4GB0A

Crystal structure of the ring domain of rnf168
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
b'LPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF168
publication title Structural basis for role of ring finger protein RNF168 RING domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 27
structure length 91
sequence length 91
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gb0A00
4A4BA 2QICA 3ZVYA 2KGIA 3O7AA 4A0CD 4MSXA 3EB5A 2C2LA 2CKLA 4IC3A 2ZETC 2LRIC 2L75A 3SOUA 2HDPA 5LKZA 3FL2A 2EA6A 2Y1MA 5TBNA 5G05B 4N4FA 5TABA 1WIMA 5H1UA 4CA1A 2CSYA 5J3XA 2YUCA 4AVXA 4AYCA 2YQLA 3RPGB 1WEWA 4QF3A 3MHHA 3KV5A 4UI9B 1ZBDB 1RMDA 2G45A 2F6NA 2VPEA 2K1JA 4P5OB 2KIZA 4FJCA 2AN6A 2LN0A 2LDRA 2MA5A 4WZ2A 1WE9A 4AUQB 4GB0A 5H9MA 2KREA 4WZ0A 4YBMA 1VYXA 2MUMA 4NN2A 3L11A 4B7YC 4LKAA 1DVPA 2XB1A 2E6SA 4ZUXU 5EYAF 3O33A 1Z6UA 2EGPA 3O70A 5FERA 2ECWA 2ECJA 5KH3A 1Z60A 1V87A 2Y1NA 3U5NA 1LDJB 4YADA 4A49A 1WEEA 2LGLA 5AIUA 1JOCA 2XEUA 3O34A 3ZNIA 2KYUA 1BORA 3O37A 4MVTA 2L5UA 4LK9A 2K16A 2VJFB 3SHBA 2YU4A 4A4CA 3HCTA 4YAXA 2K17A 2YSMA 2VJEB 3ZTGA 5B77A 2KWNA 5G04B 3LQJA 2LGVA 4IC2A 4PPEA 2KFTA 2F42A 1JM7A 5KH9A 2ECGA 4Q6FA 3T7LA 2M3HA 4AYCB 2VJEA 2OXQC 3MHSA 2PUYA 4W4UA 4S3OB 5D1KB 3U5OA 1WEOA 2VNFA 1WEUA 3N9LA 4FK5A 2LGKA 3KQIA 4I7CA 3QZVA 3U5MA 2VPGA 3VK6A 4R7EA 2HYED 4N3WA 3PUQA 2KWJA 4R2YA 5LKUA 2VP7A 4LJNA 1F62A 2EODA 1IYMA 2LV9A 1MM3A 2ECNA 1WENA 1WGMA 2FSAA 3HCSA 3I2DA 2LGGA 5FEYA 4LADB 1K2FA 5I3LA 3LQHA 3V43A 4X3GA 1HYJA 5D1MB 2KU3A 2ECIA 3LQIA 2RI7A 2KGGA 4WZ3B 3U5PA 3O35A 1XWHA 3HTKC 2JMIA 5C11A 4V3KC 1WFKA 2YHNA 5DINA 1HYIA 1VFYA 2QIZA 1WEPA 2JMJA 5DKAA 5B79A 1WESA 2E6RA 4XI1A 4F52B 5TRBA 1CHCA 4YBSA 1VD4A 3PHDA 3KV6A 3M62A 2D8SA 5AITA 3RPGC 1MM2A 5LKXA 4ZQLA 4GNFA 3SOWA 3HCUA 2ECTA 3KNVA 1U6GB 1N87A 5KH7A 1JM7B 2F6JA 4C9ZA 1WEQA 4CCGX 4PTBA 4QF2A 2FUIA 3C6WA 4WA6A 3T6RA 4YBTA 4I7BA 4B86C 2YURA 3GV4A 3L1ZB 1FBVA 4GNEA 4UP5A 2C2VS 4ZDTA 1X4IA 4V3LC 2YSJA 1G25A 2QJ0A 3PURA 4GNDA 2MA6A 1T1HA 3L1XA 5B8DA 3N9PA 3M63A 3SOXA 2I50A 2M6MA 2G6QA 4R8PK 1WILA 2DX8A 1X4JA 4L7XA 5B78A 2H0DA 3GL6A 3N9MA 2RSDA 4GNGA 2CSZA 4L58A 5TDWA 1E4UA 3RTRB 3EB6A 2YYRA 4I7DA 1LDKC 2MIQA 5C13A 3DQVR 2M1RA 3ZPV1 5H1VA 2VPDA 3ZPVE 4BHWA 3N9OA 3ZVZB 1Z2QA 2JRJA 2KR4A 2YQMA 3ZYQA 2Y43A 4O64A 4S3OC 1FP0A 3N9QA 5TDRA 5JG6A 2L0BA 2MD8C 2JMDA 4TKPB 5H1TA 2L80A 5D1LB 5B75A 2KWKA 2NAAA 2KWOA 3DPLR 4AP4A 3C5KA 2FUUA 3N9NA 2YHOA 2LXHC 2M85A 4LLBA 5FB0A 3LRQA 4FO9A 1WEMA 2G43A 4FIPA 2L43A 2MD7B 5B76A 2LXPC 3ASLA 4YABA 2YW8A 5LKTA 5LCWB 4YC9A 2YT5A 4BBQA 2CT2A 3M99A 2UZGA 3IHPA 2ECVA 3O36A 2VPBA 2MNZA 5G0FA 2IDAA 1WEVA 2MNYA 2LQ6A 2PNXA 3NG2A 2K4DA 4YATA 2H0DB 2KE1A 2MT5A 2CKLB 4UP0A 5FB1A 2VJFA 1X4UA 2YREA 2BAYA
chains in the Genus database with same CATH superfamily
4A4BA 2QICA 3ZVYA 4OGEA 2KGIA 3O7AA 4A0CD 4MSXA 3EB5A 2C2LA 2CKLA 4IC3A 2ZETC 2LRIC 2L75A 2JUNA 3SOUA 2HDPA 5LKZA 3FL2A 2EA6A 2Y1MA 5TBNA 5G05B 4N4FA 5TABA 3O47A 1WIMA 5H1UA 4CA1A 2CSYA 5J3XA 2YUCA 3DDTA 4AVXA 4AYCA 2YQLA 3RPGB 1WEWA 4QF3A 3MHHA 3KV5A 4UI9B 1ZBDB 1RMDA 2G45A 2F6NA 2VPEA 2K1JA 4P5OB 2KIZA 4FJCA 2AN6A 2LN0A 2LDRA 2MA5A 4WZ2A 1WE9A 4AUQB 4GB0A 5H9MA 2KREA 4WZ0A 4YBMA 1VYXA 2MUMA 4NN2A 3L11A 4B7YC 4LKAA 1DVPA 2XB1A 2E6SA 4ZUXU 5EYAF 3O33A 2FFWA 2XOZA 1Z6UA 2B0OE 2EGPA 3O70A 5FERA 2ECWA 2ECJA 5KH3A 1Z60A 3DWDA 1V87A 2Y1NA 4QQ4A 3U5NA 1LDJB 4YADA 4A49A 1WEEA 2LGLA 5AIUA 4OGCA 1JOCA 2CRRA 3H7HA 2XEUA 3O34A 3ZNIA 2KYUA 1BORA 2JM3A 3LVQE 3Q1DA 3O37A 4MVTA 2L5UA 4LK9A 2K16A 2VJFB 3SHBA 2YU4A 4A4CA 3HCTA 4YAXA 2KKYA 2K17A 2MKEA 2YSMA 2VJEB 3ZTGA 5B77A 5SVYA 3FJUB 2KWNA 5G04B 3LQJA 2LGVA 2P57A 3E2DA 4IC2A 4PPEA 2KFTA 2DSMA 2F42A 1JM7A 5KH9A 2CONA 2ECGA 4Q6FA 3LJUX 3T7LA 2M3HA 4AYCB 2VJEA 2M13A 2OXQC 3MHSA 2PUYA 4W4UA 4S3OB 5D1KB 3U5OA 1WEOA 2VNFA 1WEUA 3N9LA 4FK5A 2LGKA 3KQIA 4I7CA 3T9KA 3QZVA 3U5MA 2VPGA 3VK6A 4R7EA 2HYED 4N3WA 3KDEC 2RR4A 3PUQA 4Z0RA 2KWJA 4R2YA 5LKUA 2VP7A 4LJNA 3M7KA 1F62A 2EODA 1IYMA 2LV9A 1MM3A 2ECNA 1WENA 2L7PA 1WGMA 2FSAA 3HCSA 3I2DA 2LGGA 5FEYA 3FANA 1MBMA 4LADB 1K2FA 5I3LA 3LQHA 3V43A 5K3QA 4X3GA 1HYJA 5D1MB 2KU3A 2ECIA 3LQIA 2RI7A 2KGGA 4WZ3B 4O62A 3U5PA 3O35A 1XWHA 3HTKC 2JMIA 5C11A 4V3KC 1WFKA 2YHNA 2EGMA 5DINA 1HYIA 1VFYA 2QIZA 2EXUA 1WEPA 2JMJA 5DKAA 5B79A 1WESA 2E6RA 4XI1A 4F52B 5TRBA 1CHCA 4YBSA 2XOCA 1VD4A 3PHDA 3FAOA 3KV6A 3M62A 2D8SA 5AITA 5SVXA 3RPGC 1MM2A 5LKXA 2D8UA 4ZQLA 4GNFA 3SOWA 3HCUA 2ECTA 3KNVA 1U6GB 2FD4A 1N87A 5KH7A 1JM7B 2F6JA 2OWAA 2XP0A 2IQJA 4C9ZA 1WEQA 4CCGX 4PTBA 4QF2A 2FUIA 3LDYA 3C6WA 4WA6A 3T6RA 4YBTA 4I7BA 4B86C 2YURA 3GV4A 3L1ZB 1FBVA 4GNEA 4UP5A 2C2VS 4ZDTA 1X4IA 2YVRA 4V3LC 2YSJA 1G25A 2QJ0A 3PURA 4GNDA 2MA6A 1T1HA 3L1XA 5B8DA 3N9PA 4Z0OA 3M63A 3SOXA 2I50A 2M6MA 2G6QA 4R8PK 1WILA 5SVIB 2DX8A 1X4JA 4L7XA 5B78A 2H0DA 3GL6A 3N9MA 2RSDA 1DCQA 4GNGA 2CSZA 4L58A 5TDWA 4F1PA 1E4UA 3RTRB 3EB6A 2YYRA 4I7DA 5SVIA 1LDKC 2MIQA 5C13A 3DQVR 2M1RA 3PLWA 3MDBC 3ZPV1 5H1VA 2VPDA 3SUBA 3FM8C 3ZPVE 4BHWA 3N9OA 3ZVZB 1Z2QA 2JRJA 2E61A 2KR4A 2YQMA 3ZYQA 2Y43A 4O64A 2LAUA 4S3OC 1FP0A 3N9QA 5TDRA 5JG6A 2L0BA 2MD8C 2JMDA 4TKPB 2CSVA 5H1TA 2L80A 5D1LB 5B75A 2KWKA 2NAAA 2KWOA 3DPLR 4AP4A 3C5KA 3LVRE 2FUUA 3N9NA 2YHOA 2DJAA 2LXHC 2M85A 4LLBA 5FB0A 3LRQA 4FO9A 1WEMA 3FEHA 2G43A 2KKXA 4FIPA 2L43A 2MD7B 5B76A 2LXPC 3ASLA 4YABA 2YW8A 5LKTA 4H9DA 5LCWB 4YC9A 2YT5A 4BBQA 2CT2A 3M99A 2UZGA 2CRWA 3IHPA 2ECVA 3O36A 3JUEA 2VPBA 2MNZA 5G0FA 2IDAA 1WEVA 2MNYA 2LQ6A 2PNXA 3NG2A 2K4DA 4YATA 2H0DB 2KE1A 2MT5A 2CKLB 4UP0A 5FB1A 2XOYA 2VJFA 1X4UA 2YREA 2BAYA
chains in the Genus database with same CATH topology
4A4BA 2QICA 3ZVYA 2KGIA 3O7AA 4A0CD 4MSXA 3EB5A 2C2LA 2CKLA 4IC3A 2ZETC 2LRIC 2L75A 3SOUA 2HDPA 5LKZA 3FL2A 2EA6A 2Y1MA 5TBNA 5G05B 4N4FA 5TABA 1WIMA 5H1UA 4CA1A 2CSYA 5J3XA 2YUCA 4AVXA 4AYCA 2YQLA 3RPGB 1WEWA 4QF3A 3MHHA 3KV5A 4UI9B 1ZBDB 1RMDA 2G45A 2F6NA 2VPEA 2K1JA 4P5OB 2KIZA 4FJCA 2AN6A 2LN0A 2LDRA 2MA5A 4WZ2A 1WE9A 4AUQB 4GB0A 5H9MA 2KREA 4WZ0A 4YBMA 1VYXA 2MUMA 4NN2A 3L11A 4B7YC 4LKAA 1DVPA 2XB1A 2E6SA 4ZUXU 5EYAF 3O33A 1Z6UA 2EGPA 3O70A 5FERA 2ECWA 2ECJA 5KH3A 1Z60A 1V87A 2Y1NA 3U5NA 1LDJB 4YADA 4A49A 1WEEA 2LGLA 5AIUA 1JOCA 2XEUA 3O34A 3ZNIA 2KYUA 1BORA 3O37A 4MVTA 2L5UA 4LK9A 2K16A 2VJFB 3SHBA 2YU4A 4A4CA 3HCTA 4YAXA 2K17A 2YSMA 2VJEB 3ZTGA 5B77A 2KWNA 5G04B 3LQJA 2LGVA 4IC2A 4PPEA 2KFTA 2F42A 1JM7A 5KH9A 2ECGA 4Q6FA 3T7LA 2M3HA 4AYCB 2VJEA 2OXQC 3MHSA 2PUYA 4W4UA 4S3OB 5D1KB 3U5OA 1WEOA 2VNFA 1WEUA 3N9LA 4FK5A 2LGKA 3KQIA 4I7CA 3QZVA 3U5MA 2VPGA 3VK6A 4R7EA 2HYED 4N3WA 3PUQA 2KWJA 4R2YA 5LKUA 2VP7A 4LJNA 1F62A 2EODA 1IYMA 2LV9A 1MM3A 2ECNA 1WENA 1WGMA 2FSAA 3HCSA 3I2DA 2LGGA 5FEYA 4LADB 1K2FA 5I3LA 3LQHA 3V43A 4X3GA 1HYJA 5D1MB 2KU3A 2ECIA 3LQIA 2RI7A 2KGGA 4WZ3B 3U5PA 3O35A 1XWHA 3HTKC 2JMIA 5C11A 4V3KC 1WFKA 2YHNA 5DINA 1HYIA 1VFYA 2QIZA 1WEPA 2JMJA 5DKAA 5B79A 1WESA 2E6RA 4XI1A 4F52B 5TRBA 1CHCA 4YBSA 1VD4A 3PHDA 3KV6A 3M62A 2D8SA 5AITA 3RPGC 1MM2A 5LKXA 4ZQLA 4GNFA 3SOWA 3HCUA 2ECTA 3KNVA 1U6GB 1N87A 5KH7A 1JM7B 2F6JA 4C9ZA 1WEQA 4CCGX 4PTBA 4QF2A 2FUIA 3C6WA 4WA6A 3T6RA 4YBTA 4I7BA 4B86C 2YURA 3GV4A 3L1ZB 1FBVA 4GNEA 4UP5A 2C2VS 4ZDTA 1X4IA 4V3LC 2YSJA 1G25A 2QJ0A 3PURA 4GNDA 2MA6A 1T1HA 3L1XA 5B8DA 3N9PA 3M63A 3SOXA 2I50A 2M6MA 2G6QA 4R8PK 1WILA 2DX8A 1X4JA 4L7XA 5B78A 2H0DA 3GL6A 3N9MA 2RSDA 4GNGA 2CSZA 4L58A 5TDWA 1E4UA 3RTRB 3EB6A 2YYRA 4I7DA 1LDKC 2MIQA 5C13A 3DQVR 2M1RA 3ZPV1 5H1VA 2VPDA 3ZPVE 4BHWA 3N9OA 3ZVZB 1Z2QA 2JRJA 2KR4A 2YQMA 3ZYQA 2Y43A 4O64A 4S3OC 1FP0A 3N9QA 5TDRA 5JG6A 2L0BA 2MD8C 2JMDA 4TKPB 5H1TA 2L80A 5D1LB 5B75A 2KWKA 2NAAA 2KWOA 3DPLR 4AP4A 3C5KA 2FUUA 3N9NA 2YHOA 2LXHC 2M85A 4LLBA 5FB0A 3LRQA 4FO9A 1WEMA 2G43A 4FIPA 2L43A 2MD7B 5B76A 2LXPC 3ASLA 4YABA 2YW8A 5LKTA 5LCWB 4YC9A 2YT5A 4BBQA 2CT2A 3M99A 2UZGA 3IHPA 2ECVA 3O36A 2VPBA 2MNZA 5G0FA 2IDAA 1WEVA 2MNYA 2LQ6A 2PNXA 3NG2A 2K4DA 4YATA 2H0DB 2KE1A 2MT5A 2CKLB 4UP0A 5FB1A 2VJFA 1X4UA 2YREA 2BAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B A;  2QIC A;  3ZVY A;  2KGI A;  3O7A A;  4A0C D;  4MSX A;  3EB5 A;  2C2L A;  2CKL A;  4IC3 A;  2ZET C;  2LRI C;  2L75 A;  3SOU A;  2HDP A;  5LKZ A;  3FL2 A;  2EA6 A;  2Y1M A;  5TBN A;  5G05 B;  4N4F A;  5TAB A;  1WIM A;  5H1U A;  4CA1 A;  2CSY A;  5J3X A;  2YUC A;  4AVX A;  4AYC A;  2YQL A;  3RPG B;  1WEW A;  4QF3 A;  3MHH A;  3KV5 A;  4UI9 B;  1ZBD B;  1RMD A;  2G45 A;  2F6N A;  2VPE A;  2K1J A;  4P5O B;  2KIZ A;  4FJC A;  2AN6 A;  2LN0 A;  2LDR A;  2MA5 A;  4WZ2 A;  1WE9 A;  4AUQ B;  4GB0 A;  5H9M A;  2KRE A;  4WZ0 A;  4YBM A;  1VYX A;  2MUM A;  4NN2 A;  3L11 A;  4B7Y C;  4LKA A;  1DVP A;  2XB1 A;  2E6S A;  4ZUX U;  5EYA F;  3O33 A;  1Z6U A;  2EGP A;  3O70 A;  5FER A;  2ECW A;  2ECJ A;  5KH3 A;  1Z60 A;  1V87 A;  2Y1N A;  3U5N A;  1LDJ B;  4YAD A;  4A49 A;  1WEE A;  2LGL A;  5AIU A;  1JOC A;  2XEU A;  3O34 A;  3ZNI A;  2KYU A;  1BOR A;  3O37 A;  4MVT A;  2L5U A;  4LK9 A;  2K16 A;  2VJF B;  3SHB A;  2YU4 A;  4A4C A;  3HCT A;  4YAX A;  2K17 A;  2YSM A;  2VJE B;  3ZTG A;  5B77 A;  2KWN A;  5G04 B;  3LQJ A;  2LGV A;  4IC2 A;  4PPE A;  2KFT A;  2F42 A;  1JM7 A;  5KH9 A;  2ECG A;  4Q6F A;  3T7L A;  2M3H A;  4AYC B;  2VJE A;  2OXQ C;  3MHS A;  2PUY A;  4W4U A;  4S3O B;  5D1K B;  3U5O A;  1WEO A;  2VNF A;  1WEU A;  3N9L A;  4FK5 A;  2LGK A;  3KQI A;  4I7C A;  3QZV A;  3U5M A;  2VPG A;  3VK6 A;  4R7E A;  2HYE D;  4N3W A;  3PUQ A;  2KWJ A;  4R2Y A;  5LKU A;  2VP7 A;  4LJN A;  1F62 A;  2EOD A;  1IYM A;  2LV9 A;  1MM3 A;  2ECN A;  1WEN A;  1WGM A;  2FSA A;  3HCS A;  3I2D A;  2LGG A;  5FEY A;  4LAD B;  1K2F A;  5I3L A;  3LQH A;  3V43 A;  4X3G A;  1HYJ A;  5D1M B;  2KU3 A;  2ECI A;  3LQI A;  2RI7 A;  2KGG A;  4WZ3 B;  3U5P A;  3O35 A;  1XWH A;  3HTK C;  2JMI A;  5C11 A;  4V3K C;  1WFK A;  2YHN A;  5DIN A;  1HYI A;  1VFY A;  2QIZ A;  1WEP A;  2JMJ A;  5DKA A;  5B79 A;  1WES A;  2E6R A;  4XI1 A;  4F52 B;  5TRB A;  1CHC A;  4YBS A;  1VD4 A;  3PHD A;  3KV6 A;  3M62 A;  2D8S A;  5AIT A;  3RPG C;  1MM2 A;  5LKX A;  4ZQL A;  4GNF A;  3SOW A;  3HCU A;  2ECT A;  3KNV A;  1U6G B;  1N87 A;  5KH7 A;  1JM7 B;  2F6J A;  4C9Z A;  1WEQ A;  4CCG X;  4PTB A;  4QF2 A;  2FUI A;  3C6W A;  4WA6 A;  3T6R A;  4YBT A;  4I7B A;  4B86 C;  2YUR A;  3GV4 A;  3L1Z B;  1FBV A;  4GNE A;  4UP5 A;  2C2V S;  4ZDT A;  1X4I A;  4V3L C;  2YSJ A;  1G25 A;  2QJ0 A;  3PUR A;  4GND A;  2MA6 A;  1T1H A;  3L1X A;  5B8D A;  3N9P A;  3M63 A;  3SOX A;  2I50 A;  2M6M A;  2G6Q A;  4R8P K;  1WIL A;  2DX8 A;  1X4J A;  4L7X A;  5B78 A;  2H0D A;  3GL6 A;  3N9M A;  2RSD A;  4GNG A;  2CSZ A;  4L58 A;  5TDW A;  1E4U A;  3RTR B;  3EB6 A;  2YYR A;  4I7D A;  1LDK C;  2MIQ A;  5C13 A;  3DQV R;  2M1R A;  3ZPV 1;  5H1V A;  2VPD A;  3ZPV E;  4BHW A;  3N9O A;  3ZVZ B;  1Z2Q A;  2JRJ A;  2KR4 A;  2YQM A;  3ZYQ A;  2Y43 A;  4O64 A;  4S3O C;  1FP0 A;  3N9Q A;  5TDR A;  5JG6 A;  2L0B A;  2MD8 C;  2JMD A;  4TKP B;  5H1T A;  2L80 A;  5D1L B;  5B75 A;  2KWK A;  2NAA A;  2KWO A;  3DPL R;  4AP4 A;  3C5K A;  2FUU A;  3N9N A;  2YHO A;  2LXH C;  2M85 A;  4LLB A;  5FB0 A;  3LRQ A;  4FO9 A;  1WEM A;  2G43 A;  4FIP A;  2L43 A;  2MD7 B;  5B76 A;  2LXP C;  3ASL A;  4YAB A;  2YW8 A;  5LKT A;  5LCW B;  4YC9 A;  2YT5 A;  4BBQ A;  2CT2 A;  3M99 A;  2UZG A;  3IHP A;  2ECV A;  3O36 A;  2VPB A;  2MNZ A;  5G0F A;  2IDA A;  1WEV A;  2MNY A;  2LQ6 A;  2PNX A;  3NG2 A;  2K4D A;  4YAT A;  2H0D B;  2KE1 A;  2MT5 A;  2CKL B;  4UP0 A;  5FB1 A;  2VJF A;  1X4U A;  2YRE A;  2BAY A; 
#chains in the Genus database with same CATH topology
 4A4B A;  2QIC A;  3ZVY A;  4OGE A;  2KGI A;  3O7A A;  4A0C D;  4MSX A;  3EB5 A;  2C2L A;  2CKL A;  4IC3 A;  2ZET C;  2LRI C;  2L75 A;  2JUN A;  3SOU A;  2HDP A;  5LKZ A;  3FL2 A;  2EA6 A;  2Y1M A;  5TBN A;  5G05 B;  4N4F A;  5TAB A;  3O47 A;  1WIM A;  5H1U A;  4CA1 A;  2CSY A;  5J3X A;  2YUC A;  3DDT A;  4AVX A;  4AYC A;  2YQL A;  3RPG B;  1WEW A;  4QF3 A;  3MHH A;  3KV5 A;  4UI9 B;  1ZBD B;  1RMD A;  2G45 A;  2F6N A;  2VPE A;  2K1J A;  4P5O B;  2KIZ A;  4FJC A;  2AN6 A;  2LN0 A;  2LDR A;  2MA5 A;  4WZ2 A;  1WE9 A;  4AUQ B;  4GB0 A;  5H9M A;  2KRE A;  4WZ0 A;  4YBM A;  1VYX A;  2MUM A;  4NN2 A;  3L11 A;  4B7Y C;  4LKA A;  1DVP A;  2XB1 A;  2E6S A;  4ZUX U;  5EYA F;  3O33 A;  2FFW A;  2XOZ A;  1Z6U A;  2B0O E;  2EGP A;  3O70 A;  5FER A;  2ECW A;  2ECJ A;  5KH3 A;  1Z60 A;  3DWD A;  1V87 A;  2Y1N A;  4QQ4 A;  3U5N A;  1LDJ B;  4YAD A;  4A49 A;  1WEE A;  2LGL A;  5AIU A;  4OGC A;  1JOC A;  2CRR A;  3H7H A;  2XEU A;  3O34 A;  3ZNI A;  2KYU A;  1BOR A;  2JM3 A;  3LVQ E;  3Q1D A;  3O37 A;  4MVT A;  2L5U A;  4LK9 A;  2K16 A;  2VJF B;  3SHB A;  2YU4 A;  4A4C A;  3HCT A;  4YAX A;  2KKY A;  2K17 A;  2MKE A;  2YSM A;  2VJE B;  3ZTG A;  5B77 A;  5SVY A;  3FJU B;  2KWN A;  5G04 B;  3LQJ A;  2LGV A;  2P57 A;  3E2D A;  4IC2 A;  4PPE A;  2KFT A;  2DSM A;  2F42 A;  1JM7 A;  5KH9 A;  2CON A;  2ECG A;  4Q6F A;  3LJU X;  3T7L A;  2M3H A;  4AYC B;  2VJE A;  2M13 A;  2OXQ C;  3MHS A;  2PUY A;  4W4U A;  4S3O B;  5D1K B;  3U5O A;  1WEO A;  2VNF A;  1WEU A;  3N9L A;  4FK5 A;  2LGK A;  3KQI A;  4I7C A;  3T9K A;  3QZV A;  3U5M A;  2VPG A;  3VK6 A;  4R7E A;  2HYE D;  4N3W A;  3KDE C;  2RR4 A;  3PUQ A;  4Z0R A;  2KWJ A;  4R2Y A;  5LKU A;  2VP7 A;  4LJN A;  3M7K A;  1F62 A;  2EOD A;  1IYM A;  2LV9 A;  1MM3 A;  2ECN A;  1WEN A;  2L7P A;  1WGM A;  2FSA A;  3HCS A;  3I2D A;  2LGG A;  5FEY A;  3FAN A;  1MBM A;  4LAD B;  1K2F A;  5I3L A;  3LQH A;  3V43 A;  5K3Q A;  4X3G A;  1HYJ A;  5D1M B;  2KU3 A;  2ECI A;  3LQI A;  2RI7 A;  2KGG A;  4WZ3 B;  4O62 A;  3U5P A;  3O35 A;  1XWH A;  3HTK C;  2JMI A;  5C11 A;  4V3K C;  1WFK A;  2YHN A;  2EGM A;  5DIN A;  1HYI A;  1VFY A;  2QIZ A;  2EXU A;  1WEP A;  2JMJ A;  5DKA A;  5B79 A;  1WES A;  2E6R A;  4XI1 A;  4F52 B;  5TRB A;  1CHC A;  4YBS A;  2XOC A;  1VD4 A;  3PHD A;  3FAO A;  3KV6 A;  3M62 A;  2D8S A;  5AIT A;  5SVX A;  3RPG C;  1MM2 A;  5LKX A;  2D8U A;  4ZQL A;  4GNF A;  3SOW A;  3HCU A;  2ECT A;  3KNV A;  1U6G B;  2FD4 A;  1N87 A;  5KH7 A;  1JM7 B;  2F6J A;  2OWA A;  2XP0 A;  2IQJ A;  4C9Z A;  1WEQ A;  4CCG X;  4PTB A;  4QF2 A;  2FUI A;  3LDY A;  3C6W A;  4WA6 A;  3T6R A;  4YBT A;  4I7B A;  4B86 C;  2YUR A;  3GV4 A;  3L1Z B;  1FBV A;  4GNE A;  4UP5 A;  2C2V S;  4ZDT A;  1X4I A;  2YVR A;  4V3L C;  2YSJ A;  1G25 A;  2QJ0 A;  3PUR A;  4GND A;  2MA6 A;  1T1H A;  3L1X A;  5B8D A;  3N9P A;  4Z0O A;  3M63 A;  3SOX A;  2I50 A;  2M6M A;  2G6Q A;  4R8P K;  1WIL A;  5SVI B;  2DX8 A;  1X4J A;  4L7X A;  5B78 A;  2H0D A;  3GL6 A;  3N9M A;  2RSD A;  1DCQ A;  4GNG A;  2CSZ A;  4L58 A;  5TDW A;  4F1P A;  1E4U A;  3RTR B;  3EB6 A;  2YYR A;  4I7D A;  5SVI A;  1LDK C;  2MIQ A;  5C13 A;  3DQV R;  2M1R A;  3PLW A;  3MDB C;  3ZPV 1;  5H1V A;  2VPD A;  3SUB A;  3FM8 C;  3ZPV E;  4BHW A;  3N9O A;  3ZVZ B;  1Z2Q A;  2JRJ A;  2E61 A;  2KR4 A;  2YQM A;  3ZYQ A;  2Y43 A;  4O64 A;  2LAU A;  4S3O C;  1FP0 A;  3N9Q A;  5TDR A;  5JG6 A;  2L0B A;  2MD8 C;  2JMD A;  4TKP B;  2CSV A;  5H1T A;  2L80 A;  5D1L B;  5B75 A;  2KWK A;  2NAA A;  2KWO A;  3DPL R;  4AP4 A;  3C5K A;  3LVR E;  2FUU A;  3N9N A;  2YHO A;  2DJA A;  2LXH C;  2M85 A;  4LLB A;  5FB0 A;  3LRQ A;  4FO9 A;  1WEM A;  3FEH A;  2G43 A;  2KKX A;  4FIP A;  2L43 A;  2MD7 B;  5B76 A;  2LXP C;  3ASL A;  4YAB A;  2YW8 A;  5LKT A;  4H9D A;  5LCW B;  4YC9 A;  2YT5 A;  4BBQ A;  2CT2 A;  3M99 A;  2UZG A;  2CRW A;  3IHP A;  2ECV A;  3O36 A;  3JUE A;  2VPB A;  2MNZ A;  5G0F A;  2IDA A;  1WEV A;  2MNY A;  2LQ6 A;  2PNX A;  3NG2 A;  2K4D A;  4YAT A;  2H0D B;  2KE1 A;  2MT5 A;  2CKL B;  4UP0 A;  5FB1 A;  2XOY A;  2VJF A;  1X4U A;  2YRE A;  2BAY A; 
#chains in the Genus database with same CATH homology
 4A4B A;  2QIC A;  3ZVY A;  2KGI A;  3O7A A;  4A0C D;  4MSX A;  3EB5 A;  2C2L A;  2CKL A;  4IC3 A;  2ZET C;  2LRI C;  2L75 A;  3SOU A;  2HDP A;  5LKZ A;  3FL2 A;  2EA6 A;  2Y1M A;  5TBN A;  5G05 B;  4N4F A;  5TAB A;  1WIM A;  5H1U A;  4CA1 A;  2CSY A;  5J3X A;  2YUC A;  4AVX A;  4AYC A;  2YQL A;  3RPG B;  1WEW A;  4QF3 A;  3MHH A;  3KV5 A;  4UI9 B;  1ZBD B;  1RMD A;  2G45 A;  2F6N A;  2VPE A;  2K1J A;  4P5O B;  2KIZ A;  4FJC A;  2AN6 A;  2LN0 A;  2LDR A;  2MA5 A;  4WZ2 A;  1WE9 A;  4AUQ B;  4GB0 A;  5H9M A;  2KRE A;  4WZ0 A;  4YBM A;  1VYX A;  2MUM A;  4NN2 A;  3L11 A;  4B7Y C;  4LKA A;  1DVP A;  2XB1 A;  2E6S A;  4ZUX U;  5EYA F;  3O33 A;  1Z6U A;  2EGP A;  3O70 A;  5FER A;  2ECW A;  2ECJ A;  5KH3 A;  1Z60 A;  1V87 A;  2Y1N A;  3U5N A;  1LDJ B;  4YAD A;  4A49 A;  1WEE A;  2LGL A;  5AIU A;  1JOC A;  2XEU A;  3O34 A;  3ZNI A;  2KYU A;  1BOR A;  3O37 A;  4MVT A;  2L5U A;  4LK9 A;  2K16 A;  2VJF B;  3SHB A;  2YU4 A;  4A4C A;  3HCT A;  4YAX A;  2K17 A;  2YSM A;  2VJE B;  3ZTG A;  5B77 A;  2KWN A;  5G04 B;  3LQJ A;  2LGV A;  4IC2 A;  4PPE A;  2KFT A;  2F42 A;  1JM7 A;  5KH9 A;  2ECG A;  4Q6F A;  3T7L A;  2M3H A;  4AYC B;  2VJE A;  2OXQ C;  3MHS A;  2PUY A;  4W4U A;  4S3O B;  5D1K B;  3U5O A;  1WEO A;  2VNF A;  1WEU A;  3N9L A;  4FK5 A;  2LGK A;  3KQI A;  4I7C A;  3QZV A;  3U5M A;  2VPG A;  3VK6 A;  4R7E A;  2HYE D;  4N3W A;  3PUQ A;  2KWJ A;  4R2Y A;  5LKU A;  2VP7 A;  4LJN A;  1F62 A;  2EOD A;  1IYM A;  2LV9 A;  1MM3 A;  2ECN A;  1WEN A;  1WGM A;  2FSA A;  3HCS A;  3I2D A;  2LGG A;  5FEY A;  4LAD B;  1K2F A;  5I3L A;  3LQH A;  3V43 A;  4X3G A;  1HYJ A;  5D1M B;  2KU3 A;  2ECI A;  3LQI A;  2RI7 A;  2KGG A;  4WZ3 B;  3U5P A;  3O35 A;  1XWH A;  3HTK C;  2JMI A;  5C11 A;  4V3K C;  1WFK A;  2YHN A;  5DIN A;  1HYI A;  1VFY A;  2QIZ A;  1WEP A;  2JMJ A;  5DKA A;  5B79 A;  1WES A;  2E6R A;  4XI1 A;  4F52 B;  5TRB A;  1CHC A;  4YBS A;  1VD4 A;  3PHD A;  3KV6 A;  3M62 A;  2D8S A;  5AIT A;  3RPG C;  1MM2 A;  5LKX A;  4ZQL A;  4GNF A;  3SOW A;  3HCU A;  2ECT A;  3KNV A;  1U6G B;  1N87 A;  5KH7 A;  1JM7 B;  2F6J A;  4C9Z A;  1WEQ A;  4CCG X;  4PTB A;  4QF2 A;  2FUI A;  3C6W A;  4WA6 A;  3T6R A;  4YBT A;  4I7B A;  4B86 C;  2YUR A;  3GV4 A;  3L1Z B;  1FBV A;  4GNE A;  4UP5 A;  2C2V S;  4ZDT A;  1X4I A;  4V3L C;  2YSJ A;  1G25 A;  2QJ0 A;  3PUR A;  4GND A;  2MA6 A;  1T1H A;  3L1X A;  5B8D A;  3N9P A;  3M63 A;  3SOX A;  2I50 A;  2M6M A;  2G6Q A;  4R8P K;  1WIL A;  2DX8 A;  1X4J A;  4L7X A;  5B78 A;  2H0D A;  3GL6 A;  3N9M A;  2RSD A;  4GNG A;  2CSZ A;  4L58 A;  5TDW A;  1E4U A;  3RTR B;  3EB6 A;  2YYR A;  4I7D A;  1LDK C;  2MIQ A;  5C13 A;  3DQV R;  2M1R A;  3ZPV 1;  5H1V A;  2VPD A;  3ZPV E;  4BHW A;  3N9O A;  3ZVZ B;  1Z2Q A;  2JRJ A;  2KR4 A;  2YQM A;  3ZYQ A;  2Y43 A;  4O64 A;  4S3O C;  1FP0 A;  3N9Q A;  5TDR A;  5JG6 A;  2L0B A;  2MD8 C;  2JMD A;  4TKP B;  5H1T A;  2L80 A;  5D1L B;  5B75 A;  2KWK A;  2NAA A;  2KWO A;  3DPL R;  4AP4 A;  3C5K A;  2FUU A;  3N9N A;  2YHO A;  2LXH C;  2M85 A;  4LLB A;  5FB0 A;  3LRQ A;  4FO9 A;  1WEM A;  2G43 A;  4FIP A;  2L43 A;  2MD7 B;  5B76 A;  2LXP C;  3ASL A;  4YAB A;  2YW8 A;  5LKT A;  5LCW B;  4YC9 A;  2YT5 A;  4BBQ A;  2CT2 A;  3M99 A;  2UZG A;  3IHP A;  2ECV A;  3O36 A;  2VPB A;  2MNZ A;  5G0F A;  2IDA A;  1WEV A;  2MNY A;  2LQ6 A;  2PNX A;  3NG2 A;  2K4D A;  4YAT A;  2H0D B;  2KE1 A;  2MT5 A;  2CKL B;  4UP0 A;  5FB1 A;  2VJF A;  1X4U A;  2YRE A;  2BAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...