  4GB0 A;  2KWO A;  5F2P A;  2YHN A;  2OO1 A;  5CQ3 A;  2E6R A;  2WP1 A;  5I1Q A;  3P1E A;  5CTL A;  5HEM A;  3N9P A;  5CQ7 A;  5F63 A;  4MR3 A;  2KIZ A;  2IDA A;  5KTX A;  2G45 A;  1WIL A;  4A0C D;  4HXS A;  1JM7 B;  2KWK A;  5CGP A;  1CHC A;  3JVJ A;  4J1P A;  4YYN A;  4NR5 A;  5FH8 A;  3U5K A;  4QSQ A;  4A9N A;  1U6G B;  4OGJ A;  3UVW A;  5D7X A;  4LR6 A;  5EIS A;  5EWC A;  4XY8 A;  4QSW A;  3U5N A;  5H1T A;  4PTB A;  3LQH A;  5IG6 A;  3NG2 A;  3GL6 A;  3I3J A;  4WHW A;  4FJC A;  5F36 A;  3ZVY A;  1WIM A;  4FK5 A;  2PNX A;  3C5K A;  3T6R A;  4X3G A;  3ZPV E;  2Y43 A;  4X2I A;  4QF2 A;  4QR3 A;  3ZVZ B;  3LQI A;  3SVF A;  2FUU A;  5TRB A;  2I50 A;  3G0J A;  4Z6I A;  5D25 A;  5D3S A;  5JWM A;  3GG3 A;  2L85 A;  4QNS A;  4O76 A;  3JVL A;  5KTW A;  4S3O C;  4HBY A;  5EU1 A;  5F61 A;  1WEW A;  5G0F A;  4QSS A;  5CQ4 A;  4FO9 A;  4QBM A;  4BW1 A;  3MB4 A;  3UVX A;  1VFY A;  1Z6U A;  4NRB A;  2LV9 A;  4HXM A;  5DYX A;  3M63 A;  5FER A;  2YEK A;  5L99 A;  2MIQ A;  4A9F A;  4YYM A;  1G25 A;  1MM2 A;  5D24 A;  4KV4 A;  3O34 A;  4CA1 A;  3MQM A;  5IGL A;  2I7K A;  4L7X A;  1JM4 B;  2MJV B;  2K16 A;  1VYX A;  4ZC9 A;  5EYA F;  4MR6 A;  5FB1 A;  4AVX A;  4ZDT A;  2ECW A;  4GPJ A;  4CLB A;  4O7E A;  3RPG C;  3LQJ A;  1WES A;  2FUI A;  5E9M A;  5A7C A;  3MHH A;  5TCM A;  5TBN A;  4CUT A;  3Q2E A;  3MUK A;  2JMD A;  2Y1M A;  4PS5 A;  4XI1 A;  5FG6 A;  4WIV A;  5A5Q A;  3SOW A;  5DYC A;  4Q0O A;  4BHW A;  2XEU A;  4J0R A;  4QSP A;  4MEN A;  5KHM A;  5C85 A;  2F42 A;  4QR4 A;  4TS8 A;  4YAD A;  4LZ2 A;  2R0Y A;  4BW2 A;  4HXL A;  5HCL A;  5LCW B;  2CKL B;  1RMD A;  5EWV A;  4PKL A;  2MA5 A;  5JG6 A;  5I89 A;  3QZV A;  5ENH A;  5EQ1 A;  2VPB A;  4QUT A;  5FDZ A;  4IR5 A;  5FE2 A;  3U5P A;  2H0D A;  2L43 A;  2VJF A;  2LXH C;  4S3O B;  5FE7 A;  2VP7 A;  3DPL R;  2G6Q A;  1XWH A;  3P5O A;  3O36 A;  3HME A;  5I29 A;  2VPD A;  4UP5 A;  5KTU A;  4MEQ A;  3HMH A;  2YW8 A;  4CUU A;  5CUE A;  2DVR A;  4WA6 A;  1Z2Q A;  2MD8 C;  2RO1 A;  4AUQ B;  5HRW A;  3Q2F A;  5D1M B;  5DW2 A;  4BW4 A;  1N87 A;  3DQV R;  4J0S A;  4QYD A;  4IR6 A;  5EWD A;  4ZUX U;  5DLZ A;  2WP2 A;  4DON A;  5FE1 A;  4LYW A;  4NRC A;  1FBV A;  2LRI C;  2YHO A;  5A82 A;  2E7O A;  5FE4 A;  5I88 A;  3HMF A;  4I7D A;  5J0D A;  2H0D B;  4TU6 A;  2R0V A;  4KCX A;  2RI7 A;  2KGI A;  5EGU A;  3EB5 A;  3S91 A;  4TTE A;  5BT3 A;  1T1H A;  5EIC A;  3SHB A;  1WEO A;  3KNV A;  4A9K A;  1WEQ A;  5TB6 A;  4BW3 A;  2HDP A;  2YRE A;  4WZ2 A;  1E4U A;  4NYV A;  2YSM A;  3IU5 A;  4CUP A;  5D3N A;  3UV4 A;  2L0B A;  2YQM A;  4O64 A;  1WEV A;  4C67 A;  5H1V A;  4N4G A;  4LYS A;  2ECI A;  2KR4 A;  5DFB A;  1HYJ A;  3SOU A;  5ACY A;  3ASL A;  4I7C A;  1WGM A;  3O33 A;  2YUC A;  4TT2 A;  5CRM A;  3ZTG A;  1WEP A;  4TT6 A;  4NUE A;  2DVV A;  5IGM A;  3MXF A;  4IOR A;  2RS9 B;  5LKX A;  3T7L A;  4GNF A;  5BT5 A;  5HFQ A;  2OSS A;  4OGI A;  2M85 A;  1BOR A;  2MD7 B;  2LGG A;  5FBX A;  4MVT A;  4Z1Q A;  2G43 A;  2EA6 A;  5E9K A;  5G05 B;  4LDF A;  3V43 A;  2LGL A;  3DAI A;  1EQF A;  2YQD A;  3JVK A;  4LK9 A;  5EP7 A;  4R7E A;  2YT5 A;  5A5S A;  2DWW A;  2Y1N A;  2NXB A;  5CUA A;  4LKA A;  3QZT A;  1Z60 A;  5TDW A;  5L96 A;  5FE6 A;  4A4C A;  5FH6 A;  2C2V S;  4B7Y C;  4UYF A;  5HRV A;  4HXO A;  5D1K B;  5EWH A;  4O7A A;  2E3K A;  2K17 A;  2L84 A;  2KFT A;  4UI9 B;  5C11 A;  2YW5 A;  5B76 A;  3EB6 A;  2OXQ C;  1WEM A;  4R2Y A;  4UIV A;  4CUS A;  5L8U A;  1JM7 A;  1WUG A;  2R0S A;  4UIY A;  3N9Q A;  3N9O A;  5A5O A;  3M62 A;  2L5E A;  2LXP C;  4HBX A;  2GRC A;  3O7A A;  4V3L C;  5FE8 A;  3U5O A;  5HFR A;  2KGG A;  5EVA A;  5I86 A;  5COI A;  5F25 A;  4O7F A;  5F62 A;  2MUM A;  2KU3 A;  2QIZ A;  5D3L A;  2QIC A;  5F5Z A;  4QSU A;  5D3T A;  5KU3 A;  1WE9 A;  4LJN A;  3SVH A;  3RTR B;  5ETB A;  5DKA A;  1E6I A;  2VPG A;  5CRZ A;  5DYA A;  5HJC A;  2DVQ A;  2N9G A;  5EPS A;  3UVY A;  5DIN A;  4LAD B;  4QB3 A;  4A9J A;  3TLP A;  4YK0 A;  1X4U A;  4NYW A;  5C7N A;  4YYH A;  4QY4 A;  4IOQ A;  5D3H A;  5HEN A;  4QEU A;  2CKL A;  5CPE A;  2QJ0 A;  3L11 A;  5TDR A;  3SOX A;  4N4H A;  4NQN A;  4C9Z A;  5FFY A;  2RFJ A;  2RNW A;  4C66 A;  4CFL A;  4O71 A;  1X0J A;  5E9L A;  4F52 B;  4QEV A;  4A9E A;  2VJF B;  2AN6 A;  5A5N A;  2ECJ A;  5I80 A;  4TZ2 A;  2UZG A;  4IC3 A;  3PHD A;  4NUC A;  2KWN A;  4Z1S A;  1X4J A;  5AD3 A;  5DW1 A;  5CS8 A;  4N4F A;  5CQA A;  3ZPV 1;  4NR9 A;  4UIW A;  2YEM A;  4CL9 A;  5I40 A;  5ENF A;  1F68 A;  5EPR A;  2F6J A;  2VNF A;  5LJ1 A;  5HM0 A;  4UIZ A;  4N3W A;  2LN0 A;  5KH9 A;  5D0C A;  1ZS5 A;  3QZS A;  4A9H A;  5ETD A;  3IU6 A;  3U5J A;  3ZYU A;  2M3H A;  2D82 A;  5E0R A;  4MEP A;  4Z6H A;  4ZQL A;  5FFV A;  5KH3 A;  2DAT A;  4CUR A;  2FSA A;  5I83 A;  2D8S A;  3S92 A;  5II1 A;  2XB1 A;  5ENB A;  5IID A;  5B75 A;  4NQM A;  3G0L A;  3PUQ A;  3AAD A;  4HXN A;  4PCI A;  5D3R A;  4W4U A;  3I2D A;  4NR6 A;  4YC9 A; 
#chains in the Genus database with same CATH topology
 5AME A;  4MEO A;  5I7X A;  4O75 A;  5KO4 A;  2YSJ A;  5LJ0 A;  1WEE A;  2HYE D;  2RNX A;  5AIU A;  3RPG B;  4QC3 A;  5E3D A;  5L97 A;  5DLX A;  4O72 A;  4QYL A;  5EK9 A;  4ZW1 A;  5A81 A;  4YAB A;  2E6S A;  4UYG A;  2MT5 A;  4O70 A;  4O78 A;  3UVD A;  2K1J A;  3U5L A;  1K2F A;  4QSV A;  4PPE A;  4O7B A;  4YYG A;  3RCW A;  5B77 A;  3LVR E;  2KTB B;  4UYD A;  4YAT A;  2OUO A;  5F1H A;  4YBM A;  2MA6 A;  4WZ3 B;  3FM8 C;  4R8P K;  2JMI A;  4PY6 A;  1X4I A;  2L7P A;  5LVR A;  2DSM A;  4XUB A;  5E73 A;  5EV9 A;  5HEL A;  4WZ0 A;  5J3X A;  4NR7 A;  4AKH A;  2ZET C;  3LJU X;  3N9L A;  3ZNI A;  4B86 C;  5FEY A;  1VD4 A;  5CUB A;  3SUB A;  4QST A;  4YY6 A;  3O35 A;  4QC1 A;  2CSY A;  5BT4 A;  5AD2 A;  4GNG A;  4BBQ A;  5C8G A;  3D1B A;  4UIU A;  2YQL A;  2I8N A;  5CFW A;  3FAN A;  3HCU A;  4UP0 A;  3VK6 A;  1MM3 A;  3ONI A;  5DX4 A;  3UV5 A;  5I3L A;  5EA1 A;  5C13 A;  5HRX A;  1DVP A;  5LUU A;  1LDK C;  2XOZ A;  5SVX A;  3E2D A;  2E61 A;  4IOO A;  4YY4 A;  4QEW A;  2VJE B;  4AP4 A;  4A9L A;  4NR8 A;  4A4B A;  4TQN A;  4Q6F A;  5C87 A;  3UW9 A;  5LKU A;  5A5R A;  3P1F A;  2L80 A;  3M99 A;  4QZS A;  5D3P A;  3K2J A;  4Z93 A;  3MUL A;  4MR4 A;  4YYK A;  4NYX A;  5CZG A;  5CY9 A;  5HQ6 A;  4KV1 A;  5DKH A;  5G4R A;  5FE3 A;  5I7Y A;  5CQ6 A;  1IYM A;  5D26 A;  4YH3 A;  2ECG A;  2ECN A;  3L1X A;  5IGN A;  4A49 A;  5FE9 A;  5ENI A;  3HCS A;  5B79 A;  4MR5 A;  4YAX A;  4IR3 A;  4ALG A;  2EOD A;  4Q0N A;  3LRQ A;  3VKG A;  2VJE A;  3HCT A;  4Y03 A;  2DJA A;  5D1L B;  4YBS A;  2LQ6 A;  1JSP B;  5E9Y A;  4A9O A;  3KV6 A;  5K29 A;  5E9V A;  2CON A;  4WHU A;  5ENG A;  5H1U A;  4TYL A;  5LKT A;  1FP0 A;  2OWA A;  4UYF B;  2K4D A;  4LRG A;  3N9M A;  4FLP A;  2L5U A;  4YYD A;  4I7B A;  5E9I A;  2LAU A;  3HTK C;  3O37 A;  5A83 A;  4YYI A;  5AIT A;  2PUY A;  3DWD A;  3FL2 A;  4XY9 A;  5CU8 A;  3C6W A;  5E74 A;  2F6N A;  5HLS A;  4Z0O A;  4HXP A;  5K3Q A;  2DVS A;  3JVM A;  2RR4 A;  5G04 B;  2RNY A;  5B8D A;  4A9I A;  5DFC A;  2XOC A;  4LZS A;  3LXJ A;  4NS5 A;  4QSR A;  4RVR A;  4TT4 A;  5CP5 A;  3MB3 A;  5L8T A;  3P1D A;  2B0O E;  2LGK A;  4HXR A;  3LJW A;  5FE5 A;  2KE1 A;  5JI8 A;  4V3K C;  5IBN A;  2ECT A;  4LYI A;  4PCE A;  2YU4 A;  4YBT A;  5ENE A;  3NXB A;  4XYA A;  4TKP B;  3U5M A;  4F3I A;  4O7C A;  5FE0 A;  1V87 A;  2YDW A;  4IR4 A;  4NR4 A;  3D1D A;  2JMJ A;  5A85 A;  2LDR A;  4MSX A;  1WEU A;  5CUG A;  1LDJ B;  4AYC A;  2VPE A;  5CUD A;  2RSD A;  5II2 A;  4LC2 A;  4ALH A;  3IHP A;  2KRE A;  5L98 A;  4CFK A;  5IGK A;  1ZBD B;  2M1R A;  4QSX A;  5DYU A;  4CCG X;  3O47 A;  4UIX A;  5CQ5 A;  4YH4 A;  2LSP B;  5LVQ A;  3O70 A;  3DWY A;  4FIP A;  5DY7 A;  2MNY A;  2JRJ A;  4HBV A;  2YYN A;  2DX8 A;  3P1C A;  3AQA A;  3KV5 A;  3KQI A;  5G4S A;  4NN2 A;  3SVG A;  4NUD A;  5ENC A;  5D3J A;  5DFD A;  2L75 A;  4UIT A;  2LGV A;  2MNZ A;  1N72 A;  4O77 A;  4OUF A;  5FG5 A;  4OGE A;  5FG4 A;  4GND A;  4HXK A;  4O74 A;  5LKZ A;  5F60 A;  5HQ5 A;  4AKN A;  1WUM A;  2YEL A;  4AI6 A;  3MDB C;  3FKM X;  5H85 A;  4BJX A;  4NXJ A;  4GNE A;  2DKW A;  4E96 A;  4UYE A;  5DBM A;  2EGP A;  2NAA A;  5F1L A;  3JUE A;  5FFW A;  4AYC B;  4N4I A;  5EPB A;  2KWJ A;  4XUA A;  2G4A A;  4HBW A;  5TAB A;  2CSZ A;  1WFK A;  1HYI A;  4P5O B;  2C2L A;  4QR5 A;  3UV2 A;  5CQT A;  4A9M A;  5E7D A;  2YVR A;  2D9E A;  4QUU A;  5F3A A;  2YUR A;  5FH7 A;  2ECV A;  3GV4 A;  4NRA A;  5CQ8 A;  1F62 A;  2H60 A;  5ENJ A;  4CUQ A;  4LZR A;  5FB0 A;  5H9M A;  5EI4 A;  2YYR A;  4TU4 A;  2XOY A;  4Z0R A;  5B78 A;  4QF3 A;  4TZ8 A;  5EWW A;  4YYJ A;  2BAY A;  4IC2 A;  5C4Q A;  4J3I A;  5E3G A;  4LLB A;  5CUC A;  5A5P A;  5KH7 A;  2E7N A;  2KYU A;  5LJ2 A;  5DKC A;  3D7C A;  2M6M A;  3H7H A;  3L1Z B;  5EM3 A;  5HQ7 A;  2CT2 A;  5C89 A;  3PUR A;  5AMF A;  1WEN A;  4UYH A;  3N9N A;  4H9D A;  4L58 A;  5DKD A;  3MHS A;  1JOC A;  2R10 A;  4GB0 A;  2KWO A;  5F2P A;  2YHN A;  2OO1 A;  5CQ3 A;  2E6R A;  2WP1 A;  5I1Q A;  3P1E A;  5CTL A;  5HEM A;  3N9P A;  5CQ7 A;  5F63 A;  4MR3 A;  2KIZ A;  2IDA A;  5KTX A;  2G45 A;  1WIL A;  4A0C D;  4HXS A;  1JM7 B;  2KWK A;  3KDE C;  5CGP A;  1CHC A;  3JVJ A;  3LVQ E;  4J1P A;  4YYN A;  4NR5 A;  5FH8 A;  3U5K A;  4QSQ A;  4A9N A;  1U6G B;  2EGM A;  3FAO A;  4OGJ A;  3UVW A;  5D7X A;  4LR6 A;  5EIS A;  5EWC A;  4XY8 A;  4QSW A;  3U5N A;  5H1T A;  3LQH A;  4PTB A;  5IG6 A;  3NG2 A;  3GL6 A;  3I3J A;  4WHW A;  4FJC A;  5F36 A;  3ZVY A;  1WIM A;  4FK5 A;  2PNX A;  3C5K A;  3PLW A;  3T6R A;  4QQ4 A;  4X3G A;  3ZPV E;  2Y43 A;  4X2I A;  4QF2 A;  4QR3 A;  3ZVZ B;  3LQI A;  3SVF A;  2FUU A;  5TRB A;  2I50 A;  3G0J A;  4Z6I A;  5D25 A;  5D3S A;  5JWM A;  3GG3 A;  2L85 A;  4QNS A;  4O76 A;  3JVL A;  5KTW A;  4S3O C;  4HBY A;  5EU1 A;  5F61 A;  1WEW A;  5G0F A;  4QSS A;  5CQ4 A;  4FO9 A;  4QBM A;  4BW1 A;  3MB4 A;  3UVX A;  1VFY A;  1Z6U A;  4NRB A;  2LV9 A;  4HXM A;  5DYX A;  3M63 A;  5FER A;  2YEK A;  5L99 A;  2MIQ A;  4A9F A;  4YYM A;  1G25 A;  2CSV A;  1MM2 A;  2FD4 A;  5D24 A;  4KV4 A;  3O34 A;  4CA1 A;  3MQM A;  5IGL A;  2I7K A;  4L7X A;  1JM4 B;  2MJV B;  2K16 A;  1VYX A;  4ZC9 A;  5EYA F;  4MR6 A;  5FB1 A;  2CRW A;  4ZDT A;  4AVX A;  2ECW A;  2FFW A;  4GPJ A;  4CLB A;  4O7E A;  3RPG C;  3LQJ A;  1WES A;  2FUI A;  5E9M A;  5A7C A;  3MHH A;  5TCM A;  5TBN A;  4CUT A;  3Q2E A;  1MBM A;  3MUK A;  2JMD A;  2Y1M A;  4PS5 A;  4XI1 A;  5FG6 A;  4WIV A;  5A5Q A;  3SOW A;  5DYC A;  4Q0O A;  4BHW A;  2XEU A;  4J0R A;  4QSP A;  4MEN A;  5KHM A;  5C85 A;  3VKH A;  2F42 A;  4QR4 A;  4TS8 A;  4YAD A;  4LZ2 A;  2R0Y A;  4BW2 A;  3T9K A;  4HXL A;  5HCL A;  2KKX A;  5LCW B;  2CKL B;  1RMD A;  5EWV A;  4PKL A;  2MA5 A;  5JG6 A;  5I89 A;  3QZV A;  5ENH A;  5EQ1 A;  2VPB A;  4QUT A;  5FDZ A;  4IR5 A;  5FE2 A;  3U5P A;  2H0D A;  2L43 A;  2VJF A;  2LXH C;  4S3O B;  5FE7 A;  2VP7 A;  3DPL R;  2G6Q A;  1XWH A;  3P5O A;  3O36 A;  3HME A;  5I29 A;  2VPD A;  4UP5 A;  5KTU A;  4MEQ A;  3HMH A;  2JUN A;  2YW8 A;  4CUU A;  5CUE A;  2DVR A;  4WA6 A;  1Z2Q A;  2MD8 C;  2RO1 A;  4AUQ B;  5HRW A;  4O62 A;  3Q2F A;  5D1M B;  5DW2 A;  4BW4 A;  1N87 A;  3DQV R;  4J0S A;  4QYD A;  4IR6 A;  5EWD A;  4ZUX U;  5DLZ A;  2WP2 A;  4DON A;  3DDT A;  5FE1 A;  4LYW A;  4NRC A;  1FBV A;  2LRI C;  2YHO A;  5A82 A;  2E7O A;  5FE4 A;  5I88 A;  3HMF A;  4I7D A;  5J0D A;  2H0D B;  4TU6 A;  2R0V A;  4KCX A;  2RI7 A;  2KGI A;  3Q1D A;  5EGU A;  3EB5 A;  3S91 A;  4TTE A;  5BT3 A;  1T1H A;  5EIC A;  3SHB A;  1WEO A;  3KNV A;  4A9K A;  1WEQ A;  5TB6 A;  4BW3 A;  2HDP A;  2YRE A;  4WZ2 A;  1E4U A;  4NYV A;  2YSM A;  3IU5 A;  2M13 A;  4CUP A;  5D3N A;  4AKG A;  3UV4 A;  2L0B A;  2YQM A;  4O64 A;  3ERR A;  4C67 A;  1WEV A;  4OGC A;  5H1V A;  2CRR A;  4N4G A;  4LYS A;  2ECI A;  2KKY A;  2KR4 A;  5DFB A;  1HYJ A;  3SOU A;  5ACY A;  3ASL A;  4I7C A;  1WGM A;  3O33 A;  2YUC A;  4TT2 A;  5CRM A;  3ZTG A;  1WEP A;  4TT6 A;  4NUE A;  2DVV A;  5IGM A;  3MXF A;  4IOR A;  2RS9 B;  5LKX A;  2EXU A;  3T7L A;  2D8U A;  4GNF A;  5BT5 A;  5HFQ A;  2OSS A;  4OGI A;  2M85 A;  1BOR A;  2MD7 B;  2LGG A;  5FBX A;  4MVT A;  4Z1Q A;  2G43 A;  2EA6 A;  5E9K A;  5G05 B;  4LDF A;  3V43 A;  2LGL A;  3DAI A;  1EQF A;  2YQD A;  3JVK A;  4LK9 A;  5EP7 A;  4R7E A;  2YT5 A;  2JM3 A;  5A5S A;  2DWW A;  2Y1N A;  2NXB A;  3ZYQ A;  5CUA A;  4LKA A;  3QZT A;  5SVI B;  2IQJ A;  1PUO A;  1Z60 A;  5TDW A;  5L96 A;  5FE6 A;  4A4C A;  5FH6 A;  2C2V S;  4B7Y C;  4UYF A;  5HRV A;  4HXO A;  5D1K B;  5SVY A;  5EWH A;  4O7A A;  2E3K A;  2K17 A;  2L84 A;  2KFT A;  2P57 A;  2XP0 A;  4UI9 B;  5C11 A;  2YW5 A;  5B76 A;  3EB6 A;  3M7K A;  2OXQ C;  1ZKR A;  1WEM A;  4R2Y A;  4UIV A;  4CUS A;  5L8U A;  1JM7 A;  1WUG A;  2R0S A;  4UIY A;  3N9Q A;  3N9O A;  5A5O A;  3M62 A;  2L5E A;  2LXP C;  4HBX A;  2GRC A;  3O7A A;  4V3L C;  5FE8 A;  3U5O A;  5HFR A;  2KGG A;  5EVA A;  5I86 A;  5COI A;  5F25 A;  4O7F A;  5F62 A;  3FEH A;  2MUM A;  2KU3 A;  2QIZ A;  5D3L A;  2QIC A;  5F5Z A;  4QSU A;  5D3T A;  5KU3 A;  1WE9 A;  4LJN A;  3SVH A;  3RTR B;  5ETB A;  5DKA A;  1E6I A;  2VPG A;  5CRZ A;  5DYA A;  5HJC A;  4F1P A;  2DVQ A;  2N9G A;  5EPS A;  3UVY A;  5DIN A;  4LAD B;  4QB3 A;  4A9J A;  3TLP A;  4YK0 A;  1DCQ A;  1X4U A;  4NYW A;  5C7N A;  4YYH A;  4QY4 A;  3FJU B;  4IOQ A;  5D3H A;  5HEN A;  4QEU A;  2CKL A;  5CPE A;  2QJ0 A;  3L11 A;  5TDR A;  3SOX A;  4N4H A;  4NQN A;  4C9Z A;  5FFY A;  2RFJ A;  2RNW A;  4C66 A;  4CFL A;  4O71 A;  1X0J A;  5E9L A;  4F52 B;  4QEV A;  4A9E A;  2VJF B;  2AN6 A;  5A5N A;  2ECJ A;  5I80 A;  4AKI A;  4TZ2 A;  2UZG A;  4IC3 A;  3PHD A;  4NUC A;  2KWN A;  4Z1S A;  1X4J A;  5AD3 A;  5DW1 A;  5CS8 A;  4N4F A;  5CQA A;  3ZPV 1;  4NR9 A;  4UIW A;  2YEM A;  4CL9 A;  5I40 A;  5ENF A;  1F68 A;  5EPR A;  2F6J A;  2VNF A;  5LJ1 A;  5HM0 A;  4UIZ A;  4N3W A;  2LN0 A;  5KH9 A;  5D0C A;  1ZS5 A;  3QZS A;  4A9H A;  5SVI A;  2MKE A;  3LDY A;  5ETD A;  3IU6 A;  3U5J A;  3ZYU A;  2M3H A;  2D82 A;  5E0R A;  4MEP A;  4Z6H A;  4ZQL A;  5FFV A;  5KH3 A;  2DAT A;  4CUR A;  2FSA A;  5I83 A;  2D8S A;  3S92 A;  5II1 A;  2XB1 A;  5ENB A;  5IID A;  5B75 A;  4NQM A;  3G0L A;  3PUQ A;  3AAD A;  4HXN A;  4PCI A;  5D3R A;  4W4U A;  3I2D A;  4NR6 A;  2EJN A;  4YC9 A; 
#chains in the Genus database with same CATH homology
 5AME A;  4MEO A;  5I7X A;  4O75 A;  5KO4 A;  2YSJ A;  5LJ0 A;  1WEE A;  2HYE D;  2RNX A;  5AIU A;  3RPG B;  4QC3 A;  5E3D A;  5L97 A;  5DLX A;  4O72 A;  4QYL A;  5EK9 A;  4ZW1 A;  5A81 A;  4YAB A;  2E6S A;  4UYG A;  2MT5 A;  4O70 A;  4O78 A;  3UVD A;  2K1J A;  3U5L A;  1K2F A;  4QSV A;  4PPE A;  4O7B A;  4YYG A;  3RCW A;  5B77 A;  2KTB B;  4UYD A;  4YAT A;  2OUO A;  5F1H A;  4YBM A;  2MA6 A;  4WZ3 B;  4R8P K;  2JMI A;  4PY6 A;  1X4I A;  5LVR A;  4WZ0 A;  4XUB A;  5E73 A;  5EV9 A;  5HEL A;  5J3X A;  3ZYQ A;  4NR7 A;  2ZET C;  3N9L A;  3ZNI A;  4B86 C;  5FEY A;  1VD4 A;  5CUB A;  4QST A;  4YY6 A;  3O35 A;  4QC1 A;  2CSY A;  5BT4 A;  5AD2 A;  4GNG A;  4BBQ A;  5C8G A;  4UIU A;  2YQL A;  2I8N A;  5CFW A;  3HCU A;  4UP0 A;  3VK6 A;  1MM3 A;  3ONI A;  5DX4 A;  3UV5 A;  5I3L A;  5EA1 A;  5C13 A;  5HRX A;  1DVP A;  5LUU A;  1LDK C;  4IOO A;  4YY4 A;  4QEW A;  2VJE B;  4AP4 A;  4A9L A;  4NR8 A;  4A4B A;  4TQN A;  4Q6F A;  5C87 A;  3UW9 A;  5LKU A;  5A5R A;  3P1F A;  2L80 A;  3M99 A;  4QZS A;  5D3P A;  3K2J A;  4Z93 A;  3MUL A;  4MR4 A;  4YYK A;  4NYX A;  5CZG A;  5CY9 A;  5HQ6 A;  4KV1 A;  5DKH A;  5G4R A;  5FE3 A;  5I7Y A;  5CQ6 A;  1IYM A;  5D26 A;  4YH3 A;  2ECG A;  2ECN A;  3L1X A;  5IGN A;  4A49 A;  5FE9 A;  5ENI A;  3HCS A;  5B79 A;  4MR5 A;  4YAX A;  4IR3 A;  4ALG A;  2EOD A;  4Q0N A;  3LRQ A;  2VJE A;  3HCT A;  4Y03 A;  5D1L B;  4YBS A;  2LQ6 A;  1JSP B;  5E9Y A;  4A9O A;  3KV6 A;  5K29 A;  5E9V A;  4WHU A;  5ENG A;  5H1U A;  4TYL A;  5LKT A;  1FP0 A;  4UYF B;  2K4D A;  4LRG A;  3N9M A;  4FLP A;  2L5U A;  4YYD A;  4I7B A;  5E9I A;  3HTK C;  3O37 A;  5A83 A;  4YYI A;  5AIT A;  2PUY A;  3FL2 A;  4XY9 A;  5CU8 A;  3C6W A;  5E74 A;  2F6N A;  5HLS A;  4HXP A;  2DVS A;  3JVM A;  5G04 B;  2RNY A;  5B8D A;  4A9I A;  5DFC A;  4LZS A;  3LXJ A;  4NS5 A;  4QSR A;  4RVR A;  4TT4 A;  5CP5 A;  3MB3 A;  5L8T A;  3P1D A;  2LGK A;  4HXR A;  3LJW A;  5FE5 A;  2KE1 A;  5JI8 A;  4V3K C;  5IBN A;  2ECT A;  4LYI A;  4PCE A;  2YU4 A;  4YBT A;  5ENE A;  3NXB A;  4XYA A;  4TKP B;  3U5M A;  4F3I A;  4O7C A;  5FE0 A;  1V87 A;  2YDW A;  4IR4 A;  4NR4 A;  2JMJ A;  5A85 A;  2LDR A;  4MSX A;  1WEU A;  5CUG A;  1LDJ B;  4AYC A;  2VPE A;  5CUD A;  2RSD A;  5II2 A;  4LC2 A;  4ALH A;  3IHP A;  2KRE A;  5L98 A;  4CFK A;  5IGK A;  1ZBD B;  2M1R A;  4QSX A;  5DYU A;  4CCG X;  4UIX A;  5CQ5 A;  4YH4 A;  2LSP B;  5LVQ A;  3O70 A;  3DWY A;  4FIP A;  5DY7 A;  2MNY A;  2JRJ A;  4HBV A;  2YYN A;  2DX8 A;  3P1C A;  3AQA A;  3KV5 A;  3KQI A;  5G4S A;  4NN2 A;  3SVG A;  4NUD A;  5ENC A;  5D3J A;  5DFD A;  2L75 A;  4UIT A;  2LGV A;  2MNZ A;  1N72 A;  4O77 A;  4OUF A;  5FG5 A;  5FG4 A;  4GND A;  4HXK A;  4O74 A;  5LKZ A;  5F60 A;  5HQ5 A;  4AKN A;  1WUM A;  2YEL A;  3FKM X;  5H85 A;  4BJX A;  4NXJ A;  4GNE A;  2DKW A;  4E96 A;  4UYE A;  5DBM A;  2EGP A;  2NAA A;  5F1L A;  4AYC B;  5FFW A;  4N4I A;  5EPB A;  2KWJ A;  4XUA A;  2G4A A;  4HBW A;  5TAB A;  2CSZ A;  1WFK A;  1HYI A;  4P5O B;  2C2L A;  4QR5 A;  3UV2 A;  5CQT A;  4A9M A;  5E7D A;  2D9E A;  4QUU A;  5F3A A;  2YUR A;  5FH7 A;  2ECV A;  3GV4 A;  4NRA A;  5CQ8 A;  1F62 A;  2H60 A;  5ENJ A;  4CUQ A;  4LZR A;  5FB0 A;  5H9M A;  5EI4 A;  2YYR A;  4TU4 A;  5B78 A;  4QF3 A;  4TZ8 A;  5EWW A;  4YYJ A;  2BAY A;  4IC2 A;  5C4Q A;  4J3I A;  5E3G A;  4LLB A;  5CUC A;  5A5P A;  5KH7 A;  2E7N A;  2KYU A;  5LJ2 A;  5DKC A;  3D7C A;  2M6M A;  3L1Z B;  5EM3 A;  5HQ7 A;  2CT2 A;  5C89 A;  3PUR A;  5AMF A;  1WEN A;  4UYH A;  3N9N A;  4L58 A;  5DKD A;  3MHS A;  1JOC A;  2R10 A;  4GB0 A;  2KWO A;  5F2P A;  2YHN A;  2OO1 A;  5CQ3 A;  2E6R A;  2WP1 A;  5I1Q A;  3P1E A;  5CTL A;  5HEM A;  3N9P A;  5CQ7 A;  5F63 A;  4MR3 A;  2KIZ A;  2IDA A;  5KTX A;  2G45 A;  1WIL A;  4A0C D;  4HXS A;  1JM7 B;  2KWK A;  5CGP A;  1CHC A;  3JVJ A;  4J1P A;  4YYN A;  4NR5 A;  5FH8 A;  3U5K A;  4QSQ A;  4A9N A;  1U6G B;  4OGJ A;  3UVW A;  5D7X A;  4LR6 A;  5EIS A;  5EWC A;  4XY8 A;  4QSW A;  3U5N A;  5H1T A;  4PTB A;  3LQH A;  5IG6 A;  3NG2 A;  3GL6 A;  3I3J A;  4WHW A;  4FJC A;  5F36 A;  3ZVY A;  1WIM A;  4FK5 A;  2PNX A;  3C5K A;  3T6R A;  4X3G A;  3ZPV E;  2Y43 A;  4X2I A;  4QF2 A;  4QR3 A;  3ZVZ B;  3LQI A;  3SVF A;  2FUU A;  5TRB A;  2I50 A;  3G0J A;  4Z6I A;  5D25 A;  5D3S A;  5JWM A;  3GG3 A;  2L85 A;  4QNS A;  4O76 A;  3JVL A;  5KTW A;  4S3O C;  4HBY A;  5EU1 A;  5F61 A;  1WEW A;  5G0F A;  4QSS A;  5CQ4 A;  4FO9 A;  4QBM A;  4BW1 A;  3MB4 A;  3UVX A;  1VFY A;  1Z6U A;  4NRB A;  2LV9 A;  4HXM A;  5DYX A;  3M63 A;  5FER A;  2YEK A;  5L99 A;  2MIQ A;  4A9F A;  4YYM A;  1G25 A;  1MM2 A;  5D24 A;  4KV4 A;  3O34 A;  4CA1 A;  3MQM A;  5IGL A;  2I7K A;  4L7X A;  1JM4 B;  2MJV B;  2K16 A;  1VYX A;  4ZC9 A;  5EYA F;  4MR6 A;  5FB1 A;  4AVX A;  4ZDT A;  2ECW A;  4GPJ A;  4CLB A;  4O7E A;  3RPG C;  3LQJ A;  1WES A;  2FUI A;  5E9M A;  5A7C A;  3MHH A;  5TCM A;  5TBN A;  4CUT A;  3Q2E A;  3MUK A;  2JMD A;  2Y1M A;  4PS5 A;  4XI1 A;  5FG6 A;  4WIV A;  5A5Q A;  3SOW A;  5DYC A;  4Q0O A;  4BHW A;  2XEU A;  4J0R A;  4QSP A;  4MEN A;  5KHM A;  5C85 A;  2F42 A;  4QR4 A;  4TS8 A;  4YAD A;  4LZ2 A;  2R0Y A;  4BW2 A;  4HXL A;  5HCL A;  5LCW B;  2CKL B;  1RMD A;  5EWV A;  4PKL A;  2MA5 A;  5JG6 A;  5I89 A;  3QZV A;  5ENH A;  5EQ1 A;  2VPB A;  4QUT A;  5FDZ A;  4IR5 A;  5FE2 A;  3U5P A;  2H0D A;  2L43 A;  2VJF A;  2LXH C;  4S3O B;  5FE7 A;  2VP7 A;  3DPL R;  2G6Q A;  1XWH A;  3P5O A;  3O36 A;  3HME A;  5I29 A;  2VPD A;  4UP5 A;  5KTU A;  4MEQ A;  3HMH A;  2YW8 A;  4CUU A;  5CUE A;  2DVR A;  4WA6 A;  1Z2Q A;  2MD8 C;  2RO1 A;  4AUQ B;  5HRW A;  3Q2F A;  5D1M B;  5DW2 A;  4BW4 A;  1N87 A;  3DQV R;  4J0S A;  4QYD A;  4IR6 A;  5EWD A;  4ZUX U;  5DLZ A;  2WP2 A;  4DON A;  5FE1 A;  4LYW A;  4NRC A;  1FBV A;  2LRI C;  2YHO A;  5A82 A;  2E7O A;  5FE4 A;  5I88 A;  3HMF A;  4I7D A;  5J0D A;  2H0D B;  4TU6 A;  2R0V A;  4KCX A;  2RI7 A;  2KGI A;  5EGU A;  3EB5 A;  3S91 A;  4TTE A;  5BT3 A;  1T1H A;  5EIC A;  3SHB A;  1WEO A;  3KNV A;  4A9K A;  1WEQ A;  5TB6 A;  4BW3 A;  2HDP A;  2YRE A;  4WZ2 A;  1E4U A;  4NYV A;  2YSM A;  3IU5 A;  4CUP A;  5D3N A;  3UV4 A;  2L0B A;  2YQM A;  4O64 A;  1WEV A;  4C67 A;  5H1V A;  4N4G A;  4LYS A;  2ECI A;  2KR4 A;  5DFB A;  1HYJ A;  3SOU A;  5ACY A;  3ASL A;  4I7C A;  1WGM A;  3O33 A;  2YUC A;  4TT2 A;  5CRM A;  3ZTG A;  1WEP A;  4TT6 A;  4NUE A;  2DVV A;  5IGM A;  3MXF A;  4IOR A;  2RS9 B;  5LKX A;  3T7L A;  4GNF A;  5BT5 A;  5HFQ A;  2OSS A;  4OGI A;  2M85 A;  1BOR A;  2MD7 B;  2LGG A;  5FBX A;  4MVT A;  4Z1Q A;  2G43 A;  2EA6 A;  5E9K A;  5G05 B;  4LDF A;  3V43 A;  2LGL A;  3DAI A;  1EQF A;  2YQD A;  3JVK A;  4LK9 A;  5EP7 A;  4R7E A;  2YT5 A;  5A5S A;  2DWW A;  2Y1N A;  2NXB A;  5CUA A;  4LKA A;  3QZT A;  1Z60 A;  5TDW A;  5L96 A;  5FE6 A;  4A4C A;  5FH6 A;  2C2V S;  4B7Y C;  4UYF A;  5HRV A;  4HXO A;  5D1K B;  5EWH A;  4O7A A;  2E3K A;  2K17 A;  2L84 A;  2KFT A;  4UI9 B;  5C11 A;  2YW5 A;  5B76 A;  3EB6 A;  2OXQ C;  1WEM A;  4R2Y A;  4UIV A;  4CUS A;  5L8U A;  1JM7 A;  1WUG A;  2R0S A;  4UIY A;  3N9Q A;  3N9O A;  5A5O A;  3M62 A;  2L5E A;  2LXP C;  4HBX A;  2GRC A;  3O7A A;  4V3L C;  5FE8 A;  3U5O A;  5HFR A;  2KGG A;  5EVA A;  5I86 A;  5COI A;  5F25 A;  4O7F A;  5F62 A;  2MUM A;  2KU3 A;  2QIZ A;  5D3L A;  2QIC A;  5F5Z A;  4QSU A;  5D3T A;  5KU3 A;  1WE9 A;  4LJN A;  3SVH A;  3RTR B;  5ETB A;  5DKA A;  1E6I A;  2VPG A;  5CRZ A;  5DYA A;  5HJC A;  2DVQ A;  2N9G A;  5EPS A;  3UVY A;  5DIN A;  4LAD B;  4QB3 A;  4A9J A;  3TLP A;  4YK0 A;  1X4U A;  4NYW A;  5C7N A;  4YYH A;  4QY4 A;  4IOQ A;  5D3H A;  5HEN A;  4QEU A;  2CKL A;  5CPE A;  2QJ0 A;  3L11 A;  5TDR A;  3SOX A;  4N4H A;  4NQN A;  4C9Z A;  5FFY A;  2RFJ A;  2RNW A;  4C66 A;  4CFL A;  4O71 A;  1X0J A;  5E9L A;  4F52 B;  4QEV A;  4A9E A;  2VJF B;  2AN6 A;  5A5N A;  2ECJ A;  5I80 A;  4TZ2 A;  2UZG A;  4IC3 A;  3PHD A;  4NUC A;  2KWN A;  4Z1S A;  1X4J A;  5AD3 A;  5DW1 A;  5CS8 A;  4N4F A;  5CQA A;  3ZPV 1;  4NR9 A;  4UIW A;  2YEM A;  4CL9 A;  5I40 A;  5ENF A;  1F68 A;  5EPR A;  2F6J A;  2VNF A;  5LJ1 A;  5HM0 A;  4UIZ A;  4N3W A;  2LN0 A;  5KH9 A;  5D0C A;  1ZS5 A;  3QZS A;  4A9H A;  5ETD A;  3IU6 A;  3U5J A;  3ZYU A;  2M3H A;  2D82 A;  5E0R A;  4MEP A;  4Z6H A;  4ZQL A;  5FFV A;  5KH3 A;  2DAT A;  4CUR A;  2FSA A;  5I83 A;  2D8S A;  3S92 A;  5II1 A;  2XB1 A;  5ENB A;  5IID A;  5B75 A;  4NQM A;  3G0L A;  3PUQ A;  3AAD A;  4HXN A;  4PCI A;  5D3R A;  4W4U A;  3I2D A;  4NR6 A;  4YC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...