5K3QA

Rhesus macaques trim5alpha bbox2 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
43
structure length
43
Chain Sequence
VDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Tripartite motif-containing protein 5,Tripartite motif-conta
publication title Crystal structure of the Trim5 alpha Bbox2 domain from rhesus macaques describes a plastic oligomerisation interface.
pubmed doi rcsb
source organism Macaca mulatta
total genus 11
structure length 43
sequence length 43
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5k3qA00
2CSVA 2YVRA 3Q1DA 2EGMA 2DJAA 2D8UA 5K3QA 2JUNA 3DDTA
chains in the Genus database with same CATH superfamily
2QICA 4IC3A 3T7LA 3ASLA 2ECJA 5JG6A 2L7PA 4N3WA 3O34A 4Z0OA 4WZ3B 2LN0A 2VJFA 2FFWA 3M62A 2CRRA 2F6JA 4Z0RA 1MM3A 2YVRA 5H1UA 1JM7B 4AP4A 5LKZA 2MD8C 5D1LB 2L80A 1MBMA 2PUYA 3RTRB 1ZBDB 2F42A 3N9PA 4YADA 4S3OC 4GB0A 2I50A 4S3OB 3PURA 5EYAF 2L75A 2DX8A 2K4DA 5H1VA 4PPEA 3SOWA 1Z6UA 3O36A 3IHPA 3LQJA 4ZUXU 1DVPA 3LVRE 2VJEA 5FB1A 4YATA 2LGVA 3I2DA 2MNZA 2JMJA 5B8DA 5DKAA 5SVIA 2UZGA 2M3HA 2KGIA 3T6RA 2JRJA 1X4IA 4FK5A 4WZ2A 5I3LA 1HYIA 2C2LA 4OGCA 4AUQB 2L0BA 2L43A 5AITA 1MM2A 2H0DB 3HCSA 4L7XA 2LQ6A 5D1KB 4YBSA 4V3KC 4WZ0A 2LGGA 2YHOA 2IDAA 3O70A 1WFKA 3FJUB 3SUBA 5G0FA 5D1MB 2ECIA 5SVXA 4I7CA 4YBTA 2ECNA 3T9KA 3M99A 3PUQA 1WEUA 3H7HA 3O37A 2LAUA 2LRIC 4L58A 2OXQC 1VD4A 1LDKC 3ZVZB 4XI1A 1WEPA 5G04B 5C11A 5TBNA 3HCTA 5LCWB 5C13A 2VJFB 5FERA 5DINA 2FUIA 1FBVA 2LV9A 1BORA 3EB6A 1T1HA 1U6GB 4LLBA 4QF2A 5G05B 4C9ZA 4AYCA 2M13A 4TKPB 3FEHA 2LDRA 2YT5A 2Y43A 4A4CA 4I7DA 4W4UA 2HDPA 2Y1MA 3LJUX 2CKLA 4LK9A 5KH7A 3L1XA 3LVQE 4ZDTA 2FD4A 4X3GA 3KDEC 2MD7B 3MDBC 2JMIA 5B79A 2KR4A 2YQMA 2MNYA 5SVIB 2EGPA 3E2DA 2VP7A 4MVTA 2KWNA 3O7AA 1X4JA 2CT2A 2MA6A 2OWAA 4QQ4A 2BAYA 2LXPC 3SOUA 4O64A 2FSAA 3QZVA 3ZYQA 3N9MA 5B78A 1Z60A 2KFTA 1WIMA 1FP0A 4LKAA 4UI9B 2Y1NA 2KIZA 2XEUA 1V87A 4R8PK 2P57A 2E6RA 2KU3A 3V43A 1G25A 2ECGA 2XOCA 5SVYA 3ZNIA 2RI7A 4F1PA 4CA1A 2E6SA 5K3QA 4PTBA 2B0OE 2NAAA 4GNEA 2M6MA 3LRQA 4CCGX 4QF3A 2IQJA 2AN6A 2XP0A 3JUEA 2E61A 4MSXA 2KKYA 1WILA 1K2FA 3PLWA 4LJNA 5H9MA 1JM7A 2D8UA 3M7KA 3HCUA 4AYCB 2QIZA 4IC2A 2LGKA 5TABA 2VPBA 4N4FA 3M63A 4YC9A 3N9QA 3ZVYA 3LDYA 1N87A 5KH3A 2G6QA 2YU4A 1WGMA 3FM8C 3LQIA 4A0CD 4UP5A 4AVXA 4FO9A 5FEYA 2KREA 3ZPV1 2VNFA 2RR4A 1IYMA 4B86C 3GL6A 5KH9A 3EB5A 4I7BA 3NG2A 2JMDA 2RSDA 2YREA 5TDWA 2F6NA 5B77A 2JM3A 2DSMA 5TDRA 2K16A 2EODA 2VPGA 1E4UA 2MUMA 4LADB 4Q6FA 3Q1DA 5TRBA 3N9LA 1VYXA 2M1RA 2KWJA 2G43A 2LGLA 4B7YC 3N9NA 3KQIA 3VK6A 2VJEB 2CONA 1DCQA 2ECWA 2CSVA 2YQLA 3FAOA 3ZPVE 1RMDA 3KV6A 1WEMA 3KV5A 3U5NA 1WEQA 2YSJA 2KKXA 2M85A 4BBQA 5LKTA 3DDTA 4R7EA 2ECVA 3ZTGA 4FJCA 2JUNA 2QJ0A 5FB0A 2EXUA 3U5PA 1VFYA 3GV4A 2XOZA 4UP0A 5J3XA 2YURA 5LKUA 2YSMA 2VPEA 2D8SA 3DPLR 3DWDA 4FIPA 4R2YA 2CRWA 4GNDA 3LQHA 2MT5A 1WESA 2G45A 5B75A 3L11A 1HYJA 1WEWA 2MKEA 2C2VS 1WEVA 3MHHA 3SOXA 2YUCA 1X4UA 4GNGA 2K1JA 4P5OB 4WA6A 1WENA 3U5MA 2PNXA 3O33A 3FL2A 4F52B 3MHSA 1CHCA 2MA5A 2LXHC 2XOYA 3DQVR 2K17A 2CKLB 3FANA 4NN2A 1JOCA 4O62A 2KE1A 2MIQA 3C5KA 2EA6A 3PHDA 2KYUA 1WEEA 2FUUA 5AIUA 2EGMA 1Z2QA 2KGGA 5LKXA 1LDJB 3O35A 3O47A 3N9OA 4YAXA 3RPGC 4OGEA 3RPGB 3KNVA 2HYED 2XB1A 2YYRA 5H1TA 2VPDA 4YABA 4YBMA 2H0DA 2KWOA 1WEOA 1XWHA 4A49A 1WE9A 4V3LC 4ZQLA 3L1ZB 2YHNA 4H9DA 3SHBA 5B76A 2ZETC 2ECTA 3HTKC 4BHWA 2DJAA 1F62A 2CSZA 2CSYA 4A4BA 3C6WA 2L5UA 3U5OA 2YW8A 4GNFA 2KWKA
chains in the Genus database with same CATH topology
3FJUB 3SUBA 3Q1DA 4H9DA 2EGMA 5SVIA 2RR4A 3LVQE 2L7PA 2XOCA 5SVYA 5SVXA 3DWDA 3T9KA 2FD4A 4Z0OA 2KKXA 2OWAA 4OGCA 4F1PA 3O47A 3H7HA 4QQ4A 5K3QA 2B0OE 2LAUA 3KDEC 2FFWA 2CRWA 2CONA 1DCQA 2CRRA 3DDTA 2M13A 2XOYA 4OGEA 4Z0RA 2CSVA 2YREA 2YVRA 3MDBC 4O62A 3FEHA 2DJAA 3LDYA 2IQJA 3M7KA 2JM3A 2MKEA 5SVIB 2JUNA 2XP0A 3JUEA 2E61A 3E2DA 2KKYA 2EXUA 3LVRE 3FM8C 2XOZA 3PLWA 3LJUX 2D8UA 2P57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSV A;  2YVR A;  3Q1D A;  2EGM A;  2DJA A;  2D8U A;  5K3Q A;  2JUN A;  3DDT A; 
#chains in the Genus database with same CATH topology
 2QIC A;  4IC3 A;  3T7L A;  3ASL A;  2ECJ A;  5JG6 A;  2L7P A;  4N3W A;  3O34 A;  4Z0O A;  4WZ3 B;  2LN0 A;  2VJF A;  2FFW A;  3M62 A;  2CRR A;  2F6J A;  4Z0R A;  1MM3 A;  2YVR A;  5H1U A;  1JM7 B;  4AP4 A;  5LKZ A;  2MD8 C;  5D1L B;  2L80 A;  1MBM A;  2PUY A;  3RTR B;  1ZBD B;  2F42 A;  3N9P A;  4YAD A;  4S3O C;  4GB0 A;  2I50 A;  4S3O B;  3PUR A;  5EYA F;  2L75 A;  2DX8 A;  2K4D A;  5H1V A;  4PPE A;  3SOW A;  1Z6U A;  3O36 A;  3IHP A;  3LQJ A;  4ZUX U;  1DVP A;  3LVR E;  2VJE A;  5FB1 A;  4YAT A;  2LGV A;  3I2D A;  2MNZ A;  2JMJ A;  5B8D A;  5DKA A;  5SVI A;  2UZG A;  2M3H A;  2KGI A;  3T6R A;  2JRJ A;  1X4I A;  4FK5 A;  4WZ2 A;  5I3L A;  1HYI A;  2C2L A;  4OGC A;  4AUQ B;  2L0B A;  2L43 A;  5AIT A;  1MM2 A;  2H0D B;  3HCS A;  4L7X A;  2LQ6 A;  5D1K B;  4YBS A;  4V3K C;  4WZ0 A;  2LGG A;  2YHO A;  2IDA A;  3O70 A;  1WFK A;  3FJU B;  3SUB A;  5G0F A;  5D1M B;  2ECI A;  5SVX A;  4I7C A;  4YBT A;  2ECN A;  3T9K A;  3M99 A;  3PUQ A;  1WEU A;  3H7H A;  3O37 A;  2LAU A;  2LRI C;  4L58 A;  2OXQ C;  1VD4 A;  1LDK C;  3ZVZ B;  4XI1 A;  1WEP A;  5G04 B;  5C11 A;  5TBN A;  3HCT A;  5LCW B;  5C13 A;  2VJF B;  5FER A;  5DIN A;  2FUI A;  1FBV A;  2LV9 A;  1BOR A;  3EB6 A;  1T1H A;  1U6G B;  4LLB A;  4QF2 A;  5G05 B;  4C9Z A;  4AYC A;  2M13 A;  4TKP B;  3FEH A;  2LDR A;  2YT5 A;  2Y43 A;  4A4C A;  4I7D A;  4W4U A;  2HDP A;  2Y1M A;  3LJU X;  2CKL A;  4LK9 A;  5KH7 A;  3L1X A;  3LVQ E;  4ZDT A;  2FD4 A;  4X3G A;  3KDE C;  2MD7 B;  3MDB C;  2JMI A;  5B79 A;  2KR4 A;  2YQM A;  2MNY A;  5SVI B;  2EGP A;  3E2D A;  2VP7 A;  4MVT A;  2KWN A;  3O7A A;  1X4J A;  2CT2 A;  2MA6 A;  2OWA A;  4QQ4 A;  2BAY A;  2LXP C;  3SOU A;  4O64 A;  2FSA A;  3QZV A;  3ZYQ A;  3N9M A;  5B78 A;  1Z60 A;  2KFT A;  1WIM A;  1FP0 A;  4LKA A;  4UI9 B;  2Y1N A;  2KIZ A;  2XEU A;  1V87 A;  4R8P K;  2P57 A;  2E6R A;  2KU3 A;  3V43 A;  1G25 A;  2ECG A;  2XOC A;  5SVY A;  3ZNI A;  2RI7 A;  4F1P A;  4CA1 A;  2E6S A;  5K3Q A;  4PTB A;  2B0O E;  2NAA A;  4GNE A;  2M6M A;  3LRQ A;  4CCG X;  4QF3 A;  2IQJ A;  2AN6 A;  2XP0 A;  3JUE A;  2E61 A;  4MSX A;  2KKY A;  1WIL A;  1K2F A;  3PLW A;  4LJN A;  5H9M A;  1JM7 A;  2D8U A;  3M7K A;  3HCU A;  4AYC B;  2QIZ A;  4IC2 A;  2LGK A;  5TAB A;  2VPB A;  4N4F A;  3M63 A;  4YC9 A;  3N9Q A;  3ZVY A;  3LDY A;  1N87 A;  5KH3 A;  2G6Q A;  2YU4 A;  1WGM A;  3FM8 C;  3LQI A;  4A0C D;  4UP5 A;  4AVX A;  4FO9 A;  5FEY A;  2KRE A;  3ZPV 1;  2VNF A;  2RR4 A;  1IYM A;  4B86 C;  3GL6 A;  5KH9 A;  3EB5 A;  4I7B A;  3NG2 A;  2JMD A;  2RSD A;  2YRE A;  5TDW A;  2F6N A;  5B77 A;  2JM3 A;  2DSM A;  5TDR A;  2K16 A;  2EOD A;  2VPG A;  1E4U A;  2MUM A;  4LAD B;  4Q6F A;  3Q1D A;  5TRB A;  3N9L A;  1VYX A;  2M1R A;  2KWJ A;  2G43 A;  2LGL A;  4B7Y C;  3N9N A;  3KQI A;  3VK6 A;  2VJE B;  2CON A;  1DCQ A;  2ECW A;  2CSV A;  2YQL A;  3FAO A;  3ZPV E;  1RMD A;  3KV6 A;  1WEM A;  3KV5 A;  3U5N A;  1WEQ A;  2YSJ A;  2KKX A;  2M85 A;  4BBQ A;  5LKT A;  3DDT A;  4R7E A;  2ECV A;  3ZTG A;  4FJC A;  2JUN A;  2QJ0 A;  5FB0 A;  2EXU A;  3U5P A;  1VFY A;  3GV4 A;  2XOZ A;  4UP0 A;  5J3X A;  2YUR A;  5LKU A;  2YSM A;  2VPE A;  2D8S A;  3DPL R;  3DWD A;  4FIP A;  4R2Y A;  2CRW A;  4GND A;  3LQH A;  2MT5 A;  1WES A;  2G45 A;  5B75 A;  3L11 A;  1HYJ A;  1WEW A;  2MKE A;  2C2V S;  1WEV A;  3MHH A;  3SOX A;  2YUC A;  1X4U A;  4GNG A;  2K1J A;  4P5O B;  4WA6 A;  1WEN A;  3U5M A;  2PNX A;  3O33 A;  3FL2 A;  4F52 B;  3MHS A;  1CHC A;  2MA5 A;  2LXH C;  2XOY A;  3DQV R;  2K17 A;  2CKL B;  3FAN A;  4NN2 A;  1JOC A;  4O62 A;  2KE1 A;  2MIQ A;  3C5K A;  2EA6 A;  3PHD A;  2KYU A;  1WEE A;  2FUU A;  5AIU A;  2EGM A;  1Z2Q A;  2KGG A;  5LKX A;  1LDJ B;  3O35 A;  3O47 A;  3N9O A;  4YAX A;  3RPG C;  4OGE A;  3RPG B;  3KNV A;  2HYE D;  2XB1 A;  2YYR A;  5H1T A;  2VPD A;  4YAB A;  4YBM A;  2H0D A;  2KWO A;  1WEO A;  1XWH A;  4A49 A;  1WE9 A;  4V3L C;  4ZQL A;  3L1Z B;  2YHN A;  4H9D A;  3SHB A;  5B76 A;  2ZET C;  2ECT A;  3HTK C;  4BHW A;  2DJA A;  1F62 A;  2CSZ A;  2CSY A;  4A4B A;  3C6W A;  2L5U A;  3U5O A;  2YW8 A;  4GNF A;  2KWK A; 
#chains in the Genus database with same CATH homology
 3FJU B;  3SUB A;  3Q1D A;  4H9D A;  2EGM A;  5SVI A;  2RR4 A;  3LVQ E;  2L7P A;  2XOC A;  5SVY A;  5SVX A;  3DWD A;  3T9K A;  2FD4 A;  4Z0O A;  2KKX A;  2OWA A;  4OGC A;  4F1P A;  3O47 A;  3H7H A;  4QQ4 A;  5K3Q A;  2B0O E;  2LAU A;  3KDE C;  2FFW A;  2CRW A;  2CON A;  1DCQ A;  2CRR A;  3DDT A;  2M13 A;  2XOY A;  4OGE A;  4Z0R A;  2CSV A;  2YRE A;  2YVR A;  3MDB C;  4O62 A;  3FEH A;  2DJA A;  3LDY A;  2IQJ A;  3M7K A;  2JM3 A;  2MKE A;  5SVI B;  2JUN A;  2XP0 A;  3JUE A;  2E61 A;  3E2D A;  2KKY A;  2EXU A;  3LVR E;  3FM8 C;  2XOZ A;  3PLW A;  3LJU X;  2D8U A;  2P57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...