5G05B

Cryo-em structure of combined apo phosphorylated apc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g05B00
5KH9A 1FBVA 3MHSA 5LKXA 2JRJA 2FUUA 1WEUA 4R7EA 5H9MA 2QJ0A 1HYJA 2C2VS 2MUMA 4YADA 4UP5A 2KU3A 4ZQLA 2QIZA 2G45A 3N9OA 3HTKC 2LDRA 2FSAA 1WEVA 5B77A 4PPEA 4IC2A 4Q6FA 3KNVA 4GB0A 2CSYA 4TKPB 2VJFB 5C11A 4P5OB 2KE1A 2YUCA 3U5MA 5TDRA 1X4IA 2CT2A 3VK6A 4AYCB 1T1HA 4FO9A 1WEPA 2MA5A 1WILA 2ECJA 5I3LA 5H1UA 1WEEA 2JMJA 3L1ZB 5FB1A 4I7DA 4R8PK 5G0FA 4LADB 5B8DA 1JM7A 5D1MB 3QZVA 4V3KC 2ZETC 2L43A 2H0DA 1WEOA 2VJEA 3RPGC 2KYUA 2CKLA 1LDKC 1U6GB 1F62A 1WEWA 3RPGB 4F52B 2YURA 3LQHA 4QF2A 3KV6A 2M85A 4GNGA 4YBSA 4N3WA 1N87A 2I50A 2Y43A 2L0BA 5EYAF 2BAYA 1HYIA 4YATA 2VP7A 3ZVYA 4LK9A 5AITA 1BORA 4WZ0A 3N9NA 5TBNA 4LJNA 3DQVR 4V3LC 2JMDA 3ZVZB 2CSZA 3ZTGA 4A4CA 2EA6A 3O33A 2F42A 4ZUXU 4LKAA 2MD8C 2LV9A 2MD7B 5B78A 2ECWA 4O64A 1WESA 3LQIA 2KR4A 3ZPV1 2YREA 3V43A 3O36A 4L58A 4I7BA 2AN6A 3LQJA 2RI7A 1FP0A 5JG6A 2EGPA 3C5KA 1VD4A 5TDWA 4W4UA 3HCUA 2G6QA 4BBQA 3U5PA 3N9QA 2MIQA 2VPGA 1JM7B 3LRQA 3MHHA 2LXHC 5LKTA 3L11A 4I7CA 3O35A 2F6NA 5LCWB 3M63A 2E6SA 1G25A 2CKLB 3RTRB 2LQ6A 3DPLR 1WENA 4CCGX 2EODA 2VPBA 2MT5A 1VFYA 4GNEA 3PUQA 3T7LA 4R2YA 1WEMA 3ASLA 3EB6A 1K2FA 3KQIA 3N9PA 3EB5A 5G04B 2L80A 3U5OA 3C6WA 3NG2A 3N9LA 3U5NA 5J3XA 1DVPA 5H1VA 2ECGA 2LGGA 3FL2A 3O70A 4L7XA 4C9ZA 2YSJA 3SHBA 4WZ3B 5G05B 2VJFA 4YC9A 2VPDA 2QICA 4FIPA 2LGLA 2KFTA 2YSMA 2LGKA 2K4DA 4AYCA 2K16A 2LXPC 5KH3A 1WGMA 3I2DA 2F6JA 2MNZA 2ECVA 1JOCA 1MM2A 1XWHA 4AP4A 3M99A 5B79A 2KWOA 2KWNA 5D1LB 2M1RA 2LGVA 4GNFA 2ECIA 2KGIA 4A4BA 1IYMA 5KH7A 3M62A 3PURA 5B76A 4WA6A 2KREA 4MVTA 4CA1A 1E4UA 1WIMA 5FERA 5DKAA 1WEQA 4AVXA 2KWKA 5FB0A 2XEUA 3KV5A 4YABA 2YHOA 5LKUA 2Y1NA 3O7AA 5C13A 4XI1A 1Z6UA 2K17A 5D1KB 1V87A 1X4UA 2YQLA 4B86C 2M3HA 4MSXA 4BHWA 2KGGA 2G43A 2H0DB 4S3OC 3O37A 3T6RA 3HCSA 4PTBA 2VJEB 1Z60A 3GL6A 4ZDTA 2LRIC 2PNXA 4LLBA 2YHNA 4S3OB 3ZYQA 4NN2A 4UP0A 2IDAA 5TRBA 2XB1A 4YBMA 2YQMA 2D8SA 2L5UA 4YBTA 3ZPVE 2KIZA 2YU4A 5DINA 3O34A 3GV4A 1ZBDB 2VNFA 2YYRA 2M6MA 2YW8A 2NAAA 3SOWA 2JMIA 2HDPA 1Z2QA 1WE9A 2HYED 4WZ2A 2ECTA 2K1JA 1LDJB 5AIUA 1CHCA 2FUIA 2UZGA 2L75A 1X4JA 5TABA 2KWJA 2RSDA 4FJCA 1WFKA 3SOUA 2YT5A 2Y1MA 2MNYA 2DX8A 1RMDA 2VPEA 4A0CD 5H1TA 2PUYA 4GNDA 3L1XA 5B75A 5LKZA 3ZNIA 4IC3A 4FK5A 2OXQC 4YAXA 2MA6A 4UI9B 3N9MA 4QF3A 3HCTA 2LN0A 2E6RA 3IHPA 3PHDA 1MM3A 4AUQB 3SOXA 5FEYA 4B7YC 4A49A 2C2LA 2ECNA 4N4FA 1VYXA 4X3GA
chains in the Genus database with same CATH superfamily
5KH9A 1FBVA 3MHSA 5LKXA 2JRJA 2FUUA 1WEUA 4R7EA 3DWDA 5H9MA 2QJ0A 1HYJA 1MBMA 2C2VS 2MUMA 4YADA 4UP5A 2KU3A 4ZQLA 3LVRE 2QIZA 2G45A 3N9OA 3H7HA 3HTKC 2LDRA 2FSAA 3MDBC 4O62A 1WEVA 5B77A 4PPEA 4IC2A 4Q6FA 3KNVA 4GB0A 2CSYA 4TKPB 2VJFB 5C11A 4P5OB 2KE1A 2YUCA 3U5MA 5TDRA 1X4IA 2CT2A 3VK6A 2XOYA 4AYCB 1T1HA 4FO9A 1WEPA 2MA5A 1WILA 2ECJA 5I3LA 5H1UA 1WEEA 2JMJA 3L1ZB 5FB1A 4I7DA 4R8PK 5G0FA 4LADB 5B8DA 1JM7A 5D1MB 2XOCA 3QZVA 4V3KC 2ZETC 2L43A 2H0DA 1WEOA 2VJEA 3RPGC 2KYUA 2CKLA 1LDKC 1U6GB 1F62A 1WEWA 3RPGB 4F52B 2YURA 3LQHA 4QF2A 3KV6A 2M85A 4GNGA 4YBSA 4N3WA 2CONA 4OGEA 1N87A 2I50A 2Y43A 2L0BA 5EYAF 2BAYA 1HYIA 4YATA 2VP7A 3ZVYA 4LK9A 5AITA 4H9DA 1BORA 4WZ0A 3N9NA 5TBNA 4LJNA 3DQVR 4V3LC 2JMDA 3ZVZB 2CSZA 3ZTGA 4A4CA 2EA6A 3O33A 2F42A 4ZUXU 4LKAA 2MD8C 2LV9A 2MD7B 5B78A 2ECWA 4O64A 1WESA 3LQIA 2KR4A 3ZPV1 2KKXA 2M13A 2YREA 3V43A 3O36A 4L58A 4I7BA 2AN6A 3LQJA 2RI7A 2EGMA 1FP0A 5JG6A 2MKEA 2B0OE 2EGPA 3C5KA 1VD4A 5TDWA 3T9KA 4W4UA 3HCUA 2G6QA 2YVRA 4BBQA 3U5PA 3N9QA 1DCQA 5SVXA 2MIQA 2VPGA 1JM7B 3LRQA 3MHHA 2LXHC 5LKTA 2IQJA 3L11A 4I7CA 3Q1DA 3O35A 2F6NA 5LCWB 3M63A 2E6SA 1G25A 5SVIA 2CKLB 3RTRB 2LQ6A 3DPLR 3FANA 3O47A 2EXUA 1WENA 2LAUA 4CCGX 2EODA 2VPBA 2MT5A 1VFYA 4GNEA 2XP0A 3PUQA 3T7LA 4R2YA 1WEMA 3ASLA 2DSMA 5SVYA 3EB6A 1K2FA 2FD4A 3KQIA 3N9PA 3EB5A 5G04B 2L80A 4QQ4A 3U5OA 3FJUB 3C6WA 3NG2A 3N9LA 3U5NA 5J3XA 1DVPA 5H1VA 4Z0RA 2ECGA 2LGGA 3FL2A 3O70A 4L7XA 4C9ZA 2YSJA 3SHBA 4WZ3B 5G05B 2VJFA 4YC9A 2VPDA 2QICA 4FIPA 2LGLA 2KFTA 2YSMA 2LGKA 2K4DA 4AYCA 2K16A 2LXPC 5KH3A 1WGMA 3I2DA 2F6JA 2MNZA 2ECVA 1JOCA 1MM2A 1XWHA 4AP4A 3M99A 2JM3A 5B79A 2KWOA 2RR4A 2KWNA 5D1LB 3LVQE 2M1RA 3JUEA 2LGVA 4GNFA 2ECIA 2KGIA 4A4BA 1IYMA 5KH7A 3M62A 3PURA 5B76A 4WA6A 2KREA 4MVTA 4CA1A 1E4UA 2E61A 1WIMA 4Z0OA 5DKAA 5FERA 1WEQA 4AVXA 2KWKA 5FB0A 2XEUA 5SVIB 3KV5A 2FFWA 4YABA 3FEHA 2YHOA 2CRRA 5LKUA 3PLWA 2Y1NA 3O7AA 5C13A 2XOZA 4XI1A 1Z6UA 2K17A 5D1KB 1V87A 3LJUX 1X4UA 2YQLA 4B86C 2M3HA 4MSXA 4BHWA 2KGGA 2G43A 2H0DB 4S3OC 3O37A 3T6RA 3HCSA 4PTBA 2VJEB 4F1PA 1Z60A 2JUNA 3GL6A 4ZDTA 2LRIC 2PNXA 4LLBA 2YHNA 2CSVA 2OWAA 4S3OB 3ZYQA 2L7PA 2DJAA 4NN2A 4UP0A 2IDAA 2CRWA 5TRBA 2XB1A 4YBMA 2YQMA 4OGCA 2D8SA 2L5UA 4YBTA 3ZPVE 2KIZA 2YU4A 5DINA 3O34A 3GV4A 1ZBDB 2VNFA 2YYRA 2M6MA 2YW8A 3DDTA 2NAAA 3SOWA 2JMIA 2HDPA 3E2DA 1Z2QA 1WE9A 2HYED 4WZ2A 2ECTA 2K1JA 3KDEC 1LDJB 5AIUA 1CHCA 2FUIA 2UZGA 2L75A 1X4JA 5TABA 3FAOA 2KWJA 2RSDA 4FJCA 1WFKA 3SOUA 2YT5A 2Y1MA 2MNYA 2DX8A 1RMDA 2VPEA 4A0CD 5H1TA 2PUYA 4GNDA 2P57A 3LDYA 3L1XA 2D8UA 5B75A 5LKZA 3ZNIA 4IC3A 4FK5A 2OXQC 4YAXA 2MA6A 4UI9B 3N9MA 4QF3A 3HCTA 2LN0A 3M7KA 2E6RA 3IHPA 3PHDA 1MM3A 4AUQB 3SOXA 5K3QA 5FEYA 3SUBA 4B7YC 4A49A 2C2LA 2ECNA 3FM8C 4N4FA 1VYXA 2KKYA 4X3GA
chains in the Genus database with same CATH topology
5KH9A 1FBVA 3MHSA 5LKXA 2JRJA 2FUUA 1WEUA 4R7EA 5H9MA 2QJ0A 1HYJA 2C2VS 2MUMA 4YADA 4UP5A 2KU3A 4ZQLA 2QIZA 2G45A 3N9OA 3HTKC 2LDRA 2FSAA 1WEVA 5B77A 4PPEA 4IC2A 4Q6FA 3KNVA 4GB0A 2CSYA 4TKPB 2VJFB 5C11A 4P5OB 2KE1A 2YUCA 3U5MA 5TDRA 1X4IA 2CT2A 3VK6A 4AYCB 1T1HA 4FO9A 1WEPA 2MA5A 1WILA 2ECJA 5I3LA 5H1UA 1WEEA 2JMJA 3L1ZB 5FB1A 4I7DA 4R8PK 5G0FA 4LADB 5B8DA 1JM7A 5D1MB 3QZVA 4V3KC 2ZETC 2L43A 2H0DA 1WEOA 2VJEA 3RPGC 2KYUA 2CKLA 1LDKC 1U6GB 1F62A 1WEWA 3RPGB 4F52B 2YURA 3LQHA 4QF2A 3KV6A 2M85A 4GNGA 4YBSA 4N3WA 1N87A 2I50A 2Y43A 2L0BA 5EYAF 2BAYA 1HYIA 4YATA 2VP7A 3ZVYA 4LK9A 5AITA 1BORA 4WZ0A 3N9NA 5TBNA 4LJNA 3DQVR 4V3LC 2JMDA 3ZVZB 2CSZA 3ZTGA 4A4CA 2EA6A 3O33A 2F42A 4ZUXU 4LKAA 2MD8C 2LV9A 2MD7B 5B78A 2ECWA 4O64A 1WESA 3LQIA 2KR4A 3ZPV1 2YREA 3V43A 3O36A 4L58A 4I7BA 2AN6A 3LQJA 2RI7A 1FP0A 5JG6A 2EGPA 3C5KA 1VD4A 5TDWA 4W4UA 3HCUA 2G6QA 4BBQA 3U5PA 3N9QA 2MIQA 2VPGA 1JM7B 3LRQA 3MHHA 2LXHC 5LKTA 3L11A 4I7CA 3O35A 2F6NA 5LCWB 3M63A 2E6SA 1G25A 2CKLB 3RTRB 2LQ6A 3DPLR 1WENA 4CCGX 2EODA 2VPBA 2MT5A 1VFYA 4GNEA 3PUQA 3T7LA 4R2YA 1WEMA 3ASLA 3EB6A 1K2FA 3KQIA 3N9PA 3EB5A 5G04B 2L80A 3U5OA 3C6WA 3NG2A 3N9LA 3U5NA 5J3XA 1DVPA 5H1VA 2ECGA 2LGGA 3FL2A 3O70A 4L7XA 4C9ZA 2YSJA 3SHBA 4WZ3B 5G05B 2VJFA 4YC9A 2VPDA 2QICA 4FIPA 2LGLA 2KFTA 2YSMA 2LGKA 2K4DA 4AYCA 2K16A 2LXPC 5KH3A 1WGMA 3I2DA 2F6JA 2MNZA 2ECVA 1JOCA 1MM2A 1XWHA 4AP4A 3M99A 5B79A 2KWOA 2KWNA 5D1LB 2M1RA 2LGVA 4GNFA 2ECIA 2KGIA 4A4BA 1IYMA 5KH7A 3M62A 3PURA 5B76A 4WA6A 2KREA 4MVTA 4CA1A 1E4UA 1WIMA 5FERA 5DKAA 1WEQA 4AVXA 2KWKA 5FB0A 2XEUA 3KV5A 4YABA 2YHOA 5LKUA 2Y1NA 3O7AA 5C13A 4XI1A 1Z6UA 2K17A 5D1KB 1V87A 1X4UA 2YQLA 4B86C 2M3HA 4MSXA 4BHWA 2KGGA 2G43A 2H0DB 4S3OC 3O37A 3T6RA 3HCSA 4PTBA 2VJEB 1Z60A 3GL6A 4ZDTA 2LRIC 2PNXA 4LLBA 2YHNA 4S3OB 3ZYQA 4NN2A 4UP0A 2IDAA 5TRBA 2XB1A 4YBMA 2YQMA 2D8SA 2L5UA 4YBTA 3ZPVE 2KIZA 2YU4A 5DINA 3O34A 3GV4A 1ZBDB 2VNFA 2YYRA 2M6MA 2YW8A 2NAAA 3SOWA 2JMIA 2HDPA 1Z2QA 1WE9A 2HYED 4WZ2A 2ECTA 2K1JA 1LDJB 5AIUA 1CHCA 2FUIA 2UZGA 2L75A 1X4JA 5TABA 2KWJA 2RSDA 4FJCA 1WFKA 3SOUA 2YT5A 2Y1MA 2MNYA 2DX8A 1RMDA 2VPEA 4A0CD 5H1TA 2PUYA 4GNDA 3L1XA 5B75A 5LKZA 3ZNIA 4IC3A 4FK5A 2OXQC 4YAXA 2MA6A 4UI9B 3N9MA 4QF3A 3HCTA 2LN0A 2E6RA 3IHPA 3PHDA 1MM3A 4AUQB 3SOXA 5FEYA 4B7YC 4A49A 2C2LA 2ECNA 4N4FA 1VYXA 4X3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH9 A;  1FBV A;  3MHS A;  5LKX A;  2JRJ A;  2FUU A;  1WEU A;  4R7E A;  5H9M A;  2QJ0 A;  1HYJ A;  2C2V S;  2MUM A;  4YAD A;  4UP5 A;  2KU3 A;  4ZQL A;  2QIZ A;  2G45 A;  3N9O A;  3HTK C;  2LDR A;  2FSA A;  1WEV A;  5B77 A;  4PPE A;  4IC2 A;  4Q6F A;  3KNV A;  4GB0 A;  2CSY A;  4TKP B;  2VJF B;  5C11 A;  4P5O B;  2KE1 A;  2YUC A;  3U5M A;  5TDR A;  1X4I A;  2CT2 A;  3VK6 A;  4AYC B;  1T1H A;  4FO9 A;  1WEP A;  2MA5 A;  1WIL A;  2ECJ A;  5I3L A;  5H1U A;  1WEE A;  2JMJ A;  3L1Z B;  5FB1 A;  4I7D A;  4R8P K;  5G0F A;  4LAD B;  5B8D A;  1JM7 A;  5D1M B;  3QZV A;  4V3K C;  2ZET C;  2L43 A;  2H0D A;  1WEO A;  2VJE A;  3RPG C;  2KYU A;  2CKL A;  1LDK C;  1U6G B;  1F62 A;  1WEW A;  3RPG B;  4F52 B;  2YUR A;  3LQH A;  4QF2 A;  3KV6 A;  2M85 A;  4GNG A;  4YBS A;  4N3W A;  1N87 A;  2I50 A;  2Y43 A;  2L0B A;  5EYA F;  2BAY A;  1HYI A;  4YAT A;  2VP7 A;  3ZVY A;  4LK9 A;  5AIT A;  1BOR A;  4WZ0 A;  3N9N A;  5TBN A;  4LJN A;  3DQV R;  4V3L C;  2JMD A;  3ZVZ B;  2CSZ A;  3ZTG A;  4A4C A;  2EA6 A;  3O33 A;  2F42 A;  4ZUX U;  4LKA A;  2MD8 C;  2LV9 A;  2MD7 B;  5B78 A;  2ECW A;  4O64 A;  1WES A;  3LQI A;  2KR4 A;  3ZPV 1;  2YRE A;  3V43 A;  3O36 A;  4L58 A;  4I7B A;  2AN6 A;  3LQJ A;  2RI7 A;  1FP0 A;  5JG6 A;  2EGP A;  3C5K A;  1VD4 A;  5TDW A;  4W4U A;  3HCU A;  2G6Q A;  4BBQ A;  3U5P A;  3N9Q A;  2MIQ A;  2VPG A;  1JM7 B;  3LRQ A;  3MHH A;  2LXH C;  5LKT A;  3L11 A;  4I7C A;  3O35 A;  2F6N A;  5LCW B;  3M63 A;  2E6S A;  1G25 A;  2CKL B;  3RTR B;  2LQ6 A;  3DPL R;  1WEN A;  4CCG X;  2EOD A;  2VPB A;  2MT5 A;  1VFY A;  4GNE A;  3PUQ A;  3T7L A;  4R2Y A;  1WEM A;  3ASL A;  3EB6 A;  1K2F A;  3KQI A;  3N9P A;  3EB5 A;  5G04 B;  2L80 A;  3U5O A;  3C6W A;  3NG2 A;  3N9L A;  3U5N A;  5J3X A;  1DVP A;  5H1V A;  2ECG A;  2LGG A;  3FL2 A;  3O70 A;  4L7X A;  4C9Z A;  2YSJ A;  3SHB A;  4WZ3 B;  5G05 B;  2VJF A;  4YC9 A;  2VPD A;  2QIC A;  4FIP A;  2LGL A;  2KFT A;  2YSM A;  2LGK A;  2K4D A;  4AYC A;  2K16 A;  2LXP C;  5KH3 A;  1WGM A;  3I2D A;  2F6J A;  2MNZ A;  2ECV A;  1JOC A;  1MM2 A;  1XWH A;  4AP4 A;  3M99 A;  5B79 A;  2KWO A;  2KWN A;  5D1L B;  2M1R A;  2LGV A;  4GNF A;  2ECI A;  2KGI A;  4A4B A;  1IYM A;  5KH7 A;  3M62 A;  3PUR A;  5B76 A;  4WA6 A;  2KRE A;  4MVT A;  4CA1 A;  1E4U A;  1WIM A;  5FER A;  5DKA A;  1WEQ A;  4AVX A;  2KWK A;  5FB0 A;  2XEU A;  3KV5 A;  4YAB A;  2YHO A;  5LKU A;  2Y1N A;  3O7A A;  5C13 A;  4XI1 A;  1Z6U A;  2K17 A;  5D1K B;  1V87 A;  1X4U A;  2YQL A;  4B86 C;  2M3H A;  4MSX A;  4BHW A;  2KGG A;  2G43 A;  2H0D B;  4S3O C;  3O37 A;  3T6R A;  3HCS A;  4PTB A;  2VJE B;  1Z60 A;  3GL6 A;  4ZDT A;  2LRI C;  2PNX A;  4LLB A;  2YHN A;  4S3O B;  3ZYQ A;  4NN2 A;  4UP0 A;  2IDA A;  5TRB A;  2XB1 A;  4YBM A;  2YQM A;  2D8S A;  2L5U A;  4YBT A;  3ZPV E;  2KIZ A;  2YU4 A;  5DIN A;  3O34 A;  3GV4 A;  1ZBD B;  2VNF A;  2YYR A;  2M6M A;  2YW8 A;  2NAA A;  3SOW A;  2JMI A;  2HDP A;  1Z2Q A;  1WE9 A;  2HYE D;  4WZ2 A;  2ECT A;  2K1J A;  1LDJ B;  5AIU A;  1CHC A;  2FUI A;  2UZG A;  2L75 A;  1X4J A;  5TAB A;  2KWJ A;  2RSD A;  4FJC A;  1WFK A;  3SOU A;  2YT5 A;  2Y1M A;  2MNY A;  2DX8 A;  1RMD A;  2VPE A;  4A0C D;  5H1T A;  2PUY A;  4GND A;  3L1X A;  5B75 A;  5LKZ A;  3ZNI A;  4IC3 A;  4FK5 A;  2OXQ C;  4YAX A;  2MA6 A;  4UI9 B;  3N9M A;  4QF3 A;  3HCT A;  2LN0 A;  2E6R A;  3IHP A;  3PHD A;  1MM3 A;  4AUQ B;  3SOX A;  5FEY A;  4B7Y C;  4A49 A;  2C2L A;  2ECN A;  4N4F A;  1VYX A;  4X3G A; 
#chains in the Genus database with same CATH topology
 5KH9 A;  1FBV A;  3MHS A;  5LKX A;  2JRJ A;  2FUU A;  1WEU A;  4R7E A;  3DWD A;  5H9M A;  2QJ0 A;  1HYJ A;  1MBM A;  2C2V S;  2MUM A;  4YAD A;  4UP5 A;  2KU3 A;  4ZQL A;  3LVR E;  2QIZ A;  2G45 A;  3N9O A;  3H7H A;  3HTK C;  2LDR A;  2FSA A;  3MDB C;  4O62 A;  1WEV A;  5B77 A;  4PPE A;  4IC2 A;  4Q6F A;  3KNV A;  4GB0 A;  2CSY A;  4TKP B;  2VJF B;  5C11 A;  4P5O B;  2KE1 A;  2YUC A;  3U5M A;  5TDR A;  1X4I A;  2CT2 A;  3VK6 A;  2XOY A;  4AYC B;  1T1H A;  4FO9 A;  1WEP A;  2MA5 A;  1WIL A;  2ECJ A;  5I3L A;  5H1U A;  1WEE A;  2JMJ A;  3L1Z B;  5FB1 A;  4I7D A;  4R8P K;  5G0F A;  4LAD B;  5B8D A;  1JM7 A;  5D1M B;  2XOC A;  3QZV A;  4V3K C;  2ZET C;  2L43 A;  2H0D A;  1WEO A;  2VJE A;  3RPG C;  2KYU A;  2CKL A;  1LDK C;  1U6G B;  1F62 A;  1WEW A;  3RPG B;  4F52 B;  2YUR A;  3LQH A;  4QF2 A;  3KV6 A;  2M85 A;  4GNG A;  4YBS A;  4N3W A;  2CON A;  4OGE A;  1N87 A;  2I50 A;  2Y43 A;  2L0B A;  5EYA F;  2BAY A;  1HYI A;  4YAT A;  2VP7 A;  3ZVY A;  4LK9 A;  5AIT A;  4H9D A;  1BOR A;  4WZ0 A;  3N9N A;  5TBN A;  4LJN A;  3DQV R;  4V3L C;  2JMD A;  3ZVZ B;  2CSZ A;  3ZTG A;  4A4C A;  2EA6 A;  3O33 A;  2F42 A;  4ZUX U;  4LKA A;  2MD8 C;  2LV9 A;  2MD7 B;  5B78 A;  2ECW A;  4O64 A;  1WES A;  3LQI A;  2KR4 A;  3ZPV 1;  2KKX A;  2M13 A;  2YRE A;  3V43 A;  3O36 A;  4L58 A;  4I7B A;  2AN6 A;  3LQJ A;  2RI7 A;  2EGM A;  1FP0 A;  5JG6 A;  2MKE A;  2B0O E;  2EGP A;  3C5K A;  1VD4 A;  5TDW A;  3T9K A;  4W4U A;  3HCU A;  2G6Q A;  2YVR A;  4BBQ A;  3U5P A;  3N9Q A;  1DCQ A;  5SVX A;  2MIQ A;  2VPG A;  1JM7 B;  3LRQ A;  3MHH A;  2LXH C;  5LKT A;  2IQJ A;  3L11 A;  4I7C A;  3Q1D A;  3O35 A;  2F6N A;  5LCW B;  3M63 A;  2E6S A;  1G25 A;  5SVI A;  2CKL B;  3RTR B;  2LQ6 A;  3DPL R;  3FAN A;  3O47 A;  2EXU A;  1WEN A;  2LAU A;  4CCG X;  2EOD A;  2VPB A;  2MT5 A;  1VFY A;  4GNE A;  2XP0 A;  3PUQ A;  3T7L A;  4R2Y A;  1WEM A;  3ASL A;  2DSM A;  5SVY A;  3EB6 A;  1K2F A;  2FD4 A;  3KQI A;  3N9P A;  3EB5 A;  5G04 B;  2L80 A;  4QQ4 A;  3U5O A;  3FJU B;  3C6W A;  3NG2 A;  3N9L A;  3U5N A;  5J3X A;  1DVP A;  5H1V A;  4Z0R A;  2ECG A;  2LGG A;  3FL2 A;  3O70 A;  4L7X A;  4C9Z A;  2YSJ A;  3SHB A;  4WZ3 B;  5G05 B;  2VJF A;  4YC9 A;  2VPD A;  2QIC A;  4FIP A;  2LGL A;  2KFT A;  2YSM A;  2LGK A;  2K4D A;  4AYC A;  2K16 A;  2LXP C;  5KH3 A;  1WGM A;  3I2D A;  2F6J A;  2MNZ A;  2ECV A;  1JOC A;  1MM2 A;  1XWH A;  4AP4 A;  3M99 A;  2JM3 A;  5B79 A;  2KWO A;  2RR4 A;  2KWN A;  5D1L B;  3LVQ E;  2M1R A;  3JUE A;  2LGV A;  4GNF A;  2ECI A;  2KGI A;  4A4B A;  1IYM A;  5KH7 A;  3M62 A;  3PUR A;  5B76 A;  4WA6 A;  2KRE A;  4MVT A;  4CA1 A;  1E4U A;  2E61 A;  1WIM A;  4Z0O A;  5DKA A;  5FER A;  1WEQ A;  4AVX A;  2KWK A;  5FB0 A;  2XEU A;  5SVI B;  3KV5 A;  2FFW A;  4YAB A;  3FEH A;  2YHO A;  2CRR A;  5LKU A;  3PLW A;  2Y1N A;  3O7A A;  5C13 A;  2XOZ A;  4XI1 A;  1Z6U A;  2K17 A;  5D1K B;  1V87 A;  3LJU X;  1X4U A;  2YQL A;  4B86 C;  2M3H A;  4MSX A;  4BHW A;  2KGG A;  2G43 A;  2H0D B;  4S3O C;  3O37 A;  3T6R A;  3HCS A;  4PTB A;  2VJE B;  4F1P A;  1Z60 A;  2JUN A;  3GL6 A;  4ZDT A;  2LRI C;  2PNX A;  4LLB A;  2YHN A;  2CSV A;  2OWA A;  4S3O B;  3ZYQ A;  2L7P A;  2DJA A;  4NN2 A;  4UP0 A;  2IDA A;  2CRW A;  5TRB A;  2XB1 A;  4YBM A;  2YQM A;  4OGC A;  2D8S A;  2L5U A;  4YBT A;  3ZPV E;  2KIZ A;  2YU4 A;  5DIN A;  3O34 A;  3GV4 A;  1ZBD B;  2VNF A;  2YYR A;  2M6M A;  2YW8 A;  3DDT A;  2NAA A;  3SOW A;  2JMI A;  2HDP A;  3E2D A;  1Z2Q A;  1WE9 A;  2HYE D;  4WZ2 A;  2ECT A;  2K1J A;  3KDE C;  1LDJ B;  5AIU A;  1CHC A;  2FUI A;  2UZG A;  2L75 A;  1X4J A;  5TAB A;  3FAO A;  2KWJ A;  2RSD A;  4FJC A;  1WFK A;  3SOU A;  2YT5 A;  2Y1M A;  2MNY A;  2DX8 A;  1RMD A;  2VPE A;  4A0C D;  5H1T A;  2PUY A;  4GND A;  2P57 A;  3LDY A;  3L1X A;  2D8U A;  5B75 A;  5LKZ A;  3ZNI A;  4IC3 A;  4FK5 A;  2OXQ C;  4YAX A;  2MA6 A;  4UI9 B;  3N9M A;  4QF3 A;  3HCT A;  2LN0 A;  3M7K A;  2E6R A;  3IHP A;  3PHD A;  1MM3 A;  4AUQ B;  3SOX A;  5K3Q A;  5FEY A;  3SUB A;  4B7Y C;  4A49 A;  2C2L A;  2ECN A;  3FM8 C;  4N4F A;  1VYX A;  2KKY A;  4X3G A; 
#chains in the Genus database with same CATH homology
 5KH9 A;  1FBV A;  3MHS A;  5LKX A;  2JRJ A;  2FUU A;  1WEU A;  4R7E A;  5H9M A;  2QJ0 A;  1HYJ A;  2C2V S;  2MUM A;  4YAD A;  4UP5 A;  2KU3 A;  4ZQL A;  2QIZ A;  2G45 A;  3N9O A;  3HTK C;  2LDR A;  2FSA A;  1WEV A;  5B77 A;  4PPE A;  4IC2 A;  4Q6F A;  3KNV A;  4GB0 A;  2CSY A;  4TKP B;  2VJF B;  5C11 A;  4P5O B;  2KE1 A;  2YUC A;  3U5M A;  5TDR A;  1X4I A;  2CT2 A;  3VK6 A;  4AYC B;  1T1H A;  4FO9 A;  1WEP A;  2MA5 A;  1WIL A;  2ECJ A;  5I3L A;  5H1U A;  1WEE A;  2JMJ A;  3L1Z B;  5FB1 A;  4I7D A;  4R8P K;  5G0F A;  4LAD B;  5B8D A;  1JM7 A;  5D1M B;  3QZV A;  4V3K C;  2ZET C;  2L43 A;  2H0D A;  1WEO A;  2VJE A;  3RPG C;  2KYU A;  2CKL A;  1LDK C;  1U6G B;  1F62 A;  1WEW A;  3RPG B;  4F52 B;  2YUR A;  3LQH A;  4QF2 A;  3KV6 A;  2M85 A;  4GNG A;  4YBS A;  4N3W A;  1N87 A;  2I50 A;  2Y43 A;  2L0B A;  5EYA F;  2BAY A;  1HYI A;  4YAT A;  2VP7 A;  3ZVY A;  4LK9 A;  5AIT A;  1BOR A;  4WZ0 A;  3N9N A;  5TBN A;  4LJN A;  3DQV R;  4V3L C;  2JMD A;  3ZVZ B;  2CSZ A;  3ZTG A;  4A4C A;  2EA6 A;  3O33 A;  2F42 A;  4ZUX U;  4LKA A;  2MD8 C;  2LV9 A;  2MD7 B;  5B78 A;  2ECW A;  4O64 A;  1WES A;  3LQI A;  2KR4 A;  3ZPV 1;  2YRE A;  3V43 A;  3O36 A;  4L58 A;  4I7B A;  2AN6 A;  3LQJ A;  2RI7 A;  1FP0 A;  5JG6 A;  2EGP A;  3C5K A;  1VD4 A;  5TDW A;  4W4U A;  3HCU A;  2G6Q A;  4BBQ A;  3U5P A;  3N9Q A;  2MIQ A;  2VPG A;  1JM7 B;  3LRQ A;  3MHH A;  2LXH C;  5LKT A;  3L11 A;  4I7C A;  3O35 A;  2F6N A;  5LCW B;  3M63 A;  2E6S A;  1G25 A;  2CKL B;  3RTR B;  2LQ6 A;  3DPL R;  1WEN A;  4CCG X;  2EOD A;  2VPB A;  2MT5 A;  1VFY A;  4GNE A;  3PUQ A;  3T7L A;  4R2Y A;  1WEM A;  3ASL A;  3EB6 A;  1K2F A;  3KQI A;  3N9P A;  3EB5 A;  5G04 B;  2L80 A;  3U5O A;  3C6W A;  3NG2 A;  3N9L A;  3U5N A;  5J3X A;  1DVP A;  5H1V A;  2ECG A;  2LGG A;  3FL2 A;  3O70 A;  4L7X A;  4C9Z A;  2YSJ A;  3SHB A;  4WZ3 B;  5G05 B;  2VJF A;  4YC9 A;  2VPD A;  2QIC A;  4FIP A;  2LGL A;  2KFT A;  2YSM A;  2LGK A;  2K4D A;  4AYC A;  2K16 A;  2LXP C;  5KH3 A;  1WGM A;  3I2D A;  2F6J A;  2MNZ A;  2ECV A;  1JOC A;  1MM2 A;  1XWH A;  4AP4 A;  3M99 A;  5B79 A;  2KWO A;  2KWN A;  5D1L B;  2M1R A;  2LGV A;  4GNF A;  2ECI A;  2KGI A;  4A4B A;  1IYM A;  5KH7 A;  3M62 A;  3PUR A;  5B76 A;  4WA6 A;  2KRE A;  4MVT A;  4CA1 A;  1E4U A;  1WIM A;  5FER A;  5DKA A;  1WEQ A;  4AVX A;  2KWK A;  5FB0 A;  2XEU A;  3KV5 A;  4YAB A;  2YHO A;  5LKU A;  2Y1N A;  3O7A A;  5C13 A;  4XI1 A;  1Z6U A;  2K17 A;  5D1K B;  1V87 A;  1X4U A;  2YQL A;  4B86 C;  2M3H A;  4MSX A;  4BHW A;  2KGG A;  2G43 A;  2H0D B;  4S3O C;  3O37 A;  3T6R A;  3HCS A;  4PTB A;  2VJE B;  1Z60 A;  3GL6 A;  4ZDT A;  2LRI C;  2PNX A;  4LLB A;  2YHN A;  4S3O B;  3ZYQ A;  4NN2 A;  4UP0 A;  2IDA A;  5TRB A;  2XB1 A;  4YBM A;  2YQM A;  2D8S A;  2L5U A;  4YBT A;  3ZPV E;  2KIZ A;  2YU4 A;  5DIN A;  3O34 A;  3GV4 A;  1ZBD B;  2VNF A;  2YYR A;  2M6M A;  2YW8 A;  2NAA A;  3SOW A;  2JMI A;  2HDP A;  1Z2Q A;  1WE9 A;  2HYE D;  4WZ2 A;  2ECT A;  2K1J A;  1LDJ B;  5AIU A;  1CHC A;  2FUI A;  2UZG A;  2L75 A;  1X4J A;  5TAB A;  2KWJ A;  2RSD A;  4FJC A;  1WFK A;  3SOU A;  2YT5 A;  2Y1M A;  2MNY A;  2DX8 A;  1RMD A;  2VPE A;  4A0C D;  5H1T A;  2PUY A;  4GND A;  3L1X A;  5B75 A;  5LKZ A;  3ZNI A;  4IC3 A;  4FK5 A;  2OXQ C;  4YAX A;  2MA6 A;  4UI9 B;  3N9M A;  4QF3 A;  3HCT A;  2LN0 A;  2E6R A;  3IHP A;  3PHD A;  1MM3 A;  4AUQ B;  3SOX A;  5FEY A;  4B7Y C;  4A49 A;  2C2L A;  2ECN A;  4N4F A;  1VYX A;  4X3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...