4GB0A

Crystal structure of the ring domain of rnf168
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
LPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF168
publication title Structural basis for role of ring finger protein RNF168 RING domain
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 91
sequence length 91
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gb0A00
4WZ0A 2EA6A 4GNEA 4A0CD 4GNGA 2H0DA 3M62A 5B76A 3T6RA 5B79A 2VPDA 2KFTA 3KV5A 2HYED 2KREA 3LRQA 1N87A 1JOCA 1JM7B 2F42A 5G04B 1MM2A 2JMJA 2L5UA 2KYUA 4GB0A 3NG2A 3EB5A 4I7CA 2MA6A 3LQJA 1WIMA 4ZDTA 4F52B 2QJ0A 4CA1A 3M63A 2KIZA 3RPGB 2OXQC 4N3WA 4UI9B 4AVXA 3LQHA 2L80A 5D1MB 4YC9A 4S3OB 3C6WA 2K1JA 5G0FA 4V3KC 4FIPA 4MSXA 2QICA 2VJEB 4CCGX 4YADA 2KWJA 2YREA 1Z60A 2LXPC 2EGPA 5FB1A 2CKLA 2VJFB 2EODA 2LXHC 1XWHA 3ZPVE 1K2FA 3ZYQA 5JG6A 5KH9A 5EYAF 4TKPB 4B7YC 2L43A 4YBSA 2CT2A 5AITA 5TDRA 2LGVA 1WEEA 2ECIA 2G6QA 1WEPA 5FEYA 4UP0A 3KV6A 4YABA 3N9LA 1WEWA 1LDKC 2ECVA 1G25A 1ZBDB 5D1KB 4V3LC 3GV4A 1WEVA 4AP4A 1Z2QA 2ECTA 4N4FA 2L75A 4YBTA 3N9PA 5G05B 4FK5A 3KQIA 1LDJB 4S3OC 3SOXA 2MNYA 4WZ2A 5DKAA 2KWOA 2KWKA 5LKUA 3LQIA 4PTBA 1RMDA 2YQLA 5DINA 1WE9A 2MNZA 2LGKA 2H0DB 2F6JA 1WFKA 3U5NA 4I7BA 3C5KA 2K4DA 3L11A 2C2VS 4XI1A 2M6MA 2DX8A 2I50A 2YUCA 4LK9A 2LGGA 4YBMA 5H1UA 5B75A 5I3LA 3PUQA 3O70A 1FP0A 2JRJA 3SHBA 1Z6UA 4YAXA 4QF3A 4W4UA 3SOUA 2VJEA 2ECGA 2KGIA 5FB0A 5LKXA 1E4UA 3MHSA 2KU3A 3L1XA 4A4CA 3ASLA 4O64A 5KH3A 2Y43A 2YW8A 2VJFA 3HTKC 1F62A 5B8DA 2G45A 1CHCA 3V43A 1HYIA 4FJCA 2Y1NA 1WGMA 2YQMA 3ZTGA 2ECWA 4LADB 3HCTA 2M85A 2E6RA 1X4IA 2MT5A 2MD8C 3L1ZB 2YT5A 4R8PK 4ZUXU 5H1VA 2MD7B 2YU4A 4L58A 3SOWA 2LGLA 2JMIA 2MUMA 3U5OA 4Q6FA 5J3XA 5D1LB 5H9MA 4YATA 3I2DA 1WEOA 5LKTA 1HYJA 3HCSA 3PURA 4ZQLA 4GNFA 2RSDA 2L0BA 3ZVYA 4A4BA 2KGGA 2YURA 3U5PA 1X4UA 1U6GB 2FUIA 1X4JA 2Y1MA 4MVTA 2MIQA 4NN2A 2YSJA 2ECNA 3MHHA 2LDRA 3RTRB 4AYCB 1JM7A 1WEUA 3DPLR 2FSAA 4PPEA 2PUYA 4B86C 2K16A 2XEUA 2F6NA 4BBQA 4X3GA 2YHNA 2M1RA 1DVPA 3O7AA 3IHPA 5AIUA 2AN6A 2LQ6A 1V87A 2ECJA 3O36A 2KR4A 5C11A 4LLBA 1VD4A 2M3HA 2ZETC 1FBVA 3U5MA 2VNFA 5FERA 3ZNIA 2YHOA 1VFYA 3HCUA 3N9QA 4WA6A 2C2LA 2KE1A 2QIZA 4IC3A 3GL6A 4I7DA 4BHWA 2VPEA 4LJNA 2PNXA 5H1TA 3QZVA 3T7LA 2HDPA 2NAAA 4A49A 2VPGA 3N9NA 5C13A 4UP5A 2LRIC 2IDAA 3O37A 2BAYA 2UZGA 3O35A 4R2YA 2G43A 3DQVR 2VP7A 3ZPV1 3FL2A 5TABA 5LCWB 1MM3A 3ZVZB 1IYMA 4L7XA 4IC2A 3N9MA 2E6SA 2FUUA 4C9ZA 1WEMA 1VYXA 2CKLB 2D8SA 2RI7A 1T1HA 2XB1A 1BORA 5KH7A 3M99A 5LKZA 3O34A 4R7EA 2LN0A 4GNDA 4WZ3B 3KNVA 4QF2A 2K17A 3EB6A 2VPBA 3PHDA 3VK6A 5B78A 2CSYA 2JMDA 4AYCA 5TBNA 5B77A 2LV9A 5TDWA 4LKAA 1WEQA 2MA5A 4P5OB 2YYRA 3RPGC 1WENA 1WESA 3N9OA 1WILA 2YSMA 2KWNA 3O33A 4AUQB 2CSZA 4FO9A 5TRBA
chains in the Genus database with same CATH superfamily
4H9DA 4WZ0A 2EA6A 4GNEA 4A0CD 4GNGA 2CRWA 2H0DA 3M62A 5B76A 3T6RA 5B79A 2VPDA 2KFTA 3KV5A 2HYED 3H7HA 2KREA 3DDTA 3LRQA 1N87A 1JOCA 1JM7B 2F42A 2M13A 5G04B 4F1PA 1MM2A 2JMJA 2L5UA 2CSVA 2KYUA 4GB0A 3NG2A 3EB5A 4I7CA 2MA6A 3LQJA 1WIMA 4ZDTA 4F52B 2QJ0A 4CA1A 3M63A 2KIZA 3RPGB 2OXQC 4N3WA 4UI9B 4AVXA 3LQHA 3DWDA 2L80A 2DJAA 5D1MB 4YC9A 4S3OB 3C6WA 2K1JA 5G0FA 4V3KC 4FIPA 4MSXA 2QICA 2VJEB 4CCGX 4YADA 2KWJA 2YREA 1Z60A 2KKXA 2LXPC 2FD4A 2B0OE 2EGPA 5FB1A 2CKLA 2VJFB 2EODA 2LXHC 1XWHA 3ZPVE 1K2FA 3ZYQA 5JG6A 2P57A 5KH9A 5EYAF 4TKPB 4B7YC 2L43A 4YBSA 2CT2A 5AITA 2CONA 5TDRA 2LGVA 1WEEA 2ECIA 2G6QA 2LAUA 2XOZA 1WEPA 5FEYA 4UP0A 3KV6A 4YABA 3N9LA 1WEWA 1LDKC 2ECVA 1G25A 1ZBDB 5D1KB 4OGCA 4V3LC 3GV4A 1WEVA 4AP4A 1Z2QA 2ECTA 2EGMA 4N4FA 2L75A 4YBTA 3N9PA 5G05B 4FK5A 4OGEA 3KQIA 1LDJB 3KDEC 4S3OC 3SOXA 2MNYA 4WZ2A 5DKAA 2YVRA 2KWOA 2KWKA 5LKUA 3LQIA 1DCQA 4PTBA 1RMDA 2YQLA 5DINA 1WE9A 2DSMA 5SVIA 2MNZA 2LGKA 2H0DB 2F6JA 1WFKA 3U5NA 4I7BA 3C5KA 2K4DA 4Z0OA 3L11A 2C2VS 4XI1A 2M6MA 3T9KA 2DX8A 2I50A 2YUCA 4LK9A 2LGGA 4YBMA 5H1UA 5SVXA 5B75A 5I3LA 3PUQA 3O70A 1FP0A 2JRJA 3SHBA 1Z6UA 4YAXA 4QF3A 4W4UA 3SOUA 3M7KA 2XP0A 2VJEA 2ECGA 2KGIA 3E2DA 5FB0A 5LKXA 1E4UA 3MHSA 2KU3A 3L1XA 4A4CA 3ASLA 4O64A 5KH3A 3LVQE 2Y43A 2YW8A 2VJFA 3HTKC 1F62A 5B8DA 2G45A 1CHCA 3V43A 1HYIA 4FJCA 2Y1NA 1WGMA 2YQMA 3ZTGA 2ECWA 4LADB 3HCTA 2M85A 2E6RA 5K3QA 1X4IA 2MT5A 2MD8C 2JM3A 3Q1DA 2RR4A 3L1ZB 2YT5A 4O62A 4R8PK 4ZUXU 5H1VA 2MD7B 2YU4A 4L58A 3SOWA 3JUEA 2LGLA 2JMIA 2MUMA 3U5OA 2FFWA 4Q6FA 5J3XA 5D1LB 5H9MA 4YATA 2KKYA 2MKEA 3I2DA 1WEOA 5LKTA 1HYJA 3HCSA 3PURA 4ZQLA 4GNFA 2RSDA 2L0BA 3ZVYA 4A4BA 2KGGA 2E61A 2YURA 3U5PA 1X4UA 1U6GB 2FUIA 1X4JA 2Y1MA 4MVTA 4NN2A 2MIQA 2YSJA 2ECNA 3MHHA 2LDRA 2EXUA 3RTRB 4AYCB 1JM7A 1WEUA 3DPLR 2FSAA 4PPEA 2PUYA 4B86C 2K16A 2XEUA 2F6NA 4BBQA 4X3GA 2M1RA 1DVPA 5SVYA 3O7AA 3IHPA 5AIUA 2AN6A 2LQ6A 1V87A 2ECJA 3O36A 2KR4A 5C11A 4LLBA 1VD4A 2M3HA 2ZETC 1FBVA 3U5MA 3SUBA 2VNFA 5FERA 4QQ4A 3ZNIA 2YHOA 1VFYA 3HCUA 3N9QA 4WA6A 2C2LA 2KE1A 5SVIB 2QIZA 4IC3A 3GL6A 4I7DA 4BHWA 2VPEA 4LJNA 2PNXA 5H1TA 3QZVA 3FJUB 3T7LA 4Z0RA 2HDPA 2NAAA 4A49A 3LDYA 2IQJA 2VPGA 3N9NA 5C13A 4UP5A 2LRIC 2IDAA 3O37A 2BAYA 2UZGA 3O35A 2L7PA 4R2YA 2G43A 3DQVR 3LJUX 2VP7A 3ZPV1 3FL2A 5TABA 3LVRE 5LCWB 1MM3A 3ZVZB 1IYMA 4L7XA 2OWAA 4IC2A 3N9MA 2E6SA 2JUNA 2FUUA 3FM8C 4C9ZA 1WEMA 1VYXA 3O47A 2D8UA 2CKLB 2D8SA 2RI7A 1T1HA 2XB1A 1BORA 5KH7A 2XOYA 3M99A 5LKZA 3FANA 3O34A 4R7EA 2LN0A 3MDBC 4GNDA 4WZ3B 3KNVA 4QF2A 2K17A 3EB6A 2VPBA 2XOCA 3PHDA 3VK6A 5B78A 2CSYA 1MBMA 2JMDA 3FEHA 4AYCA 5TBNA 5B77A 2LV9A 5TDWA 2CRRA 4LKAA 5TRBA 1WEQA 3FAOA 2MA5A 4P5OB 2YYRA 3RPGC 1WENA 3PLWA 1WESA 3N9OA 1WILA 2YSMA 2KWNA 3O33A 4AUQB 2CSZA 4FO9A 2YHNA
chains in the Genus database with same CATH topology
4WZ0A 2EA6A 4GNEA 4A0CD 4GNGA 2H0DA 3M62A 5B76A 3T6RA 5B79A 2VPDA 2KFTA 3KV5A 2HYED 2KREA 3LRQA 1N87A 1JOCA 1JM7B 2F42A 5G04B 1MM2A 2JMJA 2L5UA 2KYUA 4GB0A 3NG2A 3EB5A 4I7CA 2MA6A 3LQJA 1WIMA 4ZDTA 4F52B 2QJ0A 4CA1A 3M63A 2KIZA 3RPGB 2OXQC 4N3WA 4UI9B 4AVXA 3LQHA 2L80A 5D1MB 4YC9A 4S3OB 3C6WA 2K1JA 5G0FA 4V3KC 4FIPA 4MSXA 2QICA 2VJEB 4CCGX 4YADA 2KWJA 2YREA 1Z60A 2LXPC 2EGPA 5FB1A 2CKLA 2VJFB 2EODA 2LXHC 1XWHA 3ZPVE 1K2FA 3ZYQA 5JG6A 5KH9A 5EYAF 4TKPB 4B7YC 2L43A 4YBSA 2CT2A 5AITA 5TDRA 2LGVA 1WEEA 2ECIA 2G6QA 1WEPA 5FEYA 4UP0A 3KV6A 4YABA 3N9LA 1WEWA 1LDKC 2ECVA 1G25A 1ZBDB 5D1KB 4V3LC 3GV4A 1WEVA 4AP4A 1Z2QA 2ECTA 4N4FA 2L75A 4YBTA 3N9PA 5G05B 4FK5A 3KQIA 1LDJB 4S3OC 3SOXA 2MNYA 4WZ2A 5DKAA 2KWOA 2KWKA 5LKUA 3LQIA 4PTBA 1RMDA 2YQLA 5DINA 1WE9A 2MNZA 2LGKA 2H0DB 2F6JA 1WFKA 3U5NA 4I7BA 3C5KA 2K4DA 3L11A 2C2VS 4XI1A 2M6MA 2DX8A 2I50A 2YUCA 4LK9A 2LGGA 4YBMA 5H1UA 5B75A 5I3LA 3PUQA 3O70A 1FP0A 2JRJA 3SHBA 1Z6UA 4YAXA 4QF3A 4W4UA 3SOUA 2VJEA 2ECGA 2KGIA 5FB0A 5LKXA 1E4UA 3MHSA 2KU3A 3L1XA 4A4CA 3ASLA 4O64A 5KH3A 2Y43A 2YW8A 2VJFA 3HTKC 1F62A 5B8DA 2G45A 1CHCA 3V43A 1HYIA 4FJCA 2Y1NA 1WGMA 2YQMA 3ZTGA 2ECWA 4LADB 3HCTA 2M85A 2E6RA 1X4IA 2MT5A 2MD8C 3L1ZB 2YT5A 4R8PK 4ZUXU 5H1VA 2MD7B 2YU4A 4L58A 3SOWA 2LGLA 2JMIA 2MUMA 3U5OA 4Q6FA 5J3XA 5D1LB 5H9MA 4YATA 3I2DA 1WEOA 5LKTA 1HYJA 3HCSA 3PURA 4ZQLA 4GNFA 2RSDA 2L0BA 3ZVYA 4A4BA 2KGGA 2YURA 3U5PA 1X4UA 1U6GB 2FUIA 1X4JA 2Y1MA 4MVTA 2MIQA 4NN2A 2YSJA 2ECNA 3MHHA 2LDRA 3RTRB 4AYCB 1JM7A 1WEUA 3DPLR 2FSAA 4PPEA 2PUYA 4B86C 2K16A 2XEUA 2F6NA 4BBQA 4X3GA 2YHNA 2M1RA 1DVPA 3O7AA 3IHPA 5AIUA 2AN6A 2LQ6A 1V87A 2ECJA 3O36A 2KR4A 5C11A 4LLBA 1VD4A 2M3HA 2ZETC 1FBVA 3U5MA 2VNFA 5FERA 3ZNIA 2YHOA 1VFYA 3HCUA 3N9QA 4WA6A 2C2LA 2KE1A 2QIZA 4IC3A 3GL6A 4I7DA 4BHWA 2VPEA 4LJNA 2PNXA 5H1TA 3QZVA 3T7LA 2HDPA 2NAAA 4A49A 2VPGA 3N9NA 5C13A 4UP5A 2LRIC 2IDAA 3O37A 2BAYA 2UZGA 3O35A 4R2YA 2G43A 3DQVR 2VP7A 3ZPV1 3FL2A 5TABA 5LCWB 1MM3A 3ZVZB 1IYMA 4L7XA 4IC2A 3N9MA 2E6SA 2FUUA 4C9ZA 1WEMA 1VYXA 2CKLB 2D8SA 2RI7A 1T1HA 2XB1A 1BORA 5KH7A 3M99A 5LKZA 3O34A 4R7EA 2LN0A 4GNDA 4WZ3B 3KNVA 4QF2A 2K17A 3EB6A 2VPBA 3PHDA 3VK6A 5B78A 2CSYA 2JMDA 4AYCA 5TBNA 5B77A 2LV9A 5TDWA 4LKAA 1WEQA 2MA5A 4P5OB 2YYRA 3RPGC 1WENA 1WESA 3N9OA 1WILA 2YSMA 2KWNA 3O33A 4AUQB 2CSZA 4FO9A 5TRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ0 A;  2EA6 A;  4GNE A;  4A0C D;  4GNG A;  2H0D A;  3M62 A;  5B76 A;  3T6R A;  5B79 A;  2VPD A;  2KFT A;  3KV5 A;  2HYE D;  2KRE A;  3LRQ A;  1N87 A;  1JOC A;  1JM7 B;  2F42 A;  5G04 B;  1MM2 A;  2JMJ A;  2L5U A;  2KYU A;  4GB0 A;  3NG2 A;  3EB5 A;  4I7C A;  2MA6 A;  3LQJ A;  1WIM A;  4ZDT A;  4F52 B;  2QJ0 A;  4CA1 A;  3M63 A;  2KIZ A;  3RPG B;  2OXQ C;  4N3W A;  4UI9 B;  4AVX A;  3LQH A;  2L80 A;  5D1M B;  4YC9 A;  4S3O B;  3C6W A;  2K1J A;  5G0F A;  4V3K C;  4FIP A;  4MSX A;  2QIC A;  2VJE B;  4CCG X;  4YAD A;  2KWJ A;  2YRE A;  1Z60 A;  2LXP C;  2EGP A;  5FB1 A;  2CKL A;  2VJF B;  2EOD A;  2LXH C;  1XWH A;  3ZPV E;  1K2F A;  3ZYQ A;  5JG6 A;  5KH9 A;  5EYA F;  4TKP B;  4B7Y C;  2L43 A;  4YBS A;  2CT2 A;  5AIT A;  5TDR A;  2LGV A;  1WEE A;  2ECI A;  2G6Q A;  1WEP A;  5FEY A;  4UP0 A;  3KV6 A;  4YAB A;  3N9L A;  1WEW A;  1LDK C;  2ECV A;  1G25 A;  1ZBD B;  5D1K B;  4V3L C;  3GV4 A;  1WEV A;  4AP4 A;  1Z2Q A;  2ECT A;  4N4F A;  2L75 A;  4YBT A;  3N9P A;  5G05 B;  4FK5 A;  3KQI A;  1LDJ B;  4S3O C;  3SOX A;  2MNY A;  4WZ2 A;  5DKA A;  2KWO A;  2KWK A;  5LKU A;  3LQI A;  4PTB A;  1RMD A;  2YQL A;  5DIN A;  1WE9 A;  2MNZ A;  2LGK A;  2H0D B;  2F6J A;  1WFK A;  3U5N A;  4I7B A;  3C5K A;  2K4D A;  3L11 A;  2C2V S;  4XI1 A;  2M6M A;  2DX8 A;  2I50 A;  2YUC A;  4LK9 A;  2LGG A;  4YBM A;  5H1U A;  5B75 A;  5I3L A;  3PUQ A;  3O70 A;  1FP0 A;  2JRJ A;  3SHB A;  1Z6U A;  4YAX A;  4QF3 A;  4W4U A;  3SOU A;  2VJE A;  2ECG A;  2KGI A;  5FB0 A;  5LKX A;  1E4U A;  3MHS A;  2KU3 A;  3L1X A;  4A4C A;  3ASL A;  4O64 A;  5KH3 A;  2Y43 A;  2YW8 A;  2VJF A;  3HTK C;  1F62 A;  5B8D A;  2G45 A;  1CHC A;  3V43 A;  1HYI A;  4FJC A;  2Y1N A;  1WGM A;  2YQM A;  3ZTG A;  2ECW A;  4LAD B;  3HCT A;  2M85 A;  2E6R A;  1X4I A;  2MT5 A;  2MD8 C;  3L1Z B;  2YT5 A;  4R8P K;  4ZUX U;  5H1V A;  2MD7 B;  2YU4 A;  4L58 A;  3SOW A;  2LGL A;  2JMI A;  2MUM A;  3U5O A;  4Q6F A;  5J3X A;  5D1L B;  5H9M A;  4YAT A;  3I2D A;  1WEO A;  5LKT A;  1HYJ A;  3HCS A;  3PUR A;  4ZQL A;  4GNF A;  2RSD A;  2L0B A;  3ZVY A;  4A4B A;  2KGG A;  2YUR A;  3U5P A;  1X4U A;  1U6G B;  2FUI A;  1X4J A;  2Y1M A;  4MVT A;  2MIQ A;  4NN2 A;  2YSJ A;  2ECN A;  3MHH A;  2LDR A;  3RTR B;  4AYC B;  1JM7 A;  1WEU A;  3DPL R;  2FSA A;  4PPE A;  2PUY A;  4B86 C;  2K16 A;  2XEU A;  2F6N A;  4BBQ A;  4X3G A;  2YHN A;  2M1R A;  1DVP A;  3O7A A;  3IHP A;  5AIU A;  2AN6 A;  2LQ6 A;  1V87 A;  2ECJ A;  3O36 A;  2KR4 A;  5C11 A;  4LLB A;  1VD4 A;  2M3H A;  2ZET C;  1FBV A;  3U5M A;  2VNF A;  5FER A;  3ZNI A;  2YHO A;  1VFY A;  3HCU A;  3N9Q A;  4WA6 A;  2C2L A;  2KE1 A;  2QIZ A;  4IC3 A;  3GL6 A;  4I7D A;  4BHW A;  2VPE A;  4LJN A;  2PNX A;  5H1T A;  3QZV A;  3T7L A;  2HDP A;  2NAA A;  4A49 A;  2VPG A;  3N9N A;  5C13 A;  4UP5 A;  2LRI C;  2IDA A;  3O37 A;  2BAY A;  2UZG A;  3O35 A;  4R2Y A;  2G43 A;  3DQV R;  2VP7 A;  3ZPV 1;  3FL2 A;  5TAB A;  5LCW B;  1MM3 A;  3ZVZ B;  1IYM A;  4L7X A;  4IC2 A;  3N9M A;  2E6S A;  2FUU A;  4C9Z A;  1WEM A;  1VYX A;  2CKL B;  2D8S A;  2RI7 A;  1T1H A;  2XB1 A;  1BOR A;  5KH7 A;  3M99 A;  5LKZ A;  3O34 A;  4R7E A;  2LN0 A;  4GND A;  4WZ3 B;  3KNV A;  4QF2 A;  2K17 A;  3EB6 A;  2VPB A;  3PHD A;  3VK6 A;  5B78 A;  2CSY A;  2JMD A;  4AYC A;  5TBN A;  5B77 A;  2LV9 A;  5TDW A;  4LKA A;  1WEQ A;  2MA5 A;  4P5O B;  2YYR A;  3RPG C;  1WEN A;  1WES A;  3N9O A;  1WIL A;  2YSM A;  2KWN A;  3O33 A;  4AUQ B;  2CSZ A;  4FO9 A;  5TRB A; 
#chains in the Genus database with same CATH topology
 4H9D A;  4WZ0 A;  2EA6 A;  4GNE A;  4A0C D;  4GNG A;  2CRW A;  2H0D A;  3M62 A;  5B76 A;  3T6R A;  5B79 A;  2VPD A;  2KFT A;  3KV5 A;  2HYE D;  3H7H A;  2KRE A;  3DDT A;  3LRQ A;  1N87 A;  1JOC A;  1JM7 B;  2F42 A;  2M13 A;  5G04 B;  4F1P A;  1MM2 A;  2JMJ A;  2L5U A;  2CSV A;  2KYU A;  4GB0 A;  3NG2 A;  3EB5 A;  4I7C A;  2MA6 A;  3LQJ A;  1WIM A;  4ZDT A;  4F52 B;  2QJ0 A;  4CA1 A;  3M63 A;  2KIZ A;  3RPG B;  2OXQ C;  4N3W A;  4UI9 B;  4AVX A;  3LQH A;  3DWD A;  2L80 A;  2DJA A;  5D1M B;  4YC9 A;  4S3O B;  3C6W A;  2K1J A;  5G0F A;  4V3K C;  4FIP A;  4MSX A;  2QIC A;  2VJE B;  4CCG X;  4YAD A;  2KWJ A;  2YRE A;  1Z60 A;  2KKX A;  2LXP C;  2FD4 A;  2B0O E;  2EGP A;  5FB1 A;  2CKL A;  2VJF B;  2EOD A;  2LXH C;  1XWH A;  3ZPV E;  1K2F A;  3ZYQ A;  5JG6 A;  2P57 A;  5KH9 A;  5EYA F;  4TKP B;  4B7Y C;  2L43 A;  4YBS A;  2CT2 A;  5AIT A;  2CON A;  5TDR A;  2LGV A;  1WEE A;  2ECI A;  2G6Q A;  2LAU A;  2XOZ A;  1WEP A;  5FEY A;  4UP0 A;  3KV6 A;  4YAB A;  3N9L A;  1WEW A;  1LDK C;  2ECV A;  1G25 A;  1ZBD B;  5D1K B;  4OGC A;  4V3L C;  3GV4 A;  1WEV A;  4AP4 A;  1Z2Q A;  2ECT A;  2EGM A;  4N4F A;  2L75 A;  4YBT A;  3N9P A;  5G05 B;  4FK5 A;  4OGE A;  3KQI A;  1LDJ B;  3KDE C;  4S3O C;  3SOX A;  2MNY A;  4WZ2 A;  5DKA A;  2YVR A;  2KWO A;  2KWK A;  5LKU A;  3LQI A;  1DCQ A;  4PTB A;  1RMD A;  2YQL A;  5DIN A;  1WE9 A;  2DSM A;  5SVI A;  2MNZ A;  2LGK A;  2H0D B;  2F6J A;  1WFK A;  3U5N A;  4I7B A;  3C5K A;  2K4D A;  4Z0O A;  3L11 A;  2C2V S;  4XI1 A;  2M6M A;  3T9K A;  2DX8 A;  2I50 A;  2YUC A;  4LK9 A;  2LGG A;  4YBM A;  5H1U A;  5SVX A;  5B75 A;  5I3L A;  3PUQ A;  3O70 A;  1FP0 A;  2JRJ A;  3SHB A;  1Z6U A;  4YAX A;  4QF3 A;  4W4U A;  3SOU A;  3M7K A;  2XP0 A;  2VJE A;  2ECG A;  2KGI A;  3E2D A;  5FB0 A;  5LKX A;  1E4U A;  3MHS A;  2KU3 A;  3L1X A;  4A4C A;  3ASL A;  4O64 A;  5KH3 A;  3LVQ E;  2Y43 A;  2YW8 A;  2VJF A;  3HTK C;  1F62 A;  5B8D A;  2G45 A;  1CHC A;  3V43 A;  1HYI A;  4FJC A;  2Y1N A;  1WGM A;  2YQM A;  3ZTG A;  2ECW A;  4LAD B;  3HCT A;  2M85 A;  2E6R A;  5K3Q A;  1X4I A;  2MT5 A;  2MD8 C;  2JM3 A;  3Q1D A;  2RR4 A;  3L1Z B;  2YT5 A;  4O62 A;  4R8P K;  4ZUX U;  5H1V A;  2MD7 B;  2YU4 A;  4L58 A;  3SOW A;  3JUE A;  2LGL A;  2JMI A;  2MUM A;  3U5O A;  2FFW A;  4Q6F A;  5J3X A;  5D1L B;  5H9M A;  4YAT A;  2KKY A;  2MKE A;  3I2D A;  1WEO A;  5LKT A;  1HYJ A;  3HCS A;  3PUR A;  4ZQL A;  4GNF A;  2RSD A;  2L0B A;  3ZVY A;  4A4B A;  2KGG A;  2E61 A;  2YUR A;  3U5P A;  1X4U A;  1U6G B;  2FUI A;  1X4J A;  2Y1M A;  4MVT A;  4NN2 A;  2MIQ A;  2YSJ A;  2ECN A;  3MHH A;  2LDR A;  2EXU A;  3RTR B;  4AYC B;  1JM7 A;  1WEU A;  3DPL R;  2FSA A;  4PPE A;  2PUY A;  4B86 C;  2K16 A;  2XEU A;  2F6N A;  4BBQ A;  4X3G A;  2M1R A;  1DVP A;  5SVY A;  3O7A A;  3IHP A;  5AIU A;  2AN6 A;  2LQ6 A;  1V87 A;  2ECJ A;  3O36 A;  2KR4 A;  5C11 A;  4LLB A;  1VD4 A;  2M3H A;  2ZET C;  1FBV A;  3U5M A;  3SUB A;  2VNF A;  5FER A;  4QQ4 A;  3ZNI A;  2YHO A;  1VFY A;  3HCU A;  3N9Q A;  4WA6 A;  2C2L A;  2KE1 A;  5SVI B;  2QIZ A;  4IC3 A;  3GL6 A;  4I7D A;  4BHW A;  2VPE A;  4LJN A;  2PNX A;  5H1T A;  3QZV A;  3FJU B;  3T7L A;  4Z0R A;  2HDP A;  2NAA A;  4A49 A;  3LDY A;  2IQJ A;  2VPG A;  3N9N A;  5C13 A;  4UP5 A;  2LRI C;  2IDA A;  3O37 A;  2BAY A;  2UZG A;  3O35 A;  2L7P A;  4R2Y A;  2G43 A;  3DQV R;  3LJU X;  2VP7 A;  3ZPV 1;  3FL2 A;  5TAB A;  3LVR E;  5LCW B;  1MM3 A;  3ZVZ B;  1IYM A;  4L7X A;  2OWA A;  4IC2 A;  3N9M A;  2E6S A;  2JUN A;  2FUU A;  3FM8 C;  4C9Z A;  1WEM A;  1VYX A;  3O47 A;  2D8U A;  2CKL B;  2D8S A;  2RI7 A;  1T1H A;  2XB1 A;  1BOR A;  5KH7 A;  2XOY A;  3M99 A;  5LKZ A;  3FAN A;  3O34 A;  4R7E A;  2LN0 A;  3MDB C;  4GND A;  4WZ3 B;  3KNV A;  4QF2 A;  2K17 A;  3EB6 A;  2VPB A;  2XOC A;  3PHD A;  3VK6 A;  5B78 A;  2CSY A;  1MBM A;  2JMD A;  3FEH A;  4AYC A;  5TBN A;  5B77 A;  2LV9 A;  5TDW A;  2CRR A;  4LKA A;  5TRB A;  1WEQ A;  3FAO A;  2MA5 A;  4P5O B;  2YYR A;  3RPG C;  1WEN A;  3PLW A;  1WES A;  3N9O A;  1WIL A;  2YSM A;  2KWN A;  3O33 A;  4AUQ B;  2CSZ A;  4FO9 A;  2YHN A; 
#chains in the Genus database with same CATH homology
 4WZ0 A;  2EA6 A;  4GNE A;  4A0C D;  4GNG A;  2H0D A;  3M62 A;  5B76 A;  3T6R A;  5B79 A;  2VPD A;  2KFT A;  3KV5 A;  2HYE D;  2KRE A;  3LRQ A;  1N87 A;  1JOC A;  1JM7 B;  2F42 A;  5G04 B;  1MM2 A;  2JMJ A;  2L5U A;  2KYU A;  4GB0 A;  3NG2 A;  3EB5 A;  4I7C A;  2MA6 A;  3LQJ A;  1WIM A;  4ZDT A;  4F52 B;  2QJ0 A;  4CA1 A;  3M63 A;  2KIZ A;  3RPG B;  2OXQ C;  4N3W A;  4UI9 B;  4AVX A;  3LQH A;  2L80 A;  5D1M B;  4YC9 A;  4S3O B;  3C6W A;  2K1J A;  5G0F A;  4V3K C;  4FIP A;  4MSX A;  2QIC A;  2VJE B;  4CCG X;  4YAD A;  2KWJ A;  2YRE A;  1Z60 A;  2LXP C;  2EGP A;  5FB1 A;  2CKL A;  2VJF B;  2EOD A;  2LXH C;  1XWH A;  3ZPV E;  1K2F A;  3ZYQ A;  5JG6 A;  5KH9 A;  5EYA F;  4TKP B;  4B7Y C;  2L43 A;  4YBS A;  2CT2 A;  5AIT A;  5TDR A;  2LGV A;  1WEE A;  2ECI A;  2G6Q A;  1WEP A;  5FEY A;  4UP0 A;  3KV6 A;  4YAB A;  3N9L A;  1WEW A;  1LDK C;  2ECV A;  1G25 A;  1ZBD B;  5D1K B;  4V3L C;  3GV4 A;  1WEV A;  4AP4 A;  1Z2Q A;  2ECT A;  4N4F A;  2L75 A;  4YBT A;  3N9P A;  5G05 B;  4FK5 A;  3KQI A;  1LDJ B;  4S3O C;  3SOX A;  2MNY A;  4WZ2 A;  5DKA A;  2KWO A;  2KWK A;  5LKU A;  3LQI A;  4PTB A;  1RMD A;  2YQL A;  5DIN A;  1WE9 A;  2MNZ A;  2LGK A;  2H0D B;  2F6J A;  1WFK A;  3U5N A;  4I7B A;  3C5K A;  2K4D A;  3L11 A;  2C2V S;  4XI1 A;  2M6M A;  2DX8 A;  2I50 A;  2YUC A;  4LK9 A;  2LGG A;  4YBM A;  5H1U A;  5B75 A;  5I3L A;  3PUQ A;  3O70 A;  1FP0 A;  2JRJ A;  3SHB A;  1Z6U A;  4YAX A;  4QF3 A;  4W4U A;  3SOU A;  2VJE A;  2ECG A;  2KGI A;  5FB0 A;  5LKX A;  1E4U A;  3MHS A;  2KU3 A;  3L1X A;  4A4C A;  3ASL A;  4O64 A;  5KH3 A;  2Y43 A;  2YW8 A;  2VJF A;  3HTK C;  1F62 A;  5B8D A;  2G45 A;  1CHC A;  3V43 A;  1HYI A;  4FJC A;  2Y1N A;  1WGM A;  2YQM A;  3ZTG A;  2ECW A;  4LAD B;  3HCT A;  2M85 A;  2E6R A;  1X4I A;  2MT5 A;  2MD8 C;  3L1Z B;  2YT5 A;  4R8P K;  4ZUX U;  5H1V A;  2MD7 B;  2YU4 A;  4L58 A;  3SOW A;  2LGL A;  2JMI A;  2MUM A;  3U5O A;  4Q6F A;  5J3X A;  5D1L B;  5H9M A;  4YAT A;  3I2D A;  1WEO A;  5LKT A;  1HYJ A;  3HCS A;  3PUR A;  4ZQL A;  4GNF A;  2RSD A;  2L0B A;  3ZVY A;  4A4B A;  2KGG A;  2YUR A;  3U5P A;  1X4U A;  1U6G B;  2FUI A;  1X4J A;  2Y1M A;  4MVT A;  2MIQ A;  4NN2 A;  2YSJ A;  2ECN A;  3MHH A;  2LDR A;  3RTR B;  4AYC B;  1JM7 A;  1WEU A;  3DPL R;  2FSA A;  4PPE A;  2PUY A;  4B86 C;  2K16 A;  2XEU A;  2F6N A;  4BBQ A;  4X3G A;  2YHN A;  2M1R A;  1DVP A;  3O7A A;  3IHP A;  5AIU A;  2AN6 A;  2LQ6 A;  1V87 A;  2ECJ A;  3O36 A;  2KR4 A;  5C11 A;  4LLB A;  1VD4 A;  2M3H A;  2ZET C;  1FBV A;  3U5M A;  2VNF A;  5FER A;  3ZNI A;  2YHO A;  1VFY A;  3HCU A;  3N9Q A;  4WA6 A;  2C2L A;  2KE1 A;  2QIZ A;  4IC3 A;  3GL6 A;  4I7D A;  4BHW A;  2VPE A;  4LJN A;  2PNX A;  5H1T A;  3QZV A;  3T7L A;  2HDP A;  2NAA A;  4A49 A;  2VPG A;  3N9N A;  5C13 A;  4UP5 A;  2LRI C;  2IDA A;  3O37 A;  2BAY A;  2UZG A;  3O35 A;  4R2Y A;  2G43 A;  3DQV R;  2VP7 A;  3ZPV 1;  3FL2 A;  5TAB A;  5LCW B;  1MM3 A;  3ZVZ B;  1IYM A;  4L7X A;  4IC2 A;  3N9M A;  2E6S A;  2FUU A;  4C9Z A;  1WEM A;  1VYX A;  2CKL B;  2D8S A;  2RI7 A;  1T1H A;  2XB1 A;  1BOR A;  5KH7 A;  3M99 A;  5LKZ A;  3O34 A;  4R7E A;  2LN0 A;  4GND A;  4WZ3 B;  3KNV A;  4QF2 A;  2K17 A;  3EB6 A;  2VPB A;  3PHD A;  3VK6 A;  5B78 A;  2CSY A;  2JMD A;  4AYC A;  5TBN A;  5B77 A;  2LV9 A;  5TDW A;  4LKA A;  1WEQ A;  2MA5 A;  4P5O B;  2YYR A;  3RPG C;  1WEN A;  1WES A;  3N9O A;  1WIL A;  2YSM A;  2KWN A;  3O33 A;  4AUQ B;  2CSZ A;  4FO9 A;  5TRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...