4YATA

Crystal structure of trim24 phd-bromodomain complexed with n-(1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl)-4-methoxybenzene-1-sulfonamide (5b)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
173
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 173
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yatA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yatA01
4UIVA 5F5ZA 4YYHA 4N4FA 4O7EA 3T7LA 4QEWA 4LYIA 5FE1A 2RNXA 4LYWA 4NQMA 5EGUA 2C2VS 2VJEA 3SHBA 4X2IA 2LGVA 4XYAA 4MR4A 4QSVA 4J0SA 5A5PA 2I7KA 5F3AA 2YURA 5ENHA 4FK5A 4Q0OA 1F68A 4MEQA 3MXFA 5FH6A 2K16A 4UYFA 2RNWA 3P1EA 3Q2EA 5HRVA 4LC2A 5DBMA 4O7BA 1JM4B 5D3SA 4QYLA 2YSJA 5C89A 2WP1A 5E74A 5F36A 4QC3A 4YY4A 5AIUA 4IR4A 5TB6A 3I3JA 5FB0A 5HJCA 2BAYA 3DPLR 3ZYUA 2G6QA 5HLSA 4QEUA 5E9LA 4YH3A 5IG6A 3PUQA 4NR8A 5C8GA 4ZW1A 4B7YC 4R2YA 1WEUA 5DKDA 5FE8A 2LXPC 4ALHA 5KO4A 1LDKC 5I7XA 5FERA 4GB0A 5LVRA 4WZ3B 4O7AA 2EGPA 3MB3A 3U5PA 5CUAA 4QYDA 5EI4A 4GNDA 2VNFA 3GV4A 5L99A 4NUEA 1WEMA 3RPGC 2FSAA 4CURA 2KWNA 3UV4A 2DVQA 4CL9A 4CUPA 5F1LA 5CQ4A 5FFVA 3U5KA 3MHSA 5G05B 2L5UA 4S3OB 4LZRA 2JMDA 4YATA 5CU8A 4YBSA 3DAIA 5AD3A 4NQNA 5ETDA 4NRCA 4TU6A 1N87A 3K2JA 2RFJA 1Z60A 2K17A 4QC1A 5HQ5A 5D1MB 4LDFA 2MD8C 5G04B 4O70A 4Z1SA 3RPGB 1VD4A 4ZC9A 5EV9A 1ZS5A 3RCWA 4YAXA 5A81A 5HFQA 4V3LC 2I50A 5EP7A 1WEEA 3LQIA 3AQAA 4YC9A 3FL2A 3PHDA 5C11A 2LSPB 5E9IA 5A5QA 4X3GA 4N3WA 5AITA 4WIVA 4NRBA 4RVRA 4YYIA 5CUCA 5I1QA 1JOCA 3HCTA 3L1ZB 5TRBA 5C13A 4UYHA 4YBTA 5HM0A 2D82A 4TQNA 3IU5A 4MR6A 5IGMA 3HMHA 5EPRA 5EVAA 5IGKA 4L58A 4YYGA 5I89A 5EPBA 5HFRA 4HXMA 4BW4A 4WHUA 5F1HA 5CQ5A 5I80A 5IIDA 4A9OA 5L96A 1MM2A 2CT2A 4AP4A 5EWCA 5FE3A 2YQMA 4J1PA 5H9MA 2L43A 5D3HA 3JVLA 2XEUA 2L5EA 2K4DA 5JWMA 4WHWA 4J0RA 2M1RA 2KYUA 4YYNA 4OUFA 4LZSA 5A85A 2JMJA 5B75A 3N9MA 4QSXA 4A4CA 2F6NA 5FH8A 5D25A 1X4JA 2LXHC 4IOOA 5B77A 3SOUA 5A5SA 3U5JA 4BBQA 4FJCA 2DATA 2E6RA 2I8NA 2DKWA 3P1DA 4P5OB 5CQAA 2XB1A 5I83A 2E6SA 5F25A 4TU4A 5FFYA 4BW1A 5FE5A 1VFYA 4N4IA 2FUUA 5EU1A 3DQVR 3N9PA 4LLBA 2YUCA 4YADA 5E0RA 2KFTA 2RSDA 4UIYA 3LQJA 3P5OA 3HCSA 1HYIA 4R7EA 5TDRA 2HYED 3D7CA 2UZGA 4YABA 2Y1MA 4QZSA 5K29A 5B8DA 4J3IA 4C9ZA 4GNFA 2QJ0A 5D3NA 1Z2QA 3MUKA 4A4BA 5LKUA 4TTEA 4XUAA 1WUGA 4TT4A 4QF2A 4XY8A 3MB4A 4HXNA 4MSXA 4NS5A 4CFKA 5E7DA 3O35A 5EISA 1FP0A 2H60A 1JSPB 3ZTGA 5CRMA 4GNEA 5D3PA 5EK9A 4NXJA 5ENEA 5BT3A 2LN0A 5KH9A 4HXOA 4QUTA 4NR5A 5EM3A 2RNYA 4NUCA 4PCEA 5LJ0A 5DKAA 3T6RA 4YYMA 4I7BA 5F63A 4IR3A 5EICA 4LJNA 5C7NA 1X4UA 5DFDA 4AKNA 3O70A 4A9LA 3C5KA 4O74A 5C4QA 4ALGA 2VPGA 5DX4A 1N72A 1WE9A 1WFKA 5F2PA 1CHCA 1K2FA 4Q6FA 3ZNIA 5DINA 5IBNA 2KGIA 4TS8A 5L8TA 2M85A 5F60A 3KQIA 5HCLA 4A0CD 5CUDA 3M62A 3V43A 4IR6A 4UIXA 4LK9A 4TZ2A 3UV5A 5DKHA 4HXRA 2L0BA 5JG6A 2R0YA 1WUMA 3DWYA 4YY6A 3QZSA 3S91A 1JM7B 4NUDA 1BORA 3L1XA 3M99A 5A83A 2IDAA 4HXPA 5E9VA 5LVQA 2CKLB 5H85A 5LCWB 3ZYQA 2ECTA 4UIWA 2CSYA 4V3KC 4WZ2A 5CQ6A 5CPEA 5CQTA 2RI7A 4C66A 4YYJA 5DYUA 2VJFB 5LUUA 5DYXA 5FE6A 5FFWA 4O71A 4CUSA 4CA1A 2F6JA 4YBMA 2KGGA 4CFLA 2N9GA 2ECJA 2YELA 5CTLA 4FLPA 2D8SA 2ZETC 2DVSA 4NR7A 1Z6UA 5ENBA 4XI1A 5KTXA 2KE1A 4I7CA 5E9YA 4NYWA 2KU3A 2DWWA 4QBMA 4IR5A 4TZ8A 4UIZA 5CUGA 5FE9A 5I40A 3O7AA 2OO1A 5LJ1A 2YU4A 4CUUA 4LR6A 5TABA 4IOQA 5AMEA 1WEOA 2YYNA 3SVHA 5DYCA 2YW8A 4O7FA 5G4RA 4HBYA 4XY9A 2R10A 2F42A 4QF3A 2C2LA 4HXLA 4F3IA 3TLPA 4BW2A 3HTKC 4UYEA 5A5OA 4GPJA 1WEQA 2D9EA 3LQHA 2LRIC 5JI8A 2YDWA 5CQ3A 4UIUA 2H0DB 2YHOA 1XWHA 1E4UA 5J3XA 3SVFA 2MUMA 5E73A 5HENA 2G45A 4ZDTA 1V87A 2PUYA 4QSSA 2DX8A 2MNZA 5DFCA 2KTBB 3O33A 3UVWA 4YYDA 2E3KA 5A5RA 4LRGA 5BT5A 5J0DA 5I3LA 5HRWA 5LKTA 4PKLA 2L84A 1EQFA 4YYKA 5ENFA 2VJEB 4AUQB 4MENA 4DONA 5B78A 5LKXA 3KV5A 5CQ7A 5ACYA 1WENA 5D3TA 4HBWA 3HMEA 5DKCA 5IGNA 2KWJA 2OUOA 5FEYA 5AD2A 3QZTA 2CSZA 4UYFB 4QSQA 5FE7A 2YEMA 3VK6A 3P1FA 4Z1QA 2LDRA 4UP0A 2ECNA 3HMFA 3L11A 4O77A 4UYDA 2MIQA 3KV6A 4A9JA 4NR4A 1DVPA 3S92A 5COIA 4BJXA 4QSUA 4CUQA 4XUBA 2JMIA 4O7CA 3IU6A 2RO1A 3N9NA 3N9LA 3JVJA 3MQMA 5L8UA 2RS9B 2MJVB 2YW5A 3UVYA 4LKAA 2DVVA 5D3LA 2MT5A 4B86C 4WZ0A 4HXSA 3SVGA 5ENJA 5II1A 5FE4A 5CP5A 3ZVZB 4O72A 3U5OA 3N9QA 4W4UA 2MD7B 5II2A 5LKZA 5G0FA 4HBVA 3Q2FA 4L7XA 5HELA 3G0JA 4WA6A 2LGLA 4A9MA 1WGMA 2VP7A 4QR5A 5H1VA 4A9EA 1WEPA 5B76A 4MVTA 4KV1A 4Z6IA 2HDPA 2YREA 4C67A 5HQ6A 5E3DA 2YT5A 5D3RA 4OGJA 4QSRA 3SOWA 4LZ2A 5F61A 4A49A 2VPDA 5D7XA 4ZUXU 1T1HA 4QSTA 5I88A 2KWKA 1U6GB 5EWWA 4IC3A 4Y03A 5HEMA 2OSSA 4PPEA 3P1CA 5L98A 4N4GA 5CUBA 4AVXA 2L75A 2M6MA 2LV9A 2ECWA 3IHPA 3ONIA 4IORA 4TT2A 2R0SA 3G0LA 3UV2A 4QNSA 4CLBA 3JVMA 5I7YA 2LQ6A 5TBNA 4QSPA 5DLZA 3UVDA 4QSWA 3O36A 2MA6A 5A82A 5FG6A 3O37A 1IYMA 5DYAA 3M63A 5EPSA 5F62A 2NXBA 1E6IA 5FDZA 2G4AA 5DW1A 5E3GA 2MNYA 1X0JA 2YEKA 5CGPA 4FO9A 2NAAA 3C6WA 4A9HA 2L80A 3LJWA 4TYLA 5FE2A 4NYVA 4S3OC 4TT6A 4HXKA 5IGLA 3FKMX 2KWOA 2Y43A 4QUUA 5DY7A 3LRQA 5C85A 5CY9A 5CRZA 4E96A 4Q0NA 4A9KA 2DVRA 4NR6A 4PS5A 5D0CA 5AMFA 5CQ8A 2FUIA 4QR3A 1X4IA 2KIZA 5TCMA 3PURA 1WESA 4LADB 3O34A 4NN2A 3AADA 2YQLA 3KNVA 3MHHA 4KV4A 1HYJA 4A9IA 2L85A 1RMDA 3U5MA 4QR4A 3MULA 5H1TA 3QZVA 5EWHA 4BW3A 2WP2A 4MR5A 4Z6HA 3I2DA 5D3JA 2AN6A 2QIZA 5FE0A 4IC2A 2ECIA 4O64A 4MR3A 4O75A 1VYXA 5BT4A 3NXBA 2G43A 2EA6A 4PTBA 5ENCA 5D1LB 3GL6A 3ASLA 5EYAF 4LYSA 1ZBDB 5E9KA 1LDJB 3U5NA 5B79A 4OGIA 4UITA 4R8PK 2YHNA 4QB3A 5HRXA 4PCIA 5H1UA 2QICA 4AYCB 5D26A 1WEVA 5D1KB 3N9OA 2E7OA 2MA5A 4BHWA 5DW2A 5KTWA 4FIPA 5CS8A 4O78A 4NRAA 5A7CA 4Z93A 5FH7A 4QY4A 5ENGA 5KHMA 2YSMA 5KH3A 5ENIA 1F62A 1JM7A 4GNGA 5C87A 3LXJA 5CUEA 2JRJA 4N4HA 1FBVA 5EWDA 2K1JA 5KH7A 5CZGA 4F52B 2CKLA 2E7NA 4YH4A 5FG4A 4A9FA 2YQDA 5HQ7A 5A5NA 4A9NA 5TDWA 3EB5A 3ZPV1 3SOXA 5ETBA 4YK0A 2VJFA 5EA1A 4ZQLA 4PY6A 5EWVA 2GRCA 5CFWA 5G4SA 3UW9A 2Y1NA 2LGGA 3JVKA 3NG2A 4MEOA 2KREA 4QEVA 3HCUA 4HBXA 2M3HA 4UP5A 3U5LA 5KTUA 5I86A 4UYGA 1WIMA 5FB1A 1WEWA 4KCXA 4O76A 4MEPA 2OXQC 5E9MA 5LJ2A 1MM3A 5FG5A 2R0VA 5KU3A 2EODA 3ZVYA 2YYRA 5DFBA 4TKPB 1WILA 3GG3A 3ZPVE 3EB6A 5EQ1A 2VPEA 4UI9B 3RTRB 5DLXA 4CUTA 4NR9A 4NYXA 4I7DA 5FBXA 1G25A 2H0DA 2KR4A 4AYCA 5L97A 2ECVA 3UVXA 5I29A 2LGKA 2PNXA 4CCGX 2VPBA 5D24A 2ECGA
chains in the Genus database with same CATH superfamily
4UIVA 5F5ZA 4YYHA 4N4FA 4O7EA 3T7LA 4QEWA 4LYIA 5FE1A 2RNXA 4LYWA 3D1DA 4NQMA 5EGUA 2C2VS 2VJEA 4X2IA 3SHBA 2LGVA 4XYAA 4MR4A 4QSVA 4J0SA 5A5PA 2I7KA 5F3AA 2YURA 5ENHA 4FK5A 4Q0OA 1F68A 4MEQA 3MXFA 5FH6A 2K16A 4UYFA 2RNWA 3P1EA 3Q2EA 5HRVA 4LC2A 2DJAA 5DBMA 4O7BA 1JM4B 5D3SA 4QYLA 2YSJA 5C89A 2WP1A 5E74A 5F36A 2JUNA 4QC3A 4YY4A 3FANA 5AIUA 4IR4A 5TB6A 3VKHA 3I3JA 2RR4A 5FB0A 5HJCA 2BAYA 3DPLR 3ZYUA 3H7HA 2G6QA 5HLSA 4Z0OA 4QEUA 5E9LA 4YH3A 5IG6A 3PUQA 4NR8A 5C8GA 4ZW1A 4B7YC 4R2YA 1WEUA 5DKDA 5FE8A 2LXPC 4ALHA 5KO4A 1LDKC 5I7XA 5FERA 4GB0A 5LVRA 4WZ3B 4O7AA 2EGPA 3MB3A 3U5PA 5CUAA 4QYDA 5EI4A 4GNDA 2VNFA 3GV4A 5L99A 4NUEA 1WEMA 3RPGC 3T9KA 2FSAA 4CURA 1MBMA 2KWNA 3UV4A 2DVQA 4CL9A 4CUPA 5F1LA 5CQ4A 5FFVA 3U5KA 3MHSA 3O47A 2L5UA 4S3OB 4LZRA 5G05B 2JMDA 4YATA 5CU8A 4YBSA 3DAIA 5AD3A 4NQNA 5ETDA 4NRCA 4TU6A 1N87A 3K2JA 2RFJA 1Z60A 2K17A 4QC1A 5HQ5A 5D1MB 4LDFA 2EJNA 2MD8C 5G04B 4O70A 4Z1SA 3RPGB 1VD4A 4ZC9A 5EV9A 1ZS5A 3RCWA 4YAXA 5A81A 5HFQA 4V3LC 2I50A 5EP7A 1WEEA 3LQIA 3AQAA 4YC9A 3FL2A 3PHDA 5C11A 2LSPB 5E9IA 5A5QA 4X3GA 4N3WA 5AITA 2LAUA 4WIVA 4NRBA 4RVRA 4YYIA 5CUCA 5I1QA 1JOCA 3HCTA 2YVRA 3L1ZB 5TRBA 5C13A 4UYHA 4YBTA 5HM0A 2D82A 4TQNA 3IU5A 4MR6A 5IGMA 3HMHA 5EPRA 3LVRE 5EVAA 5IGKA 4L58A 4YYGA 5I89A 5EPBA 5HFRA 4AI6A 4HXMA 4BW4A 4WHUA 5F1HA 5CQ5A 5I80A 5IIDA 4A9OA 5L96A 1MM2A 2CT2A 4AP4A 5EWCA 5FE3A 2YQMA 4J1PA 5H9MA 2L43A 5D3HA 3JVLA 2XEUA 2L5EA 2K4DA 5JWMA 4WHWA 3M7KA 4J0RA 2M1RA 2KYUA 4YYNA 4OUFA 4LZSA 5A85A 2JMJA 5B75A 3N9MA 4QSXA 4A4CA 2F6NA 5FH8A 5D25A 1X4JA 2LXHC 4IOOA 5B77A 3SOUA 4H9DA 5A5SA 3U5JA 4BBQA 4FJCA 2DATA 2E6RA 2I8NA 2DKWA 3P1DA 4P5OB 5CQAA 2XB1A 5I83A 2E6SA 5F25A 4TU4A 5FFYA 4BW1A 5FE5A 1VFYA 4N4IA 2FUUA 3LDYA 5EU1A 3DQVR 3N9PA 4LLBA 2YUCA 4YADA 5E0RA 2KFTA 2RSDA 4UIYA 3LQJA 3P5OA 3HCSA 1HYIA 4R7EA 5TDRA 2HYED 3D7CA 2P57A 2UZGA 4YABA 3FJUB 2Y1MA 4QZSA 5K29A 5B8DA 4J3IA 2IQJA 4C9ZA 4GNFA 2EXUA 2QJ0A 5D3NA 1Z2QA 2FD4A 3MUKA 4A4BA 5LKUA 4TTEA 2CRRA 4XUAA 2XOYA 1WUGA 4TT4A 4QF2A 4XY8A 3MB4A 4HXNA 4MSXA 4NS5A 4O62A 4CFKA 5E7DA 3O35A 5EISA 1FP0A 2H60A 1JSPB 3ZTGA 5CRMA 4GNEA 5D3PA 5EK9A 4NXJA 5ENEA 5BT3A 2B0OE 2LN0A 5KH9A 5SVXA 4HXOA 4QUTA 4NR5A 5EM3A 3VKGA 2CSVA 2RNYA 4NUCA 4PCEA 5LJ0A 5DKAA 3T6RA 4YYMA 4I7BA 5F63A 4IR3A 5EICA 4LJNA 5C7NA 1X4UA 5DFDA 4AKNA 3O70A 5SVYA 4A9LA 3C5KA 4O74A 5C4QA 4ALGA 2VPGA 5DX4A 1N72A 1WE9A 1WFKA 5F2PA 1CHCA 1K2FA 4Q6FA 3ZNIA 5DINA 5IBNA 2KGIA 4TS8A 5L8TA 2M85A 5F60A 3KQIA 5HCLA 4A0CD 5CUDA 3M62A 3V43A 4IR6A 4UIXA 4LK9A 4TZ2A 3UV5A 5DKHA 4HXRA 2L0BA 4OGEA 2R0YA 5JG6A 1WUMA 3DWYA 4YY6A 3QZSA 3S91A 1JM7B 4NUDA 1BORA 3L1XA 3M99A 5A83A 2IDAA 4HXPA 5E9VA 5LVQA 2CKLB 5H85A 5LCWB 3ZYQA 2ECTA 4UIWA 2CSYA 4V3KC 4WZ2A 5CQ6A 5CPEA 5CQTA 2RI7A 4C66A 4YYJA 5DYUA 2VJFB 5LUUA 5DYXA 5FE6A 5FFWA 4QQ4A 4O71A 4CUSA 4CA1A 2F6JA 4YBMA 2KGGA 4CFLA 2N9GA 2ECJA 3KDEC 2YELA 5CTLA 4FLPA 2D8SA 2ZETC 2DVSA 4NR7A 1Z6UA 5ENBA 4XI1A 5KTXA 2KE1A 4I7CA 5E9YA 4NYWA 2KU3A 2DWWA 4QBMA 4IR5A 4TZ8A 4UIZA 5CUGA 5FE9A 1DCQA 5I40A 3FEHA 3O7AA 2OO1A 5LJ1A 2YU4A 4CUUA 4LR6A 5TABA 4IOQA 5AMEA 1WEOA 2YYNA 3SVHA 5DYCA 2YW8A 4O7FA 5G4RA 4HBYA 4XY9A 2R10A 2F42A 4QF3A 2C2LA 2E61A 4HXLA 4F3IA 3TLPA 4BW2A 3HTKC 5SVIB 4UYEA 5A5OA 4GPJA 1WEQA 2D9EA 3LQHA 2LRIC 5JI8A 2YDWA 5CQ3A 4UIUA 2H0DB 2YHOA 1XWHA 2OWAA 1E4UA 5J3XA 3SVFA 2JM3A 2MUMA 5E73A 5HENA 2G45A 4ZDTA 1V87A 2PUYA 4QSSA 2DX8A 2MNZA 5DFCA 2KTBB 3O33A 3UVWA 4YYDA 2E3KA 5A5RA 4LRGA 5BT5A 5J0DA 5I3LA 5HRWA 5LKTA 4PKLA 2L84A 1EQFA 4YYKA 3SUBA 5ENFA 3DDTA 3MDBC 2VJEB 4AUQB 4MENA 4DONA 5B78A 5LKXA 3KV5A 5CQ7A 5ACYA 1WENA 5D3TA 4HBWA 3HMEA 5DKCA 5IGNA 2KWJA 2OUOA 5FEYA 5AD2A 3QZTA 2CSZA 4UYFB 4QSQA 5FE7A 2YEMA 3VK6A 3P1FA 4Z1QA 2LDRA 4UP0A 4AKIA 3HMFA 2ECNA 3L11A 3DWDA 4O77A 4UYDA 2MIQA 3KV6A 4A9JA 4NR4A 1DVPA 3S92A 5COIA 4BJXA 4QSUA 4CUQA 4XUBA 2JMIA 4O7CA 3IU6A 2RO1A 3N9NA 3N9LA 3JVJA 3MQMA 5L8UA 3PLWA 2RS9B 2MJVB 2YW5A 3UVYA 4LKAA 2DVVA 5D3LA 2MT5A 4B86C 4WZ0A 4HXSA 3SVGA 5ENJA 5II1A 5FE4A 5CP5A 2KKYA 3ZVZB 2KKXA 4O72A 3U5OA 3N9QA 4W4UA 2MD7B 5II2A 5LKZA 5G0FA 4HBVA 3Q2FA 4L7XA 5HELA 3G0JA 4WA6A 2LGLA 4A9MA 1WGMA 2VP7A 4QR5A 5H1VA 4A9EA 1WEPA 5B76A 4MVTA 4KV1A 4Z6IA 2HDPA 2YREA 4C67A 5HQ6A 5E3DA 2YT5A 5D3RA 4OGJA 4QSRA 3SOWA 4LZ2A 5F61A 4A49A 2VPDA 5D7XA 4ZUXU 1T1HA 4QSTA 5I88A 2KWKA 1U6GB 5EWWA 4IC3A 4Y03A 5HEMA 2OSSA 4PPEA 3P1CA 5L98A 4N4GA 5CUBA 4AVXA 2L75A 2M6MA 2LV9A 2ECWA 3IHPA 3ONIA 4IORA 4TT2A 2R0SA 3G0LA 3UV2A 4QNSA 4CLBA 3JVMA 4AKHA 5I7YA 2LQ6A 5TBNA 4QSPA 5DLZA 3UVDA 4QSWA 3O36A 2MA6A 2D8UA 5A82A 5FG6A 3O37A 1IYMA 5DYAA 3M63A 5EPSA 5F62A 2NXBA 1E6IA 5FDZA 2G4AA 5DW1A 5E3GA 3D1BA 2MNYA 4OGCA 2FFWA 1X0JA 2YEKA 5CGPA 4FO9A 2NAAA 3C6WA 4A9HA 2L80A 3LJWA 4TYLA 5FE2A 4NYVA 4S3OC 4TT6A 4HXKA 5IGLA 3FKMX 2KWOA 2Y43A 4QUUA 5DY7A 2L7PA 3JUEA 4AKGA 1PUOA 3LRQA 5C85A 5CY9A 5CRZA 4E96A 4Q0NA 4A9KA 2DVRA 2XP0A 4NR6A 4PS5A 5D0CA 5AMFA 5CQ8A 2FUIA 2CRWA 4QR3A 1X4IA 2KIZA 5TCMA 3PURA 1WESA 4LADB 3O34A 4NN2A 3AADA 2YQLA 3KNVA 3MHHA 4KV4A 2CONA 1HYJA 4A9IA 2L85A 1RMDA 3U5MA 4QR4A 5K3QA 3MULA 5H1TA 3QZVA 2XOZA 5EWHA 4BW3A 2WP2A 4MR5A 4Z6HA 3I2DA 5D3JA 2AN6A 2QIZA 5FE0A 4IC2A 2ECIA 4O64A 4MR3A 4O75A 1VYXA 5BT4A 3NXBA 2G43A 2MKEA 2EA6A 4PTBA 5ENCA 5D1LB 3GL6A 3ASLA 5EYAF 4LYSA 1ZBDB 3LJUX 5E9KA 1LDJB 3U5NA 3Q1DA 5B79A 4OGIA 4UITA 4R8PK 2YHNA 4QB3A 5HRXA 3FAOA 4PCIA 5H1UA 2QICA 4AYCB 5D26A 1WEVA 5D1KB 3N9OA 2E7OA 2MA5A 4BHWA 5DW2A 5KTWA 4FIPA 3ERRA 4O78A 4NRAA 5CS8A 5A7CA 4Z93A 5FH7A 4QY4A 5ENGA 5KHMA 2YSMA 5KH3A 5ENIA 1F62A 1JM7A 4GNGA 5C87A 3LXJA 5CUEA 2JRJA 4N4HA 1FBVA 5EWDA 2K1JA 5KH7A 5CZGA 4F52B 2CKLA 2E7NA 4YH4A 5FG4A 4A9FA 2YQDA 5HQ7A 4F1PA 5A5NA 4A9NA 5TDWA 3EB5A 3ZPV1 3SOXA 5ETBA 4YK0A 2VJFA 5EA1A 4ZQLA 4PY6A 5EWVA 2GRCA 5CFWA 5G4SA 3UW9A 2Y1NA 2LGGA 3JVKA 3NG2A 4MEOA 2KREA 4QEVA 3HCUA 4HBXA 2M3HA 4UP5A 3U5LA 5KTUA 5I86A 4UYGA 1WIMA 5FB1A 3LVQE 1WEWA 4KCXA 4O76A 4MEPA 2EGMA 1ZKRA 2OXQC 5E9MA 5LJ2A 1MM3A 5FG5A 2DSMA 2R0VA 5KU3A 2EODA 3ZVYA 2YYRA 5DFBA 4TKPB 1WILA 3GG3A 3ZPVE 3EB6A 2XOCA 5EQ1A 2VPEA 4UI9B 3RTRB 5SVIA 3E2DA 5DLXA 4CUTA 4NR9A 4NYXA 4I7DA 5FBXA 1G25A 2H0DA 2KR4A 2M13A 4AYCA 5L97A 2ECVA 3UVXA 5I29A 4Z0RA 2LGKA 2PNXA 4CCGX 3FM8C 2VPBA 5D24A 2ECGA
chains in the Genus database with same CATH topology
4UIVA 5F5ZA 4YYHA 4N4FA 4O7EA 3T7LA 4QEWA 4LYIA 5FE1A 2RNXA 4LYWA 4NQMA 5EGUA 2C2VS 2VJEA 3SHBA 4X2IA 2LGVA 4XYAA 4MR4A 4QSVA 4J0SA 5A5PA 2I7KA 5F3AA 2YURA 5ENHA 4FK5A 4Q0OA 1F68A 4MEQA 3MXFA 5FH6A 2K16A 4UYFA 2RNWA 3P1EA 3Q2EA 5HRVA 4LC2A 5DBMA 4O7BA 1JM4B 5D3SA 4QYLA 2YSJA 5C89A 2WP1A 5E74A 5F36A 4QC3A 4YY4A 5AIUA 4IR4A 5TB6A 3I3JA 5FB0A 5HJCA 2BAYA 3DPLR 3ZYUA 2G6QA 5HLSA 4QEUA 5E9LA 4YH3A 5IG6A 3PUQA 4NR8A 5C8GA 4ZW1A 4B7YC 4R2YA 1WEUA 5DKDA 5FE8A 2LXPC 4ALHA 5KO4A 1LDKC 5I7XA 5FERA 4GB0A 5LVRA 4WZ3B 4O7AA 2EGPA 3MB3A 3U5PA 5CUAA 4QYDA 5EI4A 4GNDA 2VNFA 3GV4A 5L99A 4NUEA 1WEMA 3RPGC 2FSAA 4CURA 2KWNA 3UV4A 2DVQA 4CL9A 4CUPA 5F1LA 5CQ4A 5FFVA 3U5KA 3MHSA 5G05B 2L5UA 4S3OB 4LZRA 2JMDA 4YATA 5CU8A 4YBSA 3DAIA 5AD3A 4NQNA 5ETDA 4NRCA 4TU6A 1N87A 3K2JA 2RFJA 1Z60A 2K17A 4QC1A 5HQ5A 5D1MB 4LDFA 2MD8C 5G04B 4O70A 4Z1SA 3RPGB 1VD4A 4ZC9A 5EV9A 1ZS5A 3RCWA 4YAXA 5A81A 5HFQA 4V3LC 2I50A 5EP7A 1WEEA 3LQIA 3AQAA 4YC9A 3FL2A 3PHDA 5C11A 2LSPB 5E9IA 5A5QA 4X3GA 4N3WA 5AITA 4WIVA 4NRBA 4RVRA 4YYIA 5CUCA 5I1QA 1JOCA 3HCTA 3L1ZB 5TRBA 5C13A 4UYHA 4YBTA 5HM0A 2D82A 4TQNA 3IU5A 4MR6A 5IGMA 3HMHA 5EPRA 5EVAA 5IGKA 4L58A 4YYGA 5I89A 5EPBA 5HFRA 4HXMA 4BW4A 4WHUA 5F1HA 5CQ5A 5I80A 5IIDA 4A9OA 5L96A 1MM2A 2CT2A 4AP4A 5EWCA 5FE3A 2YQMA 4J1PA 5H9MA 2L43A 5D3HA 3JVLA 2XEUA 2L5EA 2K4DA 5JWMA 4WHWA 4J0RA 2M1RA 2KYUA 4YYNA 4OUFA 4LZSA 5A85A 2JMJA 5B75A 3N9MA 4QSXA 4A4CA 2F6NA 5FH8A 5D25A 1X4JA 2LXHC 4IOOA 5B77A 3SOUA 5A5SA 3U5JA 4BBQA 4FJCA 2DATA 2E6RA 2I8NA 2DKWA 3P1DA 4P5OB 5CQAA 2XB1A 5I83A 2E6SA 5F25A 4TU4A 5FFYA 4BW1A 5FE5A 1VFYA 4N4IA 2FUUA 5EU1A 3DQVR 3N9PA 4LLBA 2YUCA 4YADA 5E0RA 2KFTA 2RSDA 4UIYA 3LQJA 3P5OA 3HCSA 1HYIA 4R7EA 5TDRA 2HYED 3D7CA 2UZGA 4YABA 2Y1MA 4QZSA 5K29A 5B8DA 4J3IA 4C9ZA 4GNFA 2QJ0A 5D3NA 1Z2QA 3MUKA 4A4BA 5LKUA 4TTEA 4XUAA 1WUGA 4TT4A 4QF2A 4XY8A 3MB4A 4HXNA 4MSXA 4NS5A 4CFKA 5E7DA 3O35A 5EISA 1FP0A 2H60A 1JSPB 3ZTGA 5CRMA 4GNEA 5D3PA 5EK9A 4NXJA 5ENEA 5BT3A 2LN0A 5KH9A 4HXOA 4QUTA 4NR5A 5EM3A 2RNYA 4NUCA 4PCEA 5LJ0A 5DKAA 3T6RA 4YYMA 4I7BA 5F63A 4IR3A 5EICA 4LJNA 5C7NA 1X4UA 5DFDA 4AKNA 3O70A 4A9LA 3C5KA 4O74A 5C4QA 4ALGA 2VPGA 5DX4A 1N72A 1WE9A 1WFKA 5F2PA 1CHCA 1K2FA 4Q6FA 3ZNIA 5DINA 5IBNA 2KGIA 4TS8A 5L8TA 2M85A 5F60A 3KQIA 5HCLA 4A0CD 5CUDA 3M62A 3V43A 4IR6A 4UIXA 4LK9A 4TZ2A 3UV5A 5DKHA 4HXRA 2L0BA 5JG6A 2R0YA 1WUMA 3DWYA 4YY6A 3QZSA 3S91A 1JM7B 4NUDA 1BORA 3L1XA 3M99A 5A83A 2IDAA 4HXPA 5E9VA 5LVQA 2CKLB 5H85A 5LCWB 3ZYQA 2ECTA 4UIWA 2CSYA 4V3KC 4WZ2A 5CQ6A 5CPEA 5CQTA 2RI7A 4C66A 4YYJA 5DYUA 2VJFB 5LUUA 5DYXA 5FE6A 5FFWA 4O71A 4CUSA 4CA1A 2F6JA 4YBMA 2KGGA 4CFLA 2N9GA 2ECJA 2YELA 5CTLA 4FLPA 2D8SA 2ZETC 2DVSA 4NR7A 1Z6UA 5ENBA 4XI1A 5KTXA 2KE1A 4I7CA 5E9YA 4NYWA 2KU3A 2DWWA 4QBMA 4IR5A 4TZ8A 4UIZA 5CUGA 5FE9A 5I40A 3O7AA 2OO1A 5LJ1A 2YU4A 4CUUA 4LR6A 5TABA 4IOQA 5AMEA 1WEOA 2YYNA 3SVHA 5DYCA 2YW8A 4O7FA 5G4RA 4HBYA 4XY9A 2R10A 2F42A 4QF3A 2C2LA 4HXLA 4F3IA 3TLPA 4BW2A 3HTKC 4UYEA 5A5OA 4GPJA 1WEQA 2D9EA 3LQHA 2LRIC 5JI8A 2YDWA 5CQ3A 4UIUA 2H0DB 2YHOA 1XWHA 1E4UA 5J3XA 3SVFA 2MUMA 5E73A 5HENA 2G45A 4ZDTA 1V87A 2PUYA 4QSSA 2DX8A 2MNZA 5DFCA 2KTBB 3O33A 3UVWA 4YYDA 2E3KA 5A5RA 4LRGA 5BT5A 5J0DA 5I3LA 5HRWA 5LKTA 4PKLA 2L84A 1EQFA 4YYKA 5ENFA 2VJEB 4AUQB 4MENA 4DONA 5B78A 5LKXA 3KV5A 5CQ7A 5ACYA 1WENA 5D3TA 4HBWA 3HMEA 5DKCA 5IGNA 2KWJA 2OUOA 5FEYA 5AD2A 3QZTA 2CSZA 4UYFB 4QSQA 5FE7A 2YEMA 3VK6A 3P1FA 4Z1QA 2LDRA 4UP0A 2ECNA 3HMFA 3L11A 4O77A 4UYDA 2MIQA 3KV6A 4A9JA 4NR4A 1DVPA 3S92A 5COIA 4BJXA 4QSUA 4CUQA 4XUBA 2JMIA 4O7CA 3IU6A 2RO1A 3N9NA 3N9LA 3JVJA 3MQMA 5L8UA 2RS9B 2MJVB 2YW5A 3UVYA 4LKAA 2DVVA 5D3LA 2MT5A 4B86C 4WZ0A 4HXSA 3SVGA 5ENJA 5II1A 5FE4A 5CP5A 3ZVZB 4O72A 3U5OA 3N9QA 4W4UA 2MD7B 5II2A 5LKZA 5G0FA 4HBVA 3Q2FA 4L7XA 5HELA 3G0JA 4WA6A 2LGLA 4A9MA 1WGMA 2VP7A 4QR5A 5H1VA 4A9EA 1WEPA 5B76A 4MVTA 4KV1A 4Z6IA 2HDPA 2YREA 4C67A 5HQ6A 5E3DA 2YT5A 5D3RA 4OGJA 4QSRA 3SOWA 4LZ2A 5F61A 4A49A 2VPDA 5D7XA 4ZUXU 1T1HA 4QSTA 5I88A 2KWKA 1U6GB 5EWWA 4IC3A 4Y03A 5HEMA 2OSSA 4PPEA 3P1CA 5L98A 4N4GA 5CUBA 4AVXA 2L75A 2M6MA 2LV9A 2ECWA 3IHPA 3ONIA 4IORA 4TT2A 2R0SA 3G0LA 3UV2A 4QNSA 4CLBA 3JVMA 5I7YA 2LQ6A 5TBNA 4QSPA 5DLZA 3UVDA 4QSWA 3O36A 2MA6A 5A82A 5FG6A 3O37A 1IYMA 5DYAA 3M63A 5EPSA 5F62A 2NXBA 1E6IA 5FDZA 2G4AA 5DW1A 5E3GA 2MNYA 1X0JA 2YEKA 5CGPA 4FO9A 2NAAA 3C6WA 4A9HA 2L80A 3LJWA 4TYLA 5FE2A 4NYVA 4S3OC 4TT6A 4HXKA 5IGLA 3FKMX 2KWOA 2Y43A 4QUUA 5DY7A 3LRQA 5C85A 5CY9A 5CRZA 4E96A 4Q0NA 4A9KA 2DVRA 4NR6A 4PS5A 5D0CA 5AMFA 5CQ8A 2FUIA 4QR3A 1X4IA 2KIZA 5TCMA 3PURA 1WESA 4LADB 3O34A 4NN2A 3AADA 2YQLA 3KNVA 3MHHA 4KV4A 1HYJA 4A9IA 2L85A 1RMDA 3U5MA 4QR4A 3MULA 5H1TA 3QZVA 5EWHA 4BW3A 2WP2A 4MR5A 4Z6HA 3I2DA 5D3JA 2AN6A 2QIZA 5FE0A 4IC2A 2ECIA 4O64A 4MR3A 4O75A 1VYXA 5BT4A 3NXBA 2G43A 2EA6A 4PTBA 5ENCA 5D1LB 3GL6A 3ASLA 5EYAF 4LYSA 1ZBDB 5E9KA 1LDJB 3U5NA 5B79A 4OGIA 4UITA 4R8PK 2YHNA 4QB3A 5HRXA 4PCIA 5H1UA 2QICA 4AYCB 5D26A 1WEVA 5D1KB 3N9OA 2E7OA 2MA5A 4BHWA 5DW2A 5KTWA 4FIPA 5CS8A 4O78A 4NRAA 5A7CA 4Z93A 5FH7A 4QY4A 5ENGA 5KHMA 2YSMA 5KH3A 5ENIA 1F62A 1JM7A 4GNGA 5C87A 3LXJA 5CUEA 2JRJA 4N4HA 1FBVA 5EWDA 2K1JA 5KH7A 5CZGA 4F52B 2CKLA 2E7NA 4YH4A 5FG4A 4A9FA 2YQDA 5HQ7A 5A5NA 4A9NA 5TDWA 3EB5A 3ZPV1 3SOXA 5ETBA 4YK0A 2VJFA 5EA1A 4ZQLA 4PY6A 5EWVA 2GRCA 5CFWA 5G4SA 3UW9A 2Y1NA 2LGGA 3JVKA 3NG2A 4MEOA 2KREA 4QEVA 3HCUA 4HBXA 2M3HA 4UP5A 3U5LA 5KTUA 5I86A 4UYGA 1WIMA 5FB1A 1WEWA 4KCXA 4O76A 4MEPA 2OXQC 5E9MA 5LJ2A 1MM3A 5FG5A 2R0VA 5KU3A 2EODA 3ZVYA 2YYRA 5DFBA 4TKPB 1WILA 3GG3A 3ZPVE 3EB6A 5EQ1A 2VPEA 4UI9B 3RTRB 5DLXA 4CUTA 4NR9A 4NYXA 4I7DA 5FBXA 1G25A 2H0DA 2KR4A 4AYCA 5L97A 2ECVA 3UVXA 5I29A 2LGKA 2PNXA 4CCGX 2VPBA 5D24A 2ECGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIV A;  5F5Z A;  4YYH A;  4N4F A;  4O7E A;  3T7L A;  4QEW A;  4LYI A;  5FE1 A;  2RNX A;  4LYW A;  4NQM A;  5EGU A;  2C2V S;  2VJE A;  3SHB A;  4X2I A;  2LGV A;  4XYA A;  4MR4 A;  4QSV A;  4J0S A;  5A5P A;  2I7K A;  5F3A A;  2YUR A;  5ENH A;  4FK5 A;  4Q0O A;  1F68 A;  4MEQ A;  3MXF A;  5FH6 A;  2K16 A;  4UYF A;  2RNW A;  3P1E A;  3Q2E A;  5HRV A;  4LC2 A;  5DBM A;  4O7B A;  1JM4 B;  5D3S A;  4QYL A;  2YSJ A;  5C89 A;  2WP1 A;  5E74 A;  5F36 A;  4QC3 A;  4YY4 A;  5AIU A;  4IR4 A;  5TB6 A;  3I3J A;  5FB0 A;  5HJC A;  2BAY A;  3DPL R;  3ZYU A;  2G6Q A;  5HLS A;  4QEU A;  5E9L A;  4YH3 A;  5IG6 A;  3PUQ A;  4NR8 A;  5C8G A;  4ZW1 A;  4B7Y C;  4R2Y A;  1WEU A;  5DKD A;  5FE8 A;  2LXP C;  4ALH A;  5KO4 A;  1LDK C;  5I7X A;  5FER A;  4GB0 A;  5LVR A;  4WZ3 B;  4O7A A;  2EGP A;  3MB3 A;  3U5P A;  5CUA A;  4QYD A;  5EI4 A;  4GND A;  2VNF A;  3GV4 A;  5L99 A;  4NUE A;  1WEM A;  3RPG C;  2FSA A;  4CUR A;  2KWN A;  3UV4 A;  2DVQ A;  4CL9 A;  4CUP A;  5F1L A;  5CQ4 A;  5FFV A;  3U5K A;  3MHS A;  5G05 B;  2L5U A;  4S3O B;  4LZR A;  2JMD A;  4YAT A;  5CU8 A;  4YBS A;  3DAI A;  5AD3 A;  4NQN A;  5ETD A;  4NRC A;  4TU6 A;  1N87 A;  3K2J A;  2RFJ A;  1Z60 A;  2K17 A;  4QC1 A;  5HQ5 A;  5D1M B;  4LDF A;  2MD8 C;  5G04 B;  4O70 A;  4Z1S A;  3RPG B;  1VD4 A;  4ZC9 A;  5EV9 A;  1ZS5 A;  3RCW A;  4YAX A;  5A81 A;  5HFQ A;  4V3L C;  2I50 A;  5EP7 A;  1WEE A;  3LQI A;  3AQA A;  4YC9 A;  3FL2 A;  3PHD A;  5C11 A;  2LSP B;  5E9I A;  5A5Q A;  4X3G A;  4N3W A;  5AIT A;  4WIV A;  4NRB A;  4RVR A;  4YYI A;  5CUC A;  5I1Q A;  1JOC A;  3HCT A;  3L1Z B;  5TRB A;  5C13 A;  4UYH A;  4YBT A;  5HM0 A;  2D82 A;  4TQN A;  3IU5 A;  4MR6 A;  5IGM A;  3HMH A;  5EPR A;  5EVA A;  5IGK A;  4L58 A;  4YYG A;  5I89 A;  5EPB A;  5HFR A;  4HXM A;  4BW4 A;  4WHU A;  5F1H A;  5CQ5 A;  5I80 A;  5IID A;  4A9O A;  5L96 A;  1MM2 A;  2CT2 A;  4AP4 A;  5EWC A;  5FE3 A;  2YQM A;  4J1P A;  5H9M A;  2L43 A;  5D3H A;  3JVL A;  2XEU A;  2L5E A;  2K4D A;  5JWM A;  4WHW A;  4J0R A;  2M1R A;  2KYU A;  4YYN A;  4OUF A;  4LZS A;  5A85 A;  2JMJ A;  5B75 A;  3N9M A;  4QSX A;  4A4C A;  2F6N A;  5FH8 A;  5D25 A;  1X4J A;  2LXH C;  4IOO A;  5B77 A;  3SOU A;  5A5S A;  3U5J A;  4BBQ A;  4FJC A;  2DAT A;  2E6R A;  2I8N A;  2DKW A;  3P1D A;  4P5O B;  5CQA A;  2XB1 A;  5I83 A;  2E6S A;  5F25 A;  4TU4 A;  5FFY A;  4BW1 A;  5FE5 A;  1VFY A;  4N4I A;  2FUU A;  5EU1 A;  3DQV R;  3N9P A;  4LLB A;  2YUC A;  4YAD A;  5E0R A;  2KFT A;  2RSD A;  4UIY A;  3LQJ A;  3P5O A;  3HCS A;  1HYI A;  4R7E A;  5TDR A;  2HYE D;  3D7C A;  2UZG A;  4YAB A;  2Y1M A;  4QZS A;  5K29 A;  5B8D A;  4J3I A;  4C9Z A;  4GNF A;  2QJ0 A;  5D3N A;  1Z2Q A;  3MUK A;  4A4B A;  5LKU A;  4TTE A;  4XUA A;  1WUG A;  4TT4 A;  4QF2 A;  4XY8 A;  3MB4 A;  4HXN A;  4MSX A;  4NS5 A;  4CFK A;  5E7D A;  3O35 A;  5EIS A;  1FP0 A;  2H60 A;  1JSP B;  3ZTG A;  5CRM A;  4GNE A;  5D3P A;  5EK9 A;  4NXJ A;  5ENE A;  5BT3 A;  2LN0 A;  5KH9 A;  4HXO A;  4QUT A;  4NR5 A;  5EM3 A;  2RNY A;  4NUC A;  4PCE A;  5LJ0 A;  5DKA A;  3T6R A;  4YYM A;  4I7B A;  5F63 A;  4IR3 A;  5EIC A;  4LJN A;  5C7N A;  1X4U A;  5DFD A;  4AKN A;  3O70 A;  4A9L A;  3C5K A;  4O74 A;  5C4Q A;  4ALG A;  2VPG A;  5DX4 A;  1N72 A;  1WE9 A;  1WFK A;  5F2P A;  1CHC A;  1K2F A;  4Q6F A;  3ZNI A;  5DIN A;  5IBN A;  2KGI A;  4TS8 A;  5L8T A;  2M85 A;  5F60 A;  3KQI A;  5HCL A;  4A0C D;  5CUD A;  3M62 A;  3V43 A;  4IR6 A;  4UIX A;  4LK9 A;  4TZ2 A;  3UV5 A;  5DKH A;  4HXR A;  2L0B A;  5JG6 A;  2R0Y A;  1WUM A;  3DWY A;  4YY6 A;  3QZS A;  3S91 A;  1JM7 B;  4NUD A;  1BOR A;  3L1X A;  3M99 A;  5A83 A;  2IDA A;  4HXP A;  5E9V A;  5LVQ A;  2CKL B;  5H85 A;  5LCW B;  3ZYQ A;  2ECT A;  4UIW A;  2CSY A;  4V3K C;  4WZ2 A;  5CQ6 A;  5CPE A;  5CQT A;  2RI7 A;  4C66 A;  4YYJ A;  5DYU A;  2VJF B;  5LUU A;  5DYX A;  5FE6 A;  5FFW A;  4O71 A;  4CUS A;  4CA1 A;  2F6J A;  4YBM A;  2KGG A;  4CFL A;  2N9G A;  2ECJ A;  2YEL A;  5CTL A;  4FLP A;  2D8S A;  2ZET C;  2DVS A;  4NR7 A;  1Z6U A;  5ENB A;  4XI1 A;  5KTX A;  2KE1 A;  4I7C A;  5E9Y A;  4NYW A;  2KU3 A;  2DWW A;  4QBM A;  4IR5 A;  4TZ8 A;  4UIZ A;  5CUG A;  5FE9 A;  5I40 A;  3O7A A;  2OO1 A;  5LJ1 A;  2YU4 A;  4CUU A;  4LR6 A;  5TAB A;  4IOQ A;  5AME A;  1WEO A;  2YYN A;  3SVH A;  5DYC A;  2YW8 A;  4O7F A;  5G4R A;  4HBY A;  4XY9 A;  2R10 A;  2F42 A;  4QF3 A;  2C2L A;  4HXL A;  4F3I A;  3TLP A;  4BW2 A;  3HTK C;  4UYE A;  5A5O A;  4GPJ A;  1WEQ A;  2D9E A;  3LQH A;  2LRI C;  5JI8 A;  2YDW A;  5CQ3 A;  4UIU A;  2H0D B;  2YHO A;  1XWH A;  1E4U A;  5J3X A;  3SVF A;  2MUM A;  5E73 A;  5HEN A;  2G45 A;  4ZDT A;  1V87 A;  2PUY A;  4QSS A;  2DX8 A;  2MNZ A;  5DFC A;  2KTB B;  3O33 A;  3UVW A;  4YYD A;  2E3K A;  5A5R A;  4LRG A;  5BT5 A;  5J0D A;  5I3L A;  5HRW A;  5LKT A;  4PKL A;  2L84 A;  1EQF A;  4YYK A;  5ENF A;  2VJE B;  4AUQ B;  4MEN A;  4DON A;  5B78 A;  5LKX A;  3KV5 A;  5CQ7 A;  5ACY A;  1WEN A;  5D3T A;  4HBW A;  3HME A;  5DKC A;  5IGN A;  2KWJ A;  2OUO A;  5FEY A;  5AD2 A;  3QZT A;  2CSZ A;  4UYF B;  4QSQ A;  5FE7 A;  2YEM A;  3VK6 A;  3P1F A;  4Z1Q A;  2LDR A;  4UP0 A;  2ECN A;  3HMF A;  3L11 A;  4O77 A;  4UYD A;  2MIQ A;  3KV6 A;  4A9J A;  4NR4 A;  1DVP A;  3S92 A;  5COI A;  4BJX A;  4QSU A;  4CUQ A;  4XUB A;  2JMI A;  4O7C A;  3IU6 A;  2RO1 A;  3N9N A;  3N9L A;  3JVJ A;  3MQM A;  5L8U A;  2RS9 B;  2MJV B;  2YW5 A;  3UVY A;  4LKA A;  2DVV A;  5D3L A;  2MT5 A;  4B86 C;  4WZ0 A;  4HXS A;  3SVG A;  5ENJ A;  5II1 A;  5FE4 A;  5CP5 A;  3ZVZ B;  4O72 A;  3U5O A;  3N9Q A;  4W4U A;  2MD7 B;  5II2 A;  5LKZ A;  5G0F A;  4HBV A;  3Q2F A;  4L7X A;  5HEL A;  3G0J A;  4WA6 A;  2LGL A;  4A9M A;  1WGM A;  2VP7 A;  4QR5 A;  5H1V A;  4A9E A;  1WEP A;  5B76 A;  4MVT A;  4KV1 A;  4Z6I A;  2HDP A;  2YRE A;  4C67 A;  5HQ6 A;  5E3D A;  2YT5 A;  5D3R A;  4OGJ A;  4QSR A;  3SOW A;  4LZ2 A;  5F61 A;  4A49 A;  2VPD A;  5D7X A;  4ZUX U;  1T1H A;  4QST A;  5I88 A;  2KWK A;  1U6G B;  5EWW A;  4IC3 A;  4Y03 A;  5HEM A;  2OSS A;  4PPE A;  3P1C A;  5L98 A;  4N4G A;  5CUB A;  4AVX A;  2L75 A;  2M6M A;  2LV9 A;  2ECW A;  3IHP A;  3ONI A;  4IOR A;  4TT2 A;  2R0S A;  3G0L A;  3UV2 A;  4QNS A;  4CLB A;  3JVM A;  5I7Y A;  2LQ6 A;  5TBN A;  4QSP A;  5DLZ A;  3UVD A;  4QSW A;  3O36 A;  2MA6 A;  5A82 A;  5FG6 A;  3O37 A;  1IYM A;  5DYA A;  3M63 A;  5EPS A;  5F62 A;  2NXB A;  1E6I A;  5FDZ A;  2G4A A;  5DW1 A;  5E3G A;  2MNY A;  1X0J A;  2YEK A;  5CGP A;  4FO9 A;  2NAA A;  3C6W A;  4A9H A;  2L80 A;  3LJW A;  4TYL A;  5FE2 A;  4NYV A;  4S3O C;  4TT6 A;  4HXK A;  5IGL A;  3FKM X;  2KWO A;  2Y43 A;  4QUU A;  5DY7 A;  3LRQ A;  5C85 A;  5CY9 A;  5CRZ A;  4E96 A;  4Q0N A;  4A9K A;  2DVR A;  4NR6 A;  4PS5 A;  5D0C A;  5AMF A;  5CQ8 A;  2FUI A;  4QR3 A;  1X4I A;  2KIZ A;  5TCM A;  3PUR A;  1WES A;  4LAD B;  3O34 A;  4NN2 A;  3AAD A;  2YQL A;  3KNV A;  3MHH A;  4KV4 A;  1HYJ A;  4A9I A;  2L85 A;  1RMD A;  3U5M A;  4QR4 A;  3MUL A;  5H1T A;  3QZV A;  5EWH A;  4BW3 A;  2WP2 A;  4MR5 A;  4Z6H A;  3I2D A;  5D3J A;  2AN6 A;  2QIZ A;  5FE0 A;  4IC2 A;  2ECI A;  4O64 A;  4MR3 A;  4O75 A;  1VYX A;  5BT4 A;  3NXB A;  2G43 A;  2EA6 A;  4PTB A;  5ENC A;  5D1L B;  3GL6 A;  3ASL A;  5EYA F;  4LYS A;  1ZBD B;  5E9K A;  1LDJ B;  3U5N A;  5B79 A;  4OGI A;  4UIT A;  4R8P K;  2YHN A;  4QB3 A;  5HRX A;  4PCI A;  5H1U A;  2QIC A;  4AYC B;  5D26 A;  1WEV A;  5D1K B;  3N9O A;  2E7O A;  2MA5 A;  4BHW A;  5DW2 A;  5KTW A;  4FIP A;  5CS8 A;  4O78 A;  4NRA A;  5A7C A;  4Z93 A;  5FH7 A;  4QY4 A;  5ENG A;  5KHM A;  2YSM A;  5KH3 A;  5ENI A;  1F62 A;  1JM7 A;  4GNG A;  5C87 A;  3LXJ A;  5CUE A;  2JRJ A;  4N4H A;  1FBV A;  5EWD A;  2K1J A;  5KH7 A;  5CZG A;  4F52 B;  2CKL A;  2E7N A;  4YH4 A;  5FG4 A;  4A9F A;  2YQD A;  5HQ7 A;  5A5N A;  4A9N A;  5TDW A;  3EB5 A;  3ZPV 1;  3SOX A;  5ETB A;  4YK0 A;  2VJF A;  5EA1 A;  4ZQL A;  4PY6 A;  5EWV A;  2GRC A;  5CFW A;  5G4S A;  3UW9 A;  2Y1N A;  2LGG A;  3JVK A;  3NG2 A;  4MEO A;  2KRE A;  4QEV A;  3HCU A;  4HBX A;  2M3H A;  4UP5 A;  3U5L A;  5KTU A;  5I86 A;  4UYG A;  1WIM A;  5FB1 A;  1WEW A;  4KCX A;  4O76 A;  4MEP A;  2OXQ C;  5E9M A;  5LJ2 A;  1MM3 A;  5FG5 A;  2R0V A;  5KU3 A;  2EOD A;  3ZVY A;  2YYR A;  5DFB A;  4TKP B;  1WIL A;  3GG3 A;  3ZPV E;  3EB6 A;  5EQ1 A;  2VPE A;  4UI9 B;  3RTR B;  5DLX A;  4CUT A;  4NR9 A;  4NYX A;  4I7D A;  5FBX A;  1G25 A;  2H0D A;  2KR4 A;  4AYC A;  5L97 A;  2ECV A;  3UVX A;  5I29 A;  2LGK A;  2PNX A;  4CCG X;  2VPB A;  5D24 A;  2ECG A; 
#chains in the Genus database with same CATH topology
 4UIV A;  5F5Z A;  4YYH A;  4N4F A;  4O7E A;  3T7L A;  4QEW A;  4LYI A;  5FE1 A;  2RNX A;  4LYW A;  3D1D A;  4NQM A;  5EGU A;  2C2V S;  2VJE A;  4X2I A;  3SHB A;  2LGV A;  4XYA A;  4MR4 A;  4QSV A;  4J0S A;  5A5P A;  2I7K A;  5F3A A;  2YUR A;  5ENH A;  4FK5 A;  4Q0O A;  1F68 A;  4MEQ A;  3MXF A;  5FH6 A;  2K16 A;  4UYF A;  2RNW A;  3P1E A;  3Q2E A;  5HRV A;  4LC2 A;  2DJA A;  5DBM A;  4O7B A;  1JM4 B;  5D3S A;  4QYL A;  2YSJ A;  5C89 A;  2WP1 A;  5E74 A;  5F36 A;  2JUN A;  4QC3 A;  4YY4 A;  3FAN A;  5AIU A;  4IR4 A;  5TB6 A;  3VKH A;  3I3J A;  2RR4 A;  5FB0 A;  5HJC A;  2BAY A;  3DPL R;  3ZYU A;  3H7H A;  2G6Q A;  5HLS A;  4Z0O A;  4QEU A;  5E9L A;  4YH3 A;  5IG6 A;  3PUQ A;  4NR8 A;  5C8G A;  4ZW1 A;  4B7Y C;  4R2Y A;  1WEU A;  5DKD A;  5FE8 A;  2LXP C;  4ALH A;  5KO4 A;  1LDK C;  5I7X A;  5FER A;  4GB0 A;  5LVR A;  4WZ3 B;  4O7A A;  2EGP A;  3MB3 A;  3U5P A;  5CUA A;  4QYD A;  5EI4 A;  4GND A;  2VNF A;  3GV4 A;  5L99 A;  4NUE A;  1WEM A;  3RPG C;  3T9K A;  2FSA A;  4CUR A;  1MBM A;  2KWN A;  3UV4 A;  2DVQ A;  4CL9 A;  4CUP A;  5F1L A;  5CQ4 A;  5FFV A;  3U5K A;  3MHS A;  3O47 A;  2L5U A;  4S3O B;  4LZR A;  5G05 B;  2JMD A;  4YAT A;  5CU8 A;  4YBS A;  3DAI A;  5AD3 A;  4NQN A;  5ETD A;  4NRC A;  4TU6 A;  1N87 A;  3K2J A;  2RFJ A;  1Z60 A;  2K17 A;  4QC1 A;  5HQ5 A;  5D1M B;  4LDF A;  2EJN A;  2MD8 C;  5G04 B;  4O70 A;  4Z1S A;  3RPG B;  1VD4 A;  4ZC9 A;  5EV9 A;  1ZS5 A;  3RCW A;  4YAX A;  5A81 A;  5HFQ A;  4V3L C;  2I50 A;  5EP7 A;  1WEE A;  3LQI A;  3AQA A;  4YC9 A;  3FL2 A;  3PHD A;  5C11 A;  2LSP B;  5E9I A;  5A5Q A;  4X3G A;  4N3W A;  5AIT A;  2LAU A;  4WIV A;  4NRB A;  4RVR A;  4YYI A;  5CUC A;  5I1Q A;  1JOC A;  3HCT A;  2YVR A;  3L1Z B;  5TRB A;  5C13 A;  4UYH A;  4YBT A;  5HM0 A;  2D82 A;  4TQN A;  3IU5 A;  4MR6 A;  5IGM A;  3HMH A;  5EPR A;  3LVR E;  5EVA A;  5IGK A;  4L58 A;  4YYG A;  5I89 A;  5EPB A;  5HFR A;  4AI6 A;  4HXM A;  4BW4 A;  4WHU A;  5F1H A;  5CQ5 A;  5I80 A;  5IID A;  4A9O A;  5L96 A;  1MM2 A;  2CT2 A;  4AP4 A;  5EWC A;  5FE3 A;  2YQM A;  4J1P A;  5H9M A;  2L43 A;  5D3H A;  3JVL A;  2XEU A;  2L5E A;  2K4D A;  5JWM A;  4WHW A;  3M7K A;  4J0R A;  2M1R A;  2KYU A;  4YYN A;  4OUF A;  4LZS A;  5A85 A;  2JMJ A;  5B75 A;  3N9M A;  4QSX A;  4A4C A;  2F6N A;  5FH8 A;  5D25 A;  1X4J A;  2LXH C;  4IOO A;  5B77 A;  3SOU A;  4H9D A;  5A5S A;  3U5J A;  4BBQ A;  4FJC A;  2DAT A;  2E6R A;  2I8N A;  2DKW A;  3P1D A;  4P5O B;  5CQA A;  2XB1 A;  5I83 A;  2E6S A;  5F25 A;  4TU4 A;  5FFY A;  4BW1 A;  5FE5 A;  1VFY A;  4N4I A;  2FUU A;  3LDY A;  5EU1 A;  3DQV R;  3N9P A;  4LLB A;  2YUC A;  4YAD A;  5E0R A;  2KFT A;  2RSD A;  4UIY A;  3LQJ A;  3P5O A;  3HCS A;  1HYI A;  4R7E A;  5TDR A;  2HYE D;  3D7C A;  2P57 A;  2UZG A;  4YAB A;  3FJU B;  2Y1M A;  4QZS A;  5K29 A;  5B8D A;  4J3I A;  2IQJ A;  4C9Z A;  4GNF A;  2EXU A;  2QJ0 A;  5D3N A;  1Z2Q A;  2FD4 A;  3MUK A;  4A4B A;  5LKU A;  4TTE A;  2CRR A;  4XUA A;  2XOY A;  1WUG A;  4TT4 A;  4QF2 A;  4XY8 A;  3MB4 A;  4HXN A;  4MSX A;  4NS5 A;  4O62 A;  4CFK A;  5E7D A;  3O35 A;  5EIS A;  1FP0 A;  2H60 A;  1JSP B;  3ZTG A;  5CRM A;  4GNE A;  5D3P A;  5EK9 A;  4NXJ A;  5ENE A;  5BT3 A;  2B0O E;  2LN0 A;  5KH9 A;  5SVX A;  4HXO A;  4QUT A;  4NR5 A;  5EM3 A;  3VKG A;  2CSV A;  2RNY A;  4NUC A;  4PCE A;  5LJ0 A;  5DKA A;  3T6R A;  4YYM A;  4I7B A;  5F63 A;  4IR3 A;  5EIC A;  4LJN A;  5C7N A;  1X4U A;  5DFD A;  4AKN A;  3O70 A;  5SVY A;  4A9L A;  3C5K A;  4O74 A;  5C4Q A;  4ALG A;  2VPG A;  5DX4 A;  1N72 A;  1WE9 A;  1WFK A;  5F2P A;  1CHC A;  1K2F A;  4Q6F A;  3ZNI A;  5DIN A;  5IBN A;  2KGI A;  4TS8 A;  5L8T A;  2M85 A;  5F60 A;  3KQI A;  5HCL A;  4A0C D;  5CUD A;  3M62 A;  3V43 A;  4IR6 A;  4UIX A;  4LK9 A;  4TZ2 A;  3UV5 A;  5DKH A;  4HXR A;  2L0B A;  4OGE A;  2R0Y A;  5JG6 A;  1WUM A;  3DWY A;  4YY6 A;  3QZS A;  3S91 A;  1JM7 B;  4NUD A;  1BOR A;  3L1X A;  3M99 A;  5A83 A;  2IDA A;  4HXP A;  5E9V A;  5LVQ A;  2CKL B;  5H85 A;  5LCW B;  3ZYQ A;  2ECT A;  4UIW A;  2CSY A;  4V3K C;  4WZ2 A;  5CQ6 A;  5CPE A;  5CQT A;  2RI7 A;  4C66 A;  4YYJ A;  5DYU A;  2VJF B;  5LUU A;  5DYX A;  5FE6 A;  5FFW A;  4QQ4 A;  4O71 A;  4CUS A;  4CA1 A;  2F6J A;  4YBM A;  2KGG A;  4CFL A;  2N9G A;  2ECJ A;  3KDE C;  2YEL A;  5CTL A;  4FLP A;  2D8S A;  2ZET C;  2DVS A;  4NR7 A;  1Z6U A;  5ENB A;  4XI1 A;  5KTX A;  2KE1 A;  4I7C A;  5E9Y A;  4NYW A;  2KU3 A;  2DWW A;  4QBM A;  4IR5 A;  4TZ8 A;  4UIZ A;  5CUG A;  5FE9 A;  1DCQ A;  5I40 A;  3FEH A;  3O7A A;  2OO1 A;  5LJ1 A;  2YU4 A;  4CUU A;  4LR6 A;  5TAB A;  4IOQ A;  5AME A;  1WEO A;  2YYN A;  3SVH A;  5DYC A;  2YW8 A;  4O7F A;  5G4R A;  4HBY A;  4XY9 A;  2R10 A;  2F42 A;  4QF3 A;  2C2L A;  2E61 A;  4HXL A;  4F3I A;  3TLP A;  4BW2 A;  3HTK C;  5SVI B;  4UYE A;  5A5O A;  4GPJ A;  1WEQ A;  2D9E A;  3LQH A;  2LRI C;  5JI8 A;  2YDW A;  5CQ3 A;  4UIU A;  2H0D B;  2YHO A;  1XWH A;  2OWA A;  1E4U A;  5J3X A;  3SVF A;  2JM3 A;  2MUM A;  5E73 A;  5HEN A;  2G45 A;  4ZDT A;  1V87 A;  2PUY A;  4QSS A;  2DX8 A;  2MNZ A;  5DFC A;  2KTB B;  3O33 A;  3UVW A;  4YYD A;  2E3K A;  5A5R A;  4LRG A;  5BT5 A;  5J0D A;  5I3L A;  5HRW A;  5LKT A;  4PKL A;  2L84 A;  1EQF A;  4YYK A;  3SUB A;  5ENF A;  3DDT A;  3MDB C;  2VJE B;  4AUQ B;  4MEN A;  4DON A;  5B78 A;  5LKX A;  3KV5 A;  5CQ7 A;  5ACY A;  1WEN A;  5D3T A;  4HBW A;  3HME A;  5DKC A;  5IGN A;  2KWJ A;  2OUO A;  5FEY A;  5AD2 A;  3QZT A;  2CSZ A;  4UYF B;  4QSQ A;  5FE7 A;  2YEM A;  3VK6 A;  3P1F A;  4Z1Q A;  2LDR A;  4UP0 A;  4AKI A;  3HMF A;  2ECN A;  3L11 A;  3DWD A;  4O77 A;  4UYD A;  2MIQ A;  3KV6 A;  4A9J A;  4NR4 A;  1DVP A;  3S92 A;  5COI A;  4BJX A;  4QSU A;  4CUQ A;  4XUB A;  2JMI A;  4O7C A;  3IU6 A;  2RO1 A;  3N9N A;  3N9L A;  3JVJ A;  3MQM A;  5L8U A;  3PLW A;  2RS9 B;  2MJV B;  2YW5 A;  3UVY A;  4LKA A;  2DVV A;  5D3L A;  2MT5 A;  4B86 C;  4WZ0 A;  4HXS A;  3SVG A;  5ENJ A;  5II1 A;  5FE4 A;  5CP5 A;  2KKY A;  3ZVZ B;  2KKX A;  4O72 A;  3U5O A;  3N9Q A;  4W4U A;  2MD7 B;  5II2 A;  5LKZ A;  5G0F A;  4HBV A;  3Q2F A;  4L7X A;  5HEL A;  3G0J A;  4WA6 A;  2LGL A;  4A9M A;  1WGM A;  2VP7 A;  4QR5 A;  5H1V A;  4A9E A;  1WEP A;  5B76 A;  4MVT A;  4KV1 A;  4Z6I A;  2HDP A;  2YRE A;  4C67 A;  5HQ6 A;  5E3D A;  2YT5 A;  5D3R A;  4OGJ A;  4QSR A;  3SOW A;  4LZ2 A;  5F61 A;  4A49 A;  2VPD A;  5D7X A;  4ZUX U;  1T1H A;  4QST A;  5I88 A;  2KWK A;  1U6G B;  5EWW A;  4IC3 A;  4Y03 A;  5HEM A;  2OSS A;  4PPE A;  3P1C A;  5L98 A;  4N4G A;  5CUB A;  4AVX A;  2L75 A;  2M6M A;  2LV9 A;  2ECW A;  3IHP A;  3ONI A;  4IOR A;  4TT2 A;  2R0S A;  3G0L A;  3UV2 A;  4QNS A;  4CLB A;  3JVM A;  4AKH A;  5I7Y A;  2LQ6 A;  5TBN A;  4QSP A;  5DLZ A;  3UVD A;  4QSW A;  3O36 A;  2MA6 A;  2D8U A;  5A82 A;  5FG6 A;  3O37 A;  1IYM A;  5DYA A;  3M63 A;  5EPS A;  5F62 A;  2NXB A;  1E6I A;  5FDZ A;  2G4A A;  5DW1 A;  5E3G A;  3D1B A;  2MNY A;  4OGC A;  2FFW A;  1X0J A;  2YEK A;  5CGP A;  4FO9 A;  2NAA A;  3C6W A;  4A9H A;  2L80 A;  3LJW A;  4TYL A;  5FE2 A;  4NYV A;  4S3O C;  4TT6 A;  4HXK A;  5IGL A;  3FKM X;  2KWO A;  2Y43 A;  4QUU A;  5DY7 A;  2L7P A;  3JUE A;  4AKG A;  1PUO A;  3LRQ A;  5C85 A;  5CY9 A;  5CRZ A;  4E96 A;  4Q0N A;  4A9K A;  2DVR A;  2XP0 A;  4NR6 A;  4PS5 A;  5D0C A;  5AMF A;  5CQ8 A;  2FUI A;  2CRW A;  4QR3 A;  1X4I A;  2KIZ A;  5TCM A;  3PUR A;  1WES A;  4LAD B;  3O34 A;  4NN2 A;  3AAD A;  2YQL A;  3KNV A;  3MHH A;  4KV4 A;  2CON A;  1HYJ A;  4A9I A;  2L85 A;  1RMD A;  3U5M A;  4QR4 A;  5K3Q A;  3MUL A;  5H1T A;  3QZV A;  2XOZ A;  5EWH A;  4BW3 A;  2WP2 A;  4MR5 A;  4Z6H A;  3I2D A;  5D3J A;  2AN6 A;  2QIZ A;  5FE0 A;  4IC2 A;  2ECI A;  4O64 A;  4MR3 A;  4O75 A;  1VYX A;  5BT4 A;  3NXB A;  2G43 A;  2MKE A;  2EA6 A;  4PTB A;  5ENC A;  5D1L B;  3GL6 A;  3ASL A;  5EYA F;  4LYS A;  1ZBD B;  3LJU X;  5E9K A;  1LDJ B;  3U5N A;  3Q1D A;  5B79 A;  4OGI A;  4UIT A;  4R8P K;  2YHN A;  4QB3 A;  5HRX A;  3FAO A;  4PCI A;  5H1U A;  2QIC A;  4AYC B;  5D26 A;  1WEV A;  5D1K B;  3N9O A;  2E7O A;  2MA5 A;  4BHW A;  5DW2 A;  5KTW A;  4FIP A;  3ERR A;  4O78 A;  4NRA A;  5CS8 A;  5A7C A;  4Z93 A;  5FH7 A;  4QY4 A;  5ENG A;  5KHM A;  2YSM A;  5KH3 A;  5ENI A;  1F62 A;  1JM7 A;  4GNG A;  5C87 A;  3LXJ A;  5CUE A;  2JRJ A;  4N4H A;  1FBV A;  5EWD A;  2K1J A;  5KH7 A;  5CZG A;  4F52 B;  2CKL A;  2E7N A;  4YH4 A;  5FG4 A;  4A9F A;  2YQD A;  5HQ7 A;  4F1P A;  5A5N A;  4A9N A;  5TDW A;  3EB5 A;  3ZPV 1;  3SOX A;  5ETB A;  4YK0 A;  2VJF A;  5EA1 A;  4ZQL A;  4PY6 A;  5EWV A;  2GRC A;  5CFW A;  5G4S A;  3UW9 A;  2Y1N A;  2LGG A;  3JVK A;  3NG2 A;  4MEO A;  2KRE A;  4QEV A;  3HCU A;  4HBX A;  2M3H A;  4UP5 A;  3U5L A;  5KTU A;  5I86 A;  4UYG A;  1WIM A;  5FB1 A;  3LVQ E;  1WEW A;  4KCX A;  4O76 A;  4MEP A;  2EGM A;  1ZKR A;  2OXQ C;  5E9M A;  5LJ2 A;  1MM3 A;  5FG5 A;  2DSM A;  2R0V A;  5KU3 A;  2EOD A;  3ZVY A;  2YYR A;  5DFB A;  4TKP B;  1WIL A;  3GG3 A;  3ZPV E;  3EB6 A;  2XOC A;  5EQ1 A;  2VPE A;  4UI9 B;  3RTR B;  5SVI A;  3E2D A;  5DLX A;  4CUT A;  4NR9 A;  4NYX A;  4I7D A;  5FBX A;  1G25 A;  2H0D A;  2KR4 A;  2M13 A;  4AYC A;  5L97 A;  2ECV A;  3UVX A;  5I29 A;  4Z0R A;  2LGK A;  2PNX A;  4CCG X;  3FM8 C;  2VPB A;  5D24 A;  2ECG A; 
#chains in the Genus database with same CATH homology
 4UIV A;  5F5Z A;  4YYH A;  4N4F A;  4O7E A;  3T7L A;  4QEW A;  4LYI A;  5FE1 A;  2RNX A;  4LYW A;  4NQM A;  5EGU A;  2C2V S;  2VJE A;  3SHB A;  4X2I A;  2LGV A;  4XYA A;  4MR4 A;  4QSV A;  4J0S A;  5A5P A;  2I7K A;  5F3A A;  2YUR A;  5ENH A;  4FK5 A;  4Q0O A;  1F68 A;  4MEQ A;  3MXF A;  5FH6 A;  2K16 A;  4UYF A;  2RNW A;  3P1E A;  3Q2E A;  5HRV A;  4LC2 A;  5DBM A;  4O7B A;  1JM4 B;  5D3S A;  4QYL A;  2YSJ A;  5C89 A;  2WP1 A;  5E74 A;  5F36 A;  4QC3 A;  4YY4 A;  5AIU A;  4IR4 A;  5TB6 A;  3I3J A;  5FB0 A;  5HJC A;  2BAY A;  3DPL R;  3ZYU A;  2G6Q A;  5HLS A;  4QEU A;  5E9L A;  4YH3 A;  5IG6 A;  3PUQ A;  4NR8 A;  5C8G A;  4ZW1 A;  4B7Y C;  4R2Y A;  1WEU A;  5DKD A;  5FE8 A;  2LXP C;  4ALH A;  5KO4 A;  1LDK C;  5I7X A;  5FER A;  4GB0 A;  5LVR A;  4WZ3 B;  4O7A A;  2EGP A;  3MB3 A;  3U5P A;  5CUA A;  4QYD A;  5EI4 A;  4GND A;  2VNF A;  3GV4 A;  5L99 A;  4NUE A;  1WEM A;  3RPG C;  2FSA A;  4CUR A;  2KWN A;  3UV4 A;  2DVQ A;  4CL9 A;  4CUP A;  5F1L A;  5CQ4 A;  5FFV A;  3U5K A;  3MHS A;  5G05 B;  2L5U A;  4S3O B;  4LZR A;  2JMD A;  4YAT A;  5CU8 A;  4YBS A;  3DAI A;  5AD3 A;  4NQN A;  5ETD A;  4NRC A;  4TU6 A;  1N87 A;  3K2J A;  2RFJ A;  1Z60 A;  2K17 A;  4QC1 A;  5HQ5 A;  5D1M B;  4LDF A;  2MD8 C;  5G04 B;  4O70 A;  4Z1S A;  3RPG B;  1VD4 A;  4ZC9 A;  5EV9 A;  1ZS5 A;  3RCW A;  4YAX A;  5A81 A;  5HFQ A;  4V3L C;  2I50 A;  5EP7 A;  1WEE A;  3LQI A;  3AQA A;  4YC9 A;  3FL2 A;  3PHD A;  5C11 A;  2LSP B;  5E9I A;  5A5Q A;  4X3G A;  4N3W A;  5AIT A;  4WIV A;  4NRB A;  4RVR A;  4YYI A;  5CUC A;  5I1Q A;  1JOC A;  3HCT A;  3L1Z B;  5TRB A;  5C13 A;  4UYH A;  4YBT A;  5HM0 A;  2D82 A;  4TQN A;  3IU5 A;  4MR6 A;  5IGM A;  3HMH A;  5EPR A;  5EVA A;  5IGK A;  4L58 A;  4YYG A;  5I89 A;  5EPB A;  5HFR A;  4HXM A;  4BW4 A;  4WHU A;  5F1H A;  5CQ5 A;  5I80 A;  5IID A;  4A9O A;  5L96 A;  1MM2 A;  2CT2 A;  4AP4 A;  5EWC A;  5FE3 A;  2YQM A;  4J1P A;  5H9M A;  2L43 A;  5D3H A;  3JVL A;  2XEU A;  2L5E A;  2K4D A;  5JWM A;  4WHW A;  4J0R A;  2M1R A;  2KYU A;  4YYN A;  4OUF A;  4LZS A;  5A85 A;  2JMJ A;  5B75 A;  3N9M A;  4QSX A;  4A4C A;  2F6N A;  5FH8 A;  5D25 A;  1X4J A;  2LXH C;  4IOO A;  5B77 A;  3SOU A;  5A5S A;  3U5J A;  4BBQ A;  4FJC A;  2DAT A;  2E6R A;  2I8N A;  2DKW A;  3P1D A;  4P5O B;  5CQA A;  2XB1 A;  5I83 A;  2E6S A;  5F25 A;  4TU4 A;  5FFY A;  4BW1 A;  5FE5 A;  1VFY A;  4N4I A;  2FUU A;  5EU1 A;  3DQV R;  3N9P A;  4LLB A;  2YUC A;  4YAD A;  5E0R A;  2KFT A;  2RSD A;  4UIY A;  3LQJ A;  3P5O A;  3HCS A;  1HYI A;  4R7E A;  5TDR A;  2HYE D;  3D7C A;  2UZG A;  4YAB A;  2Y1M A;  4QZS A;  5K29 A;  5B8D A;  4J3I A;  4C9Z A;  4GNF A;  2QJ0 A;  5D3N A;  1Z2Q A;  3MUK A;  4A4B A;  5LKU A;  4TTE A;  4XUA A;  1WUG A;  4TT4 A;  4QF2 A;  4XY8 A;  3MB4 A;  4HXN A;  4MSX A;  4NS5 A;  4CFK A;  5E7D A;  3O35 A;  5EIS A;  1FP0 A;  2H60 A;  1JSP B;  3ZTG A;  5CRM A;  4GNE A;  5D3P A;  5EK9 A;  4NXJ A;  5ENE A;  5BT3 A;  2LN0 A;  5KH9 A;  4HXO A;  4QUT A;  4NR5 A;  5EM3 A;  2RNY A;  4NUC A;  4PCE A;  5LJ0 A;  5DKA A;  3T6R A;  4YYM A;  4I7B A;  5F63 A;  4IR3 A;  5EIC A;  4LJN A;  5C7N A;  1X4U A;  5DFD A;  4AKN A;  3O70 A;  4A9L A;  3C5K A;  4O74 A;  5C4Q A;  4ALG A;  2VPG A;  5DX4 A;  1N72 A;  1WE9 A;  1WFK A;  5F2P A;  1CHC A;  1K2F A;  4Q6F A;  3ZNI A;  5DIN A;  5IBN A;  2KGI A;  4TS8 A;  5L8T A;  2M85 A;  5F60 A;  3KQI A;  5HCL A;  4A0C D;  5CUD A;  3M62 A;  3V43 A;  4IR6 A;  4UIX A;  4LK9 A;  4TZ2 A;  3UV5 A;  5DKH A;  4HXR A;  2L0B A;  5JG6 A;  2R0Y A;  1WUM A;  3DWY A;  4YY6 A;  3QZS A;  3S91 A;  1JM7 B;  4NUD A;  1BOR A;  3L1X A;  3M99 A;  5A83 A;  2IDA A;  4HXP A;  5E9V A;  5LVQ A;  2CKL B;  5H85 A;  5LCW B;  3ZYQ A;  2ECT A;  4UIW A;  2CSY A;  4V3K C;  4WZ2 A;  5CQ6 A;  5CPE A;  5CQT A;  2RI7 A;  4C66 A;  4YYJ A;  5DYU A;  2VJF B;  5LUU A;  5DYX A;  5FE6 A;  5FFW A;  4O71 A;  4CUS A;  4CA1 A;  2F6J A;  4YBM A;  2KGG A;  4CFL A;  2N9G A;  2ECJ A;  2YEL A;  5CTL A;  4FLP A;  2D8S A;  2ZET C;  2DVS A;  4NR7 A;  1Z6U A;  5ENB A;  4XI1 A;  5KTX A;  2KE1 A;  4I7C A;  5E9Y A;  4NYW A;  2KU3 A;  2DWW A;  4QBM A;  4IR5 A;  4TZ8 A;  4UIZ A;  5CUG A;  5FE9 A;  5I40 A;  3O7A A;  2OO1 A;  5LJ1 A;  2YU4 A;  4CUU A;  4LR6 A;  5TAB A;  4IOQ A;  5AME A;  1WEO A;  2YYN A;  3SVH A;  5DYC A;  2YW8 A;  4O7F A;  5G4R A;  4HBY A;  4XY9 A;  2R10 A;  2F42 A;  4QF3 A;  2C2L A;  4HXL A;  4F3I A;  3TLP A;  4BW2 A;  3HTK C;  4UYE A;  5A5O A;  4GPJ A;  1WEQ A;  2D9E A;  3LQH A;  2LRI C;  5JI8 A;  2YDW A;  5CQ3 A;  4UIU A;  2H0D B;  2YHO A;  1XWH A;  1E4U A;  5J3X A;  3SVF A;  2MUM A;  5E73 A;  5HEN A;  2G45 A;  4ZDT A;  1V87 A;  2PUY A;  4QSS A;  2DX8 A;  2MNZ A;  5DFC A;  2KTB B;  3O33 A;  3UVW A;  4YYD A;  2E3K A;  5A5R A;  4LRG A;  5BT5 A;  5J0D A;  5I3L A;  5HRW A;  5LKT A;  4PKL A;  2L84 A;  1EQF A;  4YYK A;  5ENF A;  2VJE B;  4AUQ B;  4MEN A;  4DON A;  5B78 A;  5LKX A;  3KV5 A;  5CQ7 A;  5ACY A;  1WEN A;  5D3T A;  4HBW A;  3HME A;  5DKC A;  5IGN A;  2KWJ A;  2OUO A;  5FEY A;  5AD2 A;  3QZT A;  2CSZ A;  4UYF B;  4QSQ A;  5FE7 A;  2YEM A;  3VK6 A;  3P1F A;  4Z1Q A;  2LDR A;  4UP0 A;  2ECN A;  3HMF A;  3L11 A;  4O77 A;  4UYD A;  2MIQ A;  3KV6 A;  4A9J A;  4NR4 A;  1DVP A;  3S92 A;  5COI A;  4BJX A;  4QSU A;  4CUQ A;  4XUB A;  2JMI A;  4O7C A;  3IU6 A;  2RO1 A;  3N9N A;  3N9L A;  3JVJ A;  3MQM A;  5L8U A;  2RS9 B;  2MJV B;  2YW5 A;  3UVY A;  4LKA A;  2DVV A;  5D3L A;  2MT5 A;  4B86 C;  4WZ0 A;  4HXS A;  3SVG A;  5ENJ A;  5II1 A;  5FE4 A;  5CP5 A;  3ZVZ B;  4O72 A;  3U5O A;  3N9Q A;  4W4U A;  2MD7 B;  5II2 A;  5LKZ A;  5G0F A;  4HBV A;  3Q2F A;  4L7X A;  5HEL A;  3G0J A;  4WA6 A;  2LGL A;  4A9M A;  1WGM A;  2VP7 A;  4QR5 A;  5H1V A;  4A9E A;  1WEP A;  5B76 A;  4MVT A;  4KV1 A;  4Z6I A;  2HDP A;  2YRE A;  4C67 A;  5HQ6 A;  5E3D A;  2YT5 A;  5D3R A;  4OGJ A;  4QSR A;  3SOW A;  4LZ2 A;  5F61 A;  4A49 A;  2VPD A;  5D7X A;  4ZUX U;  1T1H A;  4QST A;  5I88 A;  2KWK A;  1U6G B;  5EWW A;  4IC3 A;  4Y03 A;  5HEM A;  2OSS A;  4PPE A;  3P1C A;  5L98 A;  4N4G A;  5CUB A;  4AVX A;  2L75 A;  2M6M A;  2LV9 A;  2ECW A;  3IHP A;  3ONI A;  4IOR A;  4TT2 A;  2R0S A;  3G0L A;  3UV2 A;  4QNS A;  4CLB A;  3JVM A;  5I7Y A;  2LQ6 A;  5TBN A;  4QSP A;  5DLZ A;  3UVD A;  4QSW A;  3O36 A;  2MA6 A;  5A82 A;  5FG6 A;  3O37 A;  1IYM A;  5DYA A;  3M63 A;  5EPS A;  5F62 A;  2NXB A;  1E6I A;  5FDZ A;  2G4A A;  5DW1 A;  5E3G A;  2MNY A;  1X0J A;  2YEK A;  5CGP A;  4FO9 A;  2NAA A;  3C6W A;  4A9H A;  2L80 A;  3LJW A;  4TYL A;  5FE2 A;  4NYV A;  4S3O C;  4TT6 A;  4HXK A;  5IGL A;  3FKM X;  2KWO A;  2Y43 A;  4QUU A;  5DY7 A;  3LRQ A;  5C85 A;  5CY9 A;  5CRZ A;  4E96 A;  4Q0N A;  4A9K A;  2DVR A;  4NR6 A;  4PS5 A;  5D0C A;  5AMF A;  5CQ8 A;  2FUI A;  4QR3 A;  1X4I A;  2KIZ A;  5TCM A;  3PUR A;  1WES A;  4LAD B;  3O34 A;  4NN2 A;  3AAD A;  2YQL A;  3KNV A;  3MHH A;  4KV4 A;  1HYJ A;  4A9I A;  2L85 A;  1RMD A;  3U5M A;  4QR4 A;  3MUL A;  5H1T A;  3QZV A;  5EWH A;  4BW3 A;  2WP2 A;  4MR5 A;  4Z6H A;  3I2D A;  5D3J A;  2AN6 A;  2QIZ A;  5FE0 A;  4IC2 A;  2ECI A;  4O64 A;  4MR3 A;  4O75 A;  1VYX A;  5BT4 A;  3NXB A;  2G43 A;  2EA6 A;  4PTB A;  5ENC A;  5D1L B;  3GL6 A;  3ASL A;  5EYA F;  4LYS A;  1ZBD B;  5E9K A;  1LDJ B;  3U5N A;  5B79 A;  4OGI A;  4UIT A;  4R8P K;  2YHN A;  4QB3 A;  5HRX A;  4PCI A;  5H1U A;  2QIC A;  4AYC B;  5D26 A;  1WEV A;  5D1K B;  3N9O A;  2E7O A;  2MA5 A;  4BHW A;  5DW2 A;  5KTW A;  4FIP A;  5CS8 A;  4O78 A;  4NRA A;  5A7C A;  4Z93 A;  5FH7 A;  4QY4 A;  5ENG A;  5KHM A;  2YSM A;  5KH3 A;  5ENI A;  1F62 A;  1JM7 A;  4GNG A;  5C87 A;  3LXJ A;  5CUE A;  2JRJ A;  4N4H A;  1FBV A;  5EWD A;  2K1J A;  5KH7 A;  5CZG A;  4F52 B;  2CKL A;  2E7N A;  4YH4 A;  5FG4 A;  4A9F A;  2YQD A;  5HQ7 A;  5A5N A;  4A9N A;  5TDW A;  3EB5 A;  3ZPV 1;  3SOX A;  5ETB A;  4YK0 A;  2VJF A;  5EA1 A;  4ZQL A;  4PY6 A;  5EWV A;  2GRC A;  5CFW A;  5G4S A;  3UW9 A;  2Y1N A;  2LGG A;  3JVK A;  3NG2 A;  4MEO A;  2KRE A;  4QEV A;  3HCU A;  4HBX A;  2M3H A;  4UP5 A;  3U5L A;  5KTU A;  5I86 A;  4UYG A;  1WIM A;  5FB1 A;  1WEW A;  4KCX A;  4O76 A;  4MEP A;  2OXQ C;  5E9M A;  5LJ2 A;  1MM3 A;  5FG5 A;  2R0V A;  5KU3 A;  2EOD A;  3ZVY A;  2YYR A;  5DFB A;  4TKP B;  1WIL A;  3GG3 A;  3ZPV E;  3EB6 A;  5EQ1 A;  2VPE A;  4UI9 B;  3RTR B;  5DLX A;  4CUT A;  4NR9 A;  4NYX A;  4I7D A;  5FBX A;  1G25 A;  2H0D A;  2KR4 A;  4AYC A;  5L97 A;  2ECV A;  3UVX A;  5I29 A;  2LGK A;  2PNX A;  4CCG X;  2VPB A;  5D24 A;  2ECG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...