4GB0A

Crystal structure of the ring domain of rnf168
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
LPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF168
publication title Structural basis for role of ring finger protein RNF168 RING domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 27
structure length 91
sequence length 91
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gb0A00
2YURA 2YUCA 4LJNA 5C11A 1JM7A 1WEQA 3ZPVE 3KQIA 3MHSA 4XI1A 3HCTA 3PUQA 4FJCA 2KWKA 3DPLR 3M99A 1U6GB 1WENA 2KWOA 2I50A 5TABA 4GNDA 1WEUA 5KH3A 2L5UA 2L80A 4S3OC 1X4UA 1XWHA 1HYIA 3L11A 3ZYQA 2VPBA 2OXQC 4YC9A 3NG2A 3IHPA 5B8DA 2YT5A 2LGKA 5FB1A 5J3XA 3EB5A 2KR4A 3KNVA 1WIMA 3N9OA 5FEYA 2H0DB 3O34A 5KH9A 4QF3A 4FK5A 2VNFA 3HTKC 4PTBA 1VD4A 5LKZA 1VYXA 2ECVA 2RI7A 3RTRB 2RSDA 5G04B 4V3LC 2KIZA 5AIUA 2KYUA 2E6RA 5C13A 2HYED 3O70A 3VK6A 2BAYA 2LXPC 4YBMA 1WEMA 2MIQA 2LDRA 2KE1A 4X3GA 5FB0A 3EB6A 3O36A 1VFYA 3LQIA 2M85A 2KWNA 3HCSA 4A4CA 1JOCA 2CSYA 4ZDTA 4MVTA 4BBQA 3KV6A 4AP4A 3U5OA 2VPEA 2JMIA 3O33A 3U5MA 4IC2A 4N3WA 4UI9B 1T1HA 1WEWA 2KGIA 2LV9A 2QICA 2K1JA 4R7EA 2L43A 1FP0A 2Y1MA 2PUYA 2L75A 3M62A 1WESA 3PHDA 5LKUA 5TBNA 5H9MA 2JRJA 4P5OB 4N4FA 2F6JA 3SOUA 5TRBA 4F52B 4LKAA 4WZ0A 2H0DA 4R2YA 4L7XA 4I7CA 1G25A 3L1XA 2VJEB 4ZQLA 2LGGA 2KFTA 5KH7A 5LCWB 4WZ3B 3SOXA 3FL2A 1Z60A 2VPGA 2LQ6A 2MA6A 1X4JA 4B7YC 5G05B 4FIPA 1HYJA 3LRQA 2MUMA 1Z2QA 5DKAA 2G45A 1X4IA 2JMDA 2KU3A 2YQMA 3RPGB 3HCUA 4YAXA 5AITA 4YBTA 3GV4A 2VJFB 2F6NA 2YHNA 2UZGA 5B77A 4LADB 2ECWA 2XB1A 5D1KB 2KREA 4GNGA 4CA1A 5EYAF 2Y43A 5LKXA 3LQHA 2FUUA 3RPGC 2MT5A 2ECJA 2EA6A 2CKLB 3ZVZB 4QF2A 3U5NA 2C2LA 2MD8C 3T6RA 2MA5A 2ECIA 4A4BA 2YSMA 2F42A 4YADA 3ZNIA 3O7AA 3N9QA 5I3LA 2FUIA 2LRIC 2K16A 2VJEA 4NN2A 5DINA 4GNEA 5LKTA 3SOWA 5B79A 1MM2A 2KGGA 3C5KA 4W4UA 5B78A 4I7BA 4LLBA 1DVPA 3N9PA 2PNXA 3DQVR 4YBSA 2C2VS 3U5PA 4MSXA 3O35A 1N87A 2JMJA 3N9MA 2M3HA 1LDKC 4Q6FA 5B75A 4UP5A 2YU4A 3T7LA 4A0CD 4R8PK 2YYRA 1K2FA 5D1MB 5B76A 3L1ZB 4B86C 3O37A 2LGLA 4V3KC 5G0FA 2AN6A 1CHCA 2G6QA 5D1LB 2VJFA 5H1VA 4I7DA 1IYMA 4S3OB 4IC3A 1MM3A 2LN0A 1WEEA 1FBVA 2EODA 3M63A 4LK9A 2L0BA 1WEVA 2NAAA 5H1UA 4O64A 2VPDA 3V43A 2FSAA 3QZVA 3N9NA 4YABA 2YHOA 5TDWA 2CKLA 4AYCB 1E4UA 2KWJA 4PPEA 2DX8A 4BHWA 3LQJA 5FERA 1WEPA 5H1TA 2MNZA 3I2DA 2G43A 2QJ0A 4GB0A 2K4DA 1JM7B 1WEOA 3ASLA 2YQLA 3PURA 4AVXA 1WGMA 1Z6UA 2LGVA 2CSZA 2LXHC 1V87A 5TDRA 3C6WA 3ZTGA 4C9ZA 2HDPA 2VP7A 4AUQB 1WILA 2ZETC 2E6SA 1LDJB 3MHHA 2YREA 4L58A 2XEUA 3N9LA 2YSJA 1ZBDB 4ZUXU 2MD7B 4A49A 3ZPV1 1RMDA 4YATA 2YW8A 3ZVYA 1WFKA 2ECGA 2M1RA 2MNYA 2IDAA 2Y1NA 4FO9A 2D8SA 2CT2A 2ECTA 2QIZA 4AYCA 5JG6A 1F62A 1WE9A 2K17A 3GL6A 4WA6A 2M6MA 4CCGX 3SHBA 2EGPA 4WZ2A 1BORA 4UP0A 4TKPB 2ECNA 4GNFA 3KV5A
chains in the Genus database with same CATH superfamily
2YURA 2YUCA 4LJNA 5C11A 1JM7A 1WEQA 3ZPVE 4QQ4A 3KQIA 3MHSA 3DWDA 4XI1A 3HCTA 3PUQA 4FJCA 2KWKA 3DPLR 3M99A 1U6GB 1WENA 2KWOA 2I50A 2KKYA 5TABA 4GNDA 1WEUA 5KH3A 2L5UA 2L80A 4S3OC 1X4UA 1XWHA 3FM8C 2KKXA 1HYIA 3L11A 3PLWA 3ZYQA 2EXUA 2VPBA 2OXQC 4YC9A 3NG2A 2FD4A 3IHPA 5B8DA 2YT5A 2LGKA 5FB1A 5J3XA 3EB5A 2KR4A 3KNVA 1WIMA 3N9OA 5FEYA 4Z0OA 2H0DB 3O34A 5KH9A 4QF3A 4FK5A 2VNFA 3HTKC 4PTBA 1VD4A 5LKZA 1VYXA 2ECVA 2RI7A 3RTRB 2RSDA 5G04B 4V3LC 2KIZA 5AIUA 2KYUA 2LAUA 3LJUX 2E6RA 5C13A 2HYED 3FEHA 3O70A 3VK6A 2BAYA 2LXPC 4YBMA 1WEMA 2MIQA 4OGEA 2LDRA 2KE1A 4X3GA 5FB0A 3EB6A 3O36A 3FJUB 1VFYA 3LQIA 2M85A 2KWNA 3HCSA 4A4CA 1JOCA 2CSYA 2CRWA 4ZDTA 4MVTA 4BBQA 3KV6A 4AP4A 3U5OA 2VPEA 2JMIA 3O33A 3U5MA 4IC2A 2E61A 4N3WA 4UI9B 1T1HA 1WEWA 2KGIA 2LV9A 2QICA 2K1JA 4R7EA 2L43A 1FP0A 3E2DA 2Y1MA 2PUYA 4OGCA 2L75A 3M62A 1WESA 3PHDA 5LKUA 5TBNA 3Q1DA 5H9MA 2JRJA 4P5OB 4N4FA 2F6JA 3SOUA 2EGMA 5TRBA 4F52B 4LKAA 4WZ0A 2H0DA 2RR4A 4R2YA 4L7XA 4I7CA 1G25A 3L1XA 2VJEB 4ZQLA 2LGGA 2KFTA 5KH7A 2CONA 3JUEA 5LCWB 2IQJA 4WZ3B 1MBMA 3SOXA 3FL2A 2B0OE 1Z60A 2VPGA 2LQ6A 5SVIB 2MA6A 1X4JA 4B7YC 5G05B 4FIPA 1HYJA 3LRQA 2MUMA 1Z2QA 5DKAA 2G45A 1X4IA 2JMDA 2KU3A 2YQMA 3RPGB 3HCUA 4YAXA 5AITA 4YBTA 5SVXA 3GV4A 3KDEC 2VJFB 2F6NA 3H7HA 2YHNA 2UZGA 5B77A 4LADB 2ECWA 2XB1A 5D1KB 2JM3A 2KREA 4GNGA 4CA1A 2DJAA 3LVQE 5EYAF 2Y43A 5LKXA 3LQHA 2FUUA 3RPGC 2MT5A 2ECJA 2EA6A 2CKLB 3ZVZB 4QF2A 3U5NA 2C2LA 2MD8C 3T6RA 2MA5A 2ECIA 4A4BA 2YSMA 2F42A 4YADA 3ZNIA 3M7KA 3O7AA 3N9QA 1DCQA 5I3LA 2FUIA 3LVRE 2LRIC 2K16A 3T9KA 2VJEA 4NN2A 5DINA 4GNEA 5LKTA 3SOWA 5B79A 1MM2A 2KGGA 3C5KA 4W4UA 5B78A 4I7BA 4LLBA 4O62A 1DVPA 3N9PA 2PNXA 2XOZA 3DQVR 4Z0RA 4YBSA 2C2VS 3U5PA 2M13A 4MSXA 3O35A 1N87A 2JMJA 3N9MA 2M3HA 1LDKC 4Q6FA 5B75A 4UP5A 5SVIA 2YU4A 3T7LA 4A0CD 2P57A 4R8PK 2YYRA 1K2FA 5D1MB 5B76A 3L1ZB 3MDBC 4B86C 3O37A 2LGLA 2XOCA 4V3KC 5G0FA 2AN6A 2JUNA 1CHCA 5SVYA 2G6QA 5D1LB 2VJFA 5H1VA 4I7DA 1IYMA 4S3OB 4IC3A 1MM3A 2LN0A 1WEEA 1FBVA 2EODA 3M63A 4LK9A 2L0BA 1WEVA 2NAAA 5H1UA 3DDTA 4O64A 2VPDA 2FFWA 3V43A 2FSAA 4H9DA 3QZVA 3N9NA 3SUBA 5K3QA 4YABA 2YHOA 5TDWA 2CKLA 4AYCB 1E4UA 2CSVA 2KWJA 4PPEA 2MKEA 2DX8A 4BHWA 2L7PA 3LQJA 5FERA 1WEPA 5H1TA 2MNZA 3I2DA 2G43A 2QJ0A 2XP0A 4GB0A 2K4DA 3O47A 1JM7B 1WEOA 3ASLA 2YQLA 3PURA 4AVXA 1WGMA 1Z6UA 2LGVA 2CSZA 2LXHC 1V87A 5TDRA 3C6WA 3FANA 3ZTGA 4C9ZA 2HDPA 2VP7A 4AUQB 1WILA 2ZETC 2E6SA 1LDJB 3MHHA 2YREA 4L58A 2XEUA 3N9LA 2YSJA 3LDYA 1ZBDB 4ZUXU 2MD7B 4A49A 3ZPV1 1RMDA 2CRRA 4F1PA 4YATA 2YW8A 3ZVYA 1WFKA 2ECGA 2D8UA 2M1RA 2MNYA 2IDAA 2Y1NA 2YVRA 4FO9A 2D8SA 2CT2A 2ECTA 2DSMA 2QIZA 4AYCA 5JG6A 1F62A 1WE9A 2K17A 3GL6A 4WA6A 2M6MA 4CCGX 3SHBA 3FAOA 2XOYA 2EGPA 4WZ2A 1BORA 4UP0A 2OWAA 4TKPB 2ECNA 4GNFA 3KV5A
chains in the Genus database with same CATH topology
2YURA 2YUCA 4LJNA 5C11A 1JM7A 1WEQA 3ZPVE 3KQIA 3MHSA 4XI1A 3HCTA 3PUQA 4FJCA 2KWKA 3DPLR 3M99A 1U6GB 1WENA 2KWOA 2I50A 5TABA 4GNDA 1WEUA 5KH3A 2L5UA 2L80A 4S3OC 1X4UA 1XWHA 1HYIA 3L11A 3ZYQA 2VPBA 2OXQC 4YC9A 3NG2A 3IHPA 5B8DA 2YT5A 2LGKA 5FB1A 5J3XA 3EB5A 2KR4A 3KNVA 1WIMA 3N9OA 5FEYA 2H0DB 3O34A 5KH9A 4QF3A 4FK5A 2VNFA 3HTKC 4PTBA 1VD4A 5LKZA 1VYXA 2ECVA 2RI7A 3RTRB 2RSDA 5G04B 4V3LC 2KIZA 5AIUA 2KYUA 2E6RA 5C13A 2HYED 3O70A 3VK6A 2BAYA 2LXPC 4YBMA 1WEMA 2MIQA 2LDRA 2KE1A 4X3GA 5FB0A 3EB6A 3O36A 1VFYA 3LQIA 2M85A 2KWNA 3HCSA 4A4CA 1JOCA 2CSYA 4ZDTA 4MVTA 4BBQA 3KV6A 4AP4A 3U5OA 2VPEA 2JMIA 3O33A 3U5MA 4IC2A 4N3WA 4UI9B 1T1HA 1WEWA 2KGIA 2LV9A 2QICA 2K1JA 4R7EA 2L43A 1FP0A 2Y1MA 2PUYA 2L75A 3M62A 1WESA 3PHDA 5LKUA 5TBNA 5H9MA 2JRJA 4P5OB 4N4FA 2F6JA 3SOUA 5TRBA 4F52B 4LKAA 4WZ0A 2H0DA 4R2YA 4L7XA 4I7CA 1G25A 3L1XA 2VJEB 4ZQLA 2LGGA 2KFTA 5KH7A 5LCWB 4WZ3B 3SOXA 3FL2A 1Z60A 2VPGA 2LQ6A 2MA6A 1X4JA 4B7YC 5G05B 4FIPA 1HYJA 3LRQA 2MUMA 1Z2QA 5DKAA 2G45A 1X4IA 2JMDA 2KU3A 2YQMA 3RPGB 3HCUA 4YAXA 5AITA 4YBTA 3GV4A 2VJFB 2F6NA 2YHNA 2UZGA 5B77A 4LADB 2ECWA 2XB1A 5D1KB 2KREA 4GNGA 4CA1A 5EYAF 2Y43A 5LKXA 3LQHA 2FUUA 3RPGC 2MT5A 2ECJA 2EA6A 2CKLB 3ZVZB 4QF2A 3U5NA 2C2LA 2MD8C 3T6RA 2MA5A 2ECIA 4A4BA 2YSMA 2F42A 4YADA 3ZNIA 3O7AA 3N9QA 5I3LA 2FUIA 2LRIC 2K16A 2VJEA 4NN2A 5DINA 4GNEA 5LKTA 3SOWA 5B79A 1MM2A 2KGGA 3C5KA 4W4UA 5B78A 4I7BA 4LLBA 1DVPA 3N9PA 2PNXA 3DQVR 4YBSA 2C2VS 3U5PA 4MSXA 3O35A 1N87A 2JMJA 3N9MA 2M3HA 1LDKC 4Q6FA 5B75A 4UP5A 2YU4A 3T7LA 4A0CD 4R8PK 2YYRA 1K2FA 5D1MB 5B76A 3L1ZB 4B86C 3O37A 2LGLA 4V3KC 5G0FA 2AN6A 1CHCA 2G6QA 5D1LB 2VJFA 5H1VA 4I7DA 1IYMA 4S3OB 4IC3A 1MM3A 2LN0A 1WEEA 1FBVA 2EODA 3M63A 4LK9A 2L0BA 1WEVA 2NAAA 5H1UA 4O64A 2VPDA 3V43A 2FSAA 3QZVA 3N9NA 4YABA 2YHOA 5TDWA 2CKLA 4AYCB 1E4UA 2KWJA 4PPEA 2DX8A 4BHWA 3LQJA 5FERA 1WEPA 5H1TA 2MNZA 3I2DA 2G43A 2QJ0A 4GB0A 2K4DA 1JM7B 1WEOA 3ASLA 2YQLA 3PURA 4AVXA 1WGMA 1Z6UA 2LGVA 2CSZA 2LXHC 1V87A 5TDRA 3C6WA 3ZTGA 4C9ZA 2HDPA 2VP7A 4AUQB 1WILA 2ZETC 2E6SA 1LDJB 3MHHA 2YREA 4L58A 2XEUA 3N9LA 2YSJA 1ZBDB 4ZUXU 2MD7B 4A49A 3ZPV1 1RMDA 4YATA 2YW8A 3ZVYA 1WFKA 2ECGA 2M1RA 2MNYA 2IDAA 2Y1NA 4FO9A 2D8SA 2CT2A 2ECTA 2QIZA 4AYCA 5JG6A 1F62A 1WE9A 2K17A 3GL6A 4WA6A 2M6MA 4CCGX 3SHBA 2EGPA 4WZ2A 1BORA 4UP0A 4TKPB 2ECNA 4GNFA 3KV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUR A;  2YUC A;  4LJN A;  5C11 A;  1JM7 A;  1WEQ A;  3ZPV E;  3KQI A;  3MHS A;  4XI1 A;  3HCT A;  3PUQ A;  4FJC A;  2KWK A;  3DPL R;  3M99 A;  1U6G B;  1WEN A;  2KWO A;  2I50 A;  5TAB A;  4GND A;  1WEU A;  5KH3 A;  2L5U A;  2L80 A;  4S3O C;  1X4U A;  1XWH A;  1HYI A;  3L11 A;  3ZYQ A;  2VPB A;  2OXQ C;  4YC9 A;  3NG2 A;  3IHP A;  5B8D A;  2YT5 A;  2LGK A;  5FB1 A;  5J3X A;  3EB5 A;  2KR4 A;  3KNV A;  1WIM A;  3N9O A;  5FEY A;  2H0D B;  3O34 A;  5KH9 A;  4QF3 A;  4FK5 A;  2VNF A;  3HTK C;  4PTB A;  1VD4 A;  5LKZ A;  1VYX A;  2ECV A;  2RI7 A;  3RTR B;  2RSD A;  5G04 B;  4V3L C;  2KIZ A;  5AIU A;  2KYU A;  2E6R A;  5C13 A;  2HYE D;  3O70 A;  3VK6 A;  2BAY A;  2LXP C;  4YBM A;  1WEM A;  2MIQ A;  2LDR A;  2KE1 A;  4X3G A;  5FB0 A;  3EB6 A;  3O36 A;  1VFY A;  3LQI A;  2M85 A;  2KWN A;  3HCS A;  4A4C A;  1JOC A;  2CSY A;  4ZDT A;  4MVT A;  4BBQ A;  3KV6 A;  4AP4 A;  3U5O A;  2VPE A;  2JMI A;  3O33 A;  3U5M A;  4IC2 A;  4N3W A;  4UI9 B;  1T1H A;  1WEW A;  2KGI A;  2LV9 A;  2QIC A;  2K1J A;  4R7E A;  2L43 A;  1FP0 A;  2Y1M A;  2PUY A;  2L75 A;  3M62 A;  1WES A;  3PHD A;  5LKU A;  5TBN A;  5H9M A;  2JRJ A;  4P5O B;  4N4F A;  2F6J A;  3SOU A;  5TRB A;  4F52 B;  4LKA A;  4WZ0 A;  2H0D A;  4R2Y A;  4L7X A;  4I7C A;  1G25 A;  3L1X A;  2VJE B;  4ZQL A;  2LGG A;  2KFT A;  5KH7 A;  5LCW B;  4WZ3 B;  3SOX A;  3FL2 A;  1Z60 A;  2VPG A;  2LQ6 A;  2MA6 A;  1X4J A;  4B7Y C;  5G05 B;  4FIP A;  1HYJ A;  3LRQ A;  2MUM A;  1Z2Q A;  5DKA A;  2G45 A;  1X4I A;  2JMD A;  2KU3 A;  2YQM A;  3RPG B;  3HCU A;  4YAX A;  5AIT A;  4YBT A;  3GV4 A;  2VJF B;  2F6N A;  2YHN A;  2UZG A;  5B77 A;  4LAD B;  2ECW A;  2XB1 A;  5D1K B;  2KRE A;  4GNG A;  4CA1 A;  5EYA F;  2Y43 A;  5LKX A;  3LQH A;  2FUU A;  3RPG C;  2MT5 A;  2ECJ A;  2EA6 A;  2CKL B;  3ZVZ B;  4QF2 A;  3U5N A;  2C2L A;  2MD8 C;  3T6R A;  2MA5 A;  2ECI A;  4A4B A;  2YSM A;  2F42 A;  4YAD A;  3ZNI A;  3O7A A;  3N9Q A;  5I3L A;  2FUI A;  2LRI C;  2K16 A;  2VJE A;  4NN2 A;  5DIN A;  4GNE A;  5LKT A;  3SOW A;  5B79 A;  1MM2 A;  2KGG A;  3C5K A;  4W4U A;  5B78 A;  4I7B A;  4LLB A;  1DVP A;  3N9P A;  2PNX A;  3DQV R;  4YBS A;  2C2V S;  3U5P A;  4MSX A;  3O35 A;  1N87 A;  2JMJ A;  3N9M A;  2M3H A;  1LDK C;  4Q6F A;  5B75 A;  4UP5 A;  2YU4 A;  3T7L A;  4A0C D;  4R8P K;  2YYR A;  1K2F A;  5D1M B;  5B76 A;  3L1Z B;  4B86 C;  3O37 A;  2LGL A;  4V3K C;  5G0F A;  2AN6 A;  1CHC A;  2G6Q A;  5D1L B;  2VJF A;  5H1V A;  4I7D A;  1IYM A;  4S3O B;  4IC3 A;  1MM3 A;  2LN0 A;  1WEE A;  1FBV A;  2EOD A;  3M63 A;  4LK9 A;  2L0B A;  1WEV A;  2NAA A;  5H1U A;  4O64 A;  2VPD A;  3V43 A;  2FSA A;  3QZV A;  3N9N A;  4YAB A;  2YHO A;  5TDW A;  2CKL A;  4AYC B;  1E4U A;  2KWJ A;  4PPE A;  2DX8 A;  4BHW A;  3LQJ A;  5FER A;  1WEP A;  5H1T A;  2MNZ A;  3I2D A;  2G43 A;  2QJ0 A;  4GB0 A;  2K4D A;  1JM7 B;  1WEO A;  3ASL A;  2YQL A;  3PUR A;  4AVX A;  1WGM A;  1Z6U A;  2LGV A;  2CSZ A;  2LXH C;  1V87 A;  5TDR A;  3C6W A;  3ZTG A;  4C9Z A;  2HDP A;  2VP7 A;  4AUQ B;  1WIL A;  2ZET C;  2E6S A;  1LDJ B;  3MHH A;  2YRE A;  4L58 A;  2XEU A;  3N9L A;  2YSJ A;  1ZBD B;  4ZUX U;  2MD7 B;  4A49 A;  3ZPV 1;  1RMD A;  4YAT A;  2YW8 A;  3ZVY A;  1WFK A;  2ECG A;  2M1R A;  2MNY A;  2IDA A;  2Y1N A;  4FO9 A;  2D8S A;  2CT2 A;  2ECT A;  2QIZ A;  4AYC A;  5JG6 A;  1F62 A;  1WE9 A;  2K17 A;  3GL6 A;  4WA6 A;  2M6M A;  4CCG X;  3SHB A;  2EGP A;  4WZ2 A;  1BOR A;  4UP0 A;  4TKP B;  2ECN A;  4GNF A;  3KV5 A; 
#chains in the Genus database with same CATH topology
 2YUR A;  2YUC A;  4LJN A;  5C11 A;  1JM7 A;  1WEQ A;  3ZPV E;  4QQ4 A;  3KQI A;  3MHS A;  3DWD A;  4XI1 A;  3HCT A;  3PUQ A;  4FJC A;  2KWK A;  3DPL R;  3M99 A;  1U6G B;  1WEN A;  2KWO A;  2I50 A;  2KKY A;  5TAB A;  4GND A;  1WEU A;  5KH3 A;  2L5U A;  2L80 A;  4S3O C;  1X4U A;  1XWH A;  3FM8 C;  2KKX A;  1HYI A;  3L11 A;  3PLW A;  3ZYQ A;  2EXU A;  2VPB A;  2OXQ C;  4YC9 A;  3NG2 A;  2FD4 A;  3IHP A;  5B8D A;  2YT5 A;  2LGK A;  5FB1 A;  5J3X A;  3EB5 A;  2KR4 A;  3KNV A;  1WIM A;  3N9O A;  5FEY A;  4Z0O A;  2H0D B;  3O34 A;  5KH9 A;  4QF3 A;  4FK5 A;  2VNF A;  3HTK C;  4PTB A;  1VD4 A;  5LKZ A;  1VYX A;  2ECV A;  2RI7 A;  3RTR B;  2RSD A;  5G04 B;  4V3L C;  2KIZ A;  5AIU A;  2KYU A;  2LAU A;  3LJU X;  2E6R A;  5C13 A;  2HYE D;  3FEH A;  3O70 A;  3VK6 A;  2BAY A;  2LXP C;  4YBM A;  1WEM A;  2MIQ A;  4OGE A;  2LDR A;  2KE1 A;  4X3G A;  5FB0 A;  3EB6 A;  3O36 A;  3FJU B;  1VFY A;  3LQI A;  2M85 A;  2KWN A;  3HCS A;  4A4C A;  1JOC A;  2CSY A;  2CRW A;  4ZDT A;  4MVT A;  4BBQ A;  3KV6 A;  4AP4 A;  3U5O A;  2VPE A;  2JMI A;  3O33 A;  3U5M A;  4IC2 A;  2E61 A;  4N3W A;  4UI9 B;  1T1H A;  1WEW A;  2KGI A;  2LV9 A;  2QIC A;  2K1J A;  4R7E A;  2L43 A;  1FP0 A;  3E2D A;  2Y1M A;  2PUY A;  4OGC A;  2L75 A;  3M62 A;  1WES A;  3PHD A;  5LKU A;  5TBN A;  3Q1D A;  5H9M A;  2JRJ A;  4P5O B;  4N4F A;  2F6J A;  3SOU A;  2EGM A;  5TRB A;  4F52 B;  4LKA A;  4WZ0 A;  2H0D A;  2RR4 A;  4R2Y A;  4L7X A;  4I7C A;  1G25 A;  3L1X A;  2VJE B;  4ZQL A;  2LGG A;  2KFT A;  5KH7 A;  2CON A;  3JUE A;  5LCW B;  2IQJ A;  4WZ3 B;  1MBM A;  3SOX A;  3FL2 A;  2B0O E;  1Z60 A;  2VPG A;  2LQ6 A;  5SVI B;  2MA6 A;  1X4J A;  4B7Y C;  5G05 B;  4FIP A;  1HYJ A;  3LRQ A;  2MUM A;  1Z2Q A;  5DKA A;  2G45 A;  1X4I A;  2JMD A;  2KU3 A;  2YQM A;  3RPG B;  3HCU A;  4YAX A;  5AIT A;  4YBT A;  5SVX A;  3GV4 A;  3KDE C;  2VJF B;  2F6N A;  3H7H A;  2YHN A;  2UZG A;  5B77 A;  4LAD B;  2ECW A;  2XB1 A;  5D1K B;  2JM3 A;  2KRE A;  4GNG A;  4CA1 A;  2DJA A;  3LVQ E;  5EYA F;  2Y43 A;  5LKX A;  3LQH A;  2FUU A;  3RPG C;  2MT5 A;  2ECJ A;  2EA6 A;  2CKL B;  3ZVZ B;  4QF2 A;  3U5N A;  2C2L A;  2MD8 C;  3T6R A;  2MA5 A;  2ECI A;  4A4B A;  2YSM A;  2F42 A;  4YAD A;  3ZNI A;  3M7K A;  3O7A A;  3N9Q A;  1DCQ A;  5I3L A;  2FUI A;  3LVR E;  2LRI C;  2K16 A;  3T9K A;  2VJE A;  4NN2 A;  5DIN A;  4GNE A;  5LKT A;  3SOW A;  5B79 A;  1MM2 A;  2KGG A;  3C5K A;  4W4U A;  5B78 A;  4I7B A;  4LLB A;  4O62 A;  1DVP A;  3N9P A;  2PNX A;  2XOZ A;  3DQV R;  4Z0R A;  4YBS A;  2C2V S;  3U5P A;  2M13 A;  4MSX A;  3O35 A;  1N87 A;  2JMJ A;  3N9M A;  2M3H A;  1LDK C;  4Q6F A;  5B75 A;  4UP5 A;  5SVI A;  2YU4 A;  3T7L A;  4A0C D;  2P57 A;  4R8P K;  2YYR A;  1K2F A;  5D1M B;  5B76 A;  3L1Z B;  3MDB C;  4B86 C;  3O37 A;  2LGL A;  2XOC A;  4V3K C;  5G0F A;  2AN6 A;  2JUN A;  1CHC A;  5SVY A;  2G6Q A;  5D1L B;  2VJF A;  5H1V A;  4I7D A;  1IYM A;  4S3O B;  4IC3 A;  1MM3 A;  2LN0 A;  1WEE A;  1FBV A;  2EOD A;  3M63 A;  4LK9 A;  2L0B A;  1WEV A;  2NAA A;  5H1U A;  3DDT A;  4O64 A;  2VPD A;  2FFW A;  3V43 A;  2FSA A;  4H9D A;  3QZV A;  3N9N A;  3SUB A;  5K3Q A;  4YAB A;  2YHO A;  5TDW A;  2CKL A;  4AYC B;  1E4U A;  2CSV A;  2KWJ A;  4PPE A;  2MKE A;  2DX8 A;  4BHW A;  2L7P A;  3LQJ A;  5FER A;  1WEP A;  5H1T A;  2MNZ A;  3I2D A;  2G43 A;  2QJ0 A;  2XP0 A;  4GB0 A;  2K4D A;  3O47 A;  1JM7 B;  1WEO A;  3ASL A;  2YQL A;  3PUR A;  4AVX A;  1WGM A;  1Z6U A;  2LGV A;  2CSZ A;  2LXH C;  1V87 A;  5TDR A;  3C6W A;  3FAN A;  3ZTG A;  4C9Z A;  2HDP A;  2VP7 A;  4AUQ B;  1WIL A;  2ZET C;  2E6S A;  1LDJ B;  3MHH A;  2YRE A;  4L58 A;  2XEU A;  3N9L A;  2YSJ A;  3LDY A;  1ZBD B;  4ZUX U;  2MD7 B;  4A49 A;  3ZPV 1;  1RMD A;  2CRR A;  4F1P A;  4YAT A;  2YW8 A;  3ZVY A;  1WFK A;  2ECG A;  2D8U A;  2M1R A;  2MNY A;  2IDA A;  2Y1N A;  2YVR A;  4FO9 A;  2D8S A;  2CT2 A;  2ECT A;  2DSM A;  2QIZ A;  4AYC A;  5JG6 A;  1F62 A;  1WE9 A;  2K17 A;  3GL6 A;  4WA6 A;  2M6M A;  4CCG X;  3SHB A;  3FAO A;  2XOY A;  2EGP A;  4WZ2 A;  1BOR A;  4UP0 A;  2OWA A;  4TKP B;  2ECN A;  4GNF A;  3KV5 A; 
#chains in the Genus database with same CATH homology
 2YUR A;  2YUC A;  4LJN A;  5C11 A;  1JM7 A;  1WEQ A;  3ZPV E;  3KQI A;  3MHS A;  4XI1 A;  3HCT A;  3PUQ A;  4FJC A;  2KWK A;  3DPL R;  3M99 A;  1U6G B;  1WEN A;  2KWO A;  2I50 A;  5TAB A;  4GND A;  1WEU A;  5KH3 A;  2L5U A;  2L80 A;  4S3O C;  1X4U A;  1XWH A;  1HYI A;  3L11 A;  3ZYQ A;  2VPB A;  2OXQ C;  4YC9 A;  3NG2 A;  3IHP A;  5B8D A;  2YT5 A;  2LGK A;  5FB1 A;  5J3X A;  3EB5 A;  2KR4 A;  3KNV A;  1WIM A;  3N9O A;  5FEY A;  2H0D B;  3O34 A;  5KH9 A;  4QF3 A;  4FK5 A;  2VNF A;  3HTK C;  4PTB A;  1VD4 A;  5LKZ A;  1VYX A;  2ECV A;  2RI7 A;  3RTR B;  2RSD A;  5G04 B;  4V3L C;  2KIZ A;  5AIU A;  2KYU A;  2E6R A;  5C13 A;  2HYE D;  3O70 A;  3VK6 A;  2BAY A;  2LXP C;  4YBM A;  1WEM A;  2MIQ A;  2LDR A;  2KE1 A;  4X3G A;  5FB0 A;  3EB6 A;  3O36 A;  1VFY A;  3LQI A;  2M85 A;  2KWN A;  3HCS A;  4A4C A;  1JOC A;  2CSY A;  4ZDT A;  4MVT A;  4BBQ A;  3KV6 A;  4AP4 A;  3U5O A;  2VPE A;  2JMI A;  3O33 A;  3U5M A;  4IC2 A;  4N3W A;  4UI9 B;  1T1H A;  1WEW A;  2KGI A;  2LV9 A;  2QIC A;  2K1J A;  4R7E A;  2L43 A;  1FP0 A;  2Y1M A;  2PUY A;  2L75 A;  3M62 A;  1WES A;  3PHD A;  5LKU A;  5TBN A;  5H9M A;  2JRJ A;  4P5O B;  4N4F A;  2F6J A;  3SOU A;  5TRB A;  4F52 B;  4LKA A;  4WZ0 A;  2H0D A;  4R2Y A;  4L7X A;  4I7C A;  1G25 A;  3L1X A;  2VJE B;  4ZQL A;  2LGG A;  2KFT A;  5KH7 A;  5LCW B;  4WZ3 B;  3SOX A;  3FL2 A;  1Z60 A;  2VPG A;  2LQ6 A;  2MA6 A;  1X4J A;  4B7Y C;  5G05 B;  4FIP A;  1HYJ A;  3LRQ A;  2MUM A;  1Z2Q A;  5DKA A;  2G45 A;  1X4I A;  2JMD A;  2KU3 A;  2YQM A;  3RPG B;  3HCU A;  4YAX A;  5AIT A;  4YBT A;  3GV4 A;  2VJF B;  2F6N A;  2YHN A;  2UZG A;  5B77 A;  4LAD B;  2ECW A;  2XB1 A;  5D1K B;  2KRE A;  4GNG A;  4CA1 A;  5EYA F;  2Y43 A;  5LKX A;  3LQH A;  2FUU A;  3RPG C;  2MT5 A;  2ECJ A;  2EA6 A;  2CKL B;  3ZVZ B;  4QF2 A;  3U5N A;  2C2L A;  2MD8 C;  3T6R A;  2MA5 A;  2ECI A;  4A4B A;  2YSM A;  2F42 A;  4YAD A;  3ZNI A;  3O7A A;  3N9Q A;  5I3L A;  2FUI A;  2LRI C;  2K16 A;  2VJE A;  4NN2 A;  5DIN A;  4GNE A;  5LKT A;  3SOW A;  5B79 A;  1MM2 A;  2KGG A;  3C5K A;  4W4U A;  5B78 A;  4I7B A;  4LLB A;  1DVP A;  3N9P A;  2PNX A;  3DQV R;  4YBS A;  2C2V S;  3U5P A;  4MSX A;  3O35 A;  1N87 A;  2JMJ A;  3N9M A;  2M3H A;  1LDK C;  4Q6F A;  5B75 A;  4UP5 A;  2YU4 A;  3T7L A;  4A0C D;  4R8P K;  2YYR A;  1K2F A;  5D1M B;  5B76 A;  3L1Z B;  4B86 C;  3O37 A;  2LGL A;  4V3K C;  5G0F A;  2AN6 A;  1CHC A;  2G6Q A;  5D1L B;  2VJF A;  5H1V A;  4I7D A;  1IYM A;  4S3O B;  4IC3 A;  1MM3 A;  2LN0 A;  1WEE A;  1FBV A;  2EOD A;  3M63 A;  4LK9 A;  2L0B A;  1WEV A;  2NAA A;  5H1U A;  4O64 A;  2VPD A;  3V43 A;  2FSA A;  3QZV A;  3N9N A;  4YAB A;  2YHO A;  5TDW A;  2CKL A;  4AYC B;  1E4U A;  2KWJ A;  4PPE A;  2DX8 A;  4BHW A;  3LQJ A;  5FER A;  1WEP A;  5H1T A;  2MNZ A;  3I2D A;  2G43 A;  2QJ0 A;  4GB0 A;  2K4D A;  1JM7 B;  1WEO A;  3ASL A;  2YQL A;  3PUR A;  4AVX A;  1WGM A;  1Z6U A;  2LGV A;  2CSZ A;  2LXH C;  1V87 A;  5TDR A;  3C6W A;  3ZTG A;  4C9Z A;  2HDP A;  2VP7 A;  4AUQ B;  1WIL A;  2ZET C;  2E6S A;  1LDJ B;  3MHH A;  2YRE A;  4L58 A;  2XEU A;  3N9L A;  2YSJ A;  1ZBD B;  4ZUX U;  2MD7 B;  4A49 A;  3ZPV 1;  1RMD A;  4YAT A;  2YW8 A;  3ZVY A;  1WFK A;  2ECG A;  2M1R A;  2MNY A;  2IDA A;  2Y1N A;  4FO9 A;  2D8S A;  2CT2 A;  2ECT A;  2QIZ A;  4AYC A;  5JG6 A;  1F62 A;  1WE9 A;  2K17 A;  3GL6 A;  4WA6 A;  2M6M A;  4CCG X;  3SHB A;  2EGP A;  4WZ2 A;  1BOR A;  4UP0 A;  4TKP B;  2ECN A;  4GNF A;  3KV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...