5G05B

Cryo-em structure of combined apo phosphorylated apc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
b'MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g05B00
2VP7A 2MD7B 3RPGB 2KWNA 3ZVYA 1DVPA 5FEYA 5C11A 3ZNIA 2Y1MA 4N4FA 2YHOA 1BORA 2LGVA 4BHWA 3N9LA 2MNZA 4XI1A 1X4UA 4FO9A 1T1HA 3N9MA 2VJEB 3N9QA 2CT2A 2QIZA 2K1JA 3HTKC 2LXHC 2HYED 2VNFA 2VPBA 4GNFA 3HCSA 2YSJA 4R7EA 2EGPA 3C6WA 5TBNA 2LQ6A 3IHPA 4GB0A 1V87A 2VJEA 1WFKA 4S3OC 2VPDA 2LRIC 2G6QA 4UP5A 5B76A 2ZETC 2KWKA 4S3OB 5FERA 4F52B 2BAYA 3MHSA 2AN6A 4L58A 1U6GB 2RSDA 4MVTA 2KGGA 5H1TA 2E6SA 2M6MA 2K17A 2FUIA 4YATA 3LQIA 4QF3A 5B79A 3DQVR 2ECJA 2LGLA 4AP4A 2I50A 4UI9B 3EB6A 5DINA 1WEEA 1WIMA 3O36A 5DKAA 1F62A 2ECNA 5JG6A 2ECVA 1IYMA 1X4IA 4UP0A 3T6RA 5FB0A 2MD8C 3LRQA 4ZQLA 1WE9A 2JRJA 2XB1A 2L0BA 2FSAA 5C13A 2IDAA 1MM3A 3M62A 3PURA 4L7XA 4LADB 2MA5A 3RTRB 1VD4A 2KWOA 4PPEA 3O70A 3RPGC 1E4UA 1XWHA 5FB1A 3O33A 5B78A 2G43A 2UZGA 2ECWA 4YC9A 3U5OA 2KE1A 2MNYA 4QF2A 2YYRA 4Q6FA 3GV4A 5AIUA 2CKLA 2QJ0A 1WEUA 2F42A 4WZ3B 1MM2A 2L43A 3V43A 2MA6A 1N87A 2M85A 2YU4A 1WEQA 4GNGA 3SOUA 3L1ZB 4WZ2A 2KIZA 2EA6A 3C5KA 2C2LA 3O37A 4B86C 2LXPC 2M1RA 2JMDA 3N9OA 4V3LC 1Z6UA 3ASLA 3I2DA 5KH7A 5LKXA 3MHHA 4I7BA 3O7AA 4AUQB 5TDWA 1WEWA 2MIQA 2D8SA 5EYAF 3KQIA 2Y1NA 4FJCA 3LQJA 1WEOA 2YQLA 4A4BA 4WA6A 5J3XA 1HYIA 2LDRA 2HDPA 5KH3A 4LKAA 4A4CA 2ECGA 2KGIA 2YQMA 5AITA 2F6JA 2KYUA 5D1MB 3GL6A 1VFYA 1WEVA 4P5OB 1WILA 1HYJA 2L80A 4YABA 3LQHA 5LCWB 2EODA 4R8PK 1WENA 2QICA 1CHCA 4C9ZA 2CSYA 2Y43A 4YBTA 4CCGX 5TABA 2H0DB 5D1LB 2MT5A 2OXQC 3M99A 2LGGA 4B7YC 2K4DA 2YHNA 4TKPB 2FUUA 4V3KC 5G0FA 2YSMA 4LK9A 1RMDA 5I3LA 3U5MA 5KH9A 2CKLB 5D1KB 2VJFB 1WESA 5LKTA 4NN2A 1G25A 3DPLR 4YADA 3NG2A 5H9MA 4LJNA 2H0DA 2ECTA 1LDKC 2K16A 5G04B 1WEPA 2LGKA 3ZPVE 2VPGA 1LDJB 5B8DA 4AYCB 3PHDA 4I7CA 3M63A 2VJFA 2YW8A 2E6RA 5TDRA 2C2VS 2KU3A 2LN0A 2PUYA 4FK5A 3T7LA 5H1UA 4FIPA 1Z60A 2KR4A 4O64A 5LKZA 4I7DA 2L5UA 4AYCA 4ZUXU 2L75A 2RI7A 2G45A 3ZPV1 3HCUA 3SHBA 3O35A 2ECIA 4LLBA 1WEMA 4WZ0A 3VK6A 2CSZA 3QZVA 2M3HA 3KNVA 4A49A 4BBQA 4GNDA 3ZYQA 5B75A 4A0CD 2JMJA 1FBVA 5H1VA 2KREA 4CA1A 4AVXA 2JMIA 3HCTA 1JM7B 4ZDTA 1ZBDB 2YT5A 3L1XA 3FL2A 2YREA 2LV9A 4N3WA 5G05B 4GNEA 1VYXA 2VPEA 3ZVZB 2NAAA 3O34A 2YURA 3SOWA 4W4UA 3ZTGA 5B77A 2MUMA 3L11A 1FP0A 1JM7A 2DX8A 4YBMA 3SOXA 2KWJA 1JOCA 4PTBA 2PNXA 4YBSA 1WGMA 5TRBA 1K2FA 2KFTA 4YAXA 3N9PA 2XEUA 3KV5A 4X3GA 3PUQA 4MSXA 2YUCA 4IC3A 1X4JA 3KV6A 3U5NA 1Z2QA 2F6NA 4IC2A 3N9NA 4R2YA 5LKUA 3U5PA 3EB5A
chains in the Genus database with same CATH superfamily
2VP7A 2MD7B 3RPGB 2KWNA 3ZVYA 1DVPA 5FEYA 5C11A 3ZNIA 2Y1MA 4N4FA 2YHOA 1BORA 2LGVA 4BHWA 3N9LA 2MNZA 4XI1A 1X4UA 4FO9A 1T1HA 3N9MA 2VJEB 3N9QA 3LJUX 2CT2A 2QIZA 3H7HA 2K1JA 3HTKC 2LXHC 2HYED 2VNFA 2VPBA 4GNFA 3HCSA 2YSJA 4R7EA 2EGPA 3C6WA 5TBNA 2LQ6A 3IHPA 3PLWA 2CSVA 4GB0A 2CONA 1V87A 2D8UA 2VJEA 1WFKA 4S3OC 2VPDA 2LRIC 2G6QA 4UP5A 4OGCA 5B76A 2ZETC 2KWKA 4S3OB 5FERA 3FAOA 4F52B 2E61A 4Z0RA 2BAYA 3MHSA 2AN6A 4L58A 1U6GB 4MVTA 2RSDA 2KGGA 5H1TA 2E6SA 2M6MA 2K17A 2FUIA 4YATA 3LQIA 4QF3A 2XOCA 5B79A 3DQVR 2ECJA 2LGLA 4AP4A 2I50A 4UI9B 3EB6A 5DINA 1WEEA 1WIMA 3O36A 5DKAA 2P57A 3SUBA 1F62A 2ECNA 5JG6A 3Q1DA 2ECVA 1IYMA 1X4IA 4UP0A 3T6RA 5FB0A 2MD8C 3LRQA 4ZQLA 1WE9A 2JRJA 2XB1A 2CRWA 2L0BA 2FSAA 5C13A 2IDAA 1MM3A 3M62A 2YVRA 3PURA 1DCQA 4L7XA 2XOYA 3DDTA 3FM8C 4LADB 2MA5A 3RTRB 1VD4A 2KWOA 4PPEA 3O70A 3RPGC 1E4UA 1XWHA 3T9KA 1MBMA 4H9DA 5FB1A 3O33A 5B78A 2G43A 2UZGA 2ECWA 4YC9A 3U5OA 5SVIB 2KE1A 2MNYA 3LDYA 4QF2A 2YYRA 3LVRE 4Q6FA 3GV4A 5AIUA 2CKLA 2QJ0A 1WEUA 2F42A 2EXUA 4WZ3B 3FEHA 1MM2A 2L43A 3V43A 3LVQE 2MA6A 1N87A 2M85A 2YU4A 5SVIA 2CRRA 1WEQA 4GNGA 3SOUA 3L1ZB 4WZ2A 2KIZA 2EA6A 4OGEA 3C5KA 2C2LA 3O37A 4B86C 2LXPC 2M1RA 2FD4A 2JMDA 3N9OA 4V3LC 1Z6UA 3ASLA 3I2DA 5KH7A 5LKXA 3MHHA 2EGMA 4I7BA 3O7AA 4AUQB 5TDWA 1WEWA 2MIQA 2D8SA 5EYAF 3KQIA 2Y1NA 4FJCA 3FJUB 3LQJA 2JM3A 1WEOA 4Z0OA 2YQLA 4A4BA 4WA6A 5J3XA 1HYIA 2LDRA 2HDPA 5KH3A 4LKAA 2B0OE 4A4CA 2ECGA 3DWDA 2KGIA 2YQMA 5AITA 2F6JA 2KYUA 5D1MB 3GL6A 1VFYA 1WEVA 4P5OB 1WILA 1HYJA 2XOZA 2L80A 4YABA 3LQHA 5LCWB 2EODA 4R8PK 1WENA 2QICA 1CHCA 4C9ZA 2CSYA 2Y43A 4YBTA 4CCGX 5TABA 2H0DB 5D1LB 2MT5A 2OXQC 3M99A 2LGGA 4B7YC 2K4DA 2YHNA 4TKPB 2FUUA 4V3KC 5G0FA 2YSMA 4LK9A 4QQ4A 1RMDA 5I3LA 3U5MA 5KH9A 2CKLB 5D1KB 2VJFB 1WESA 2FFWA 5LKTA 2MKEA 4NN2A 1G25A 3DPLR 4YADA 3NG2A 5H9MA 4LJNA 2IQJA 2H0DA 2ECTA 1LDKC 2LAUA 2K16A 5G04B 1WEPA 2LGKA 3ZPVE 2XP0A 2VPGA 3FANA 2DSMA 1LDJB 5B8DA 4AYCB 3PHDA 4I7CA 3M63A 2VJFA 2YW8A 2E6RA 5TDRA 2C2VS 2KU3A 2LN0A 2PUYA 4FK5A 3T7LA 5H1UA 4FIPA 1Z60A 2KR4A 4O64A 5LKZA 4I7DA 2L5UA 4AYCA 4ZUXU 2M13A 2L75A 3MDBC 2RI7A 2L7PA 2G45A 3ZPV1 3HCUA 3SHBA 2RR4A 3O47A 3O35A 2ECIA 4LLBA 5K3QA 2JUNA 3KDEC 1WEMA 4WZ0A 3VK6A 2CSZA 3QZVA 2M3HA 3KNVA 4F1PA 4A49A 3JUEA 4BBQA 4GNDA 2OWAA 4O62A 3ZYQA 5B75A 4A0CD 2JMJA 1FBVA 5H1VA 2KREA 4CA1A 4AVXA 2DJAA 2JMIA 3HCTA 1JM7B 4ZDTA 1ZBDB 2YT5A 5SVXA 3L1XA 3FL2A 2KKXA 2YREA 2LV9A 4N3WA 5G05B 4GNEA 1VYXA 3M7KA 2VPEA 3ZVZB 2NAAA 3O34A 2YURA 3SOWA 4W4UA 3ZTGA 5B77A 2MUMA 3L11A 1FP0A 1JM7A 2DX8A 4YBMA 3SOXA 2KKYA 3E2DA 2KWJA 1JOCA 4PTBA 2PNXA 4YBSA 1WGMA 5TRBA 1K2FA 2KFTA 4YAXA 3N9PA 2XEUA 3KV5A 4X3GA 3PUQA 5SVYA 4MSXA 2YUCA 4IC3A 1X4JA 3KV6A 3U5NA 1Z2QA 2F6NA 4IC2A 3N9NA 4R2YA 5LKUA 3U5PA 3EB5A
chains in the Genus database with same CATH topology
2VP7A 2MD7B 3RPGB 2KWNA 3ZVYA 1DVPA 5FEYA 5C11A 3ZNIA 2Y1MA 4N4FA 2YHOA 1BORA 2LGVA 4BHWA 3N9LA 2MNZA 4XI1A 1X4UA 4FO9A 1T1HA 3N9MA 2VJEB 3N9QA 2CT2A 2QIZA 2K1JA 3HTKC 2LXHC 2HYED 2VNFA 2VPBA 4GNFA 3HCSA 2YSJA 4R7EA 2EGPA 3C6WA 5TBNA 2LQ6A 3IHPA 4GB0A 1V87A 2VJEA 1WFKA 4S3OC 2VPDA 2LRIC 2G6QA 4UP5A 5B76A 2ZETC 2KWKA 4S3OB 5FERA 4F52B 2BAYA 3MHSA 2AN6A 4L58A 1U6GB 2RSDA 4MVTA 2KGGA 5H1TA 2E6SA 2M6MA 2K17A 2FUIA 4YATA 3LQIA 4QF3A 5B79A 3DQVR 2ECJA 2LGLA 4AP4A 2I50A 4UI9B 3EB6A 5DINA 1WEEA 1WIMA 3O36A 5DKAA 1F62A 2ECNA 5JG6A 2ECVA 1IYMA 1X4IA 4UP0A 3T6RA 5FB0A 2MD8C 3LRQA 4ZQLA 1WE9A 2JRJA 2XB1A 2L0BA 2FSAA 5C13A 2IDAA 1MM3A 3M62A 3PURA 4L7XA 4LADB 2MA5A 3RTRB 1VD4A 2KWOA 4PPEA 3O70A 3RPGC 1E4UA 1XWHA 5FB1A 3O33A 5B78A 2G43A 2UZGA 2ECWA 4YC9A 3U5OA 2KE1A 2MNYA 4QF2A 2YYRA 4Q6FA 3GV4A 5AIUA 2CKLA 2QJ0A 1WEUA 2F42A 4WZ3B 1MM2A 2L43A 3V43A 2MA6A 1N87A 2M85A 2YU4A 1WEQA 4GNGA 3SOUA 3L1ZB 4WZ2A 2KIZA 2EA6A 3C5KA 2C2LA 3O37A 4B86C 2LXPC 2M1RA 2JMDA 3N9OA 4V3LC 1Z6UA 3ASLA 3I2DA 5KH7A 5LKXA 3MHHA 4I7BA 3O7AA 4AUQB 5TDWA 1WEWA 2MIQA 2D8SA 5EYAF 3KQIA 2Y1NA 4FJCA 3LQJA 1WEOA 2YQLA 4A4BA 4WA6A 5J3XA 1HYIA 2LDRA 2HDPA 5KH3A 4LKAA 4A4CA 2ECGA 2KGIA 2YQMA 5AITA 2F6JA 2KYUA 5D1MB 3GL6A 1VFYA 1WEVA 4P5OB 1WILA 1HYJA 2L80A 4YABA 3LQHA 5LCWB 2EODA 4R8PK 1WENA 2QICA 1CHCA 4C9ZA 2CSYA 2Y43A 4YBTA 4CCGX 5TABA 2H0DB 5D1LB 2MT5A 2OXQC 3M99A 2LGGA 4B7YC 2K4DA 2YHNA 4TKPB 2FUUA 4V3KC 5G0FA 2YSMA 4LK9A 1RMDA 5I3LA 3U5MA 5KH9A 2CKLB 5D1KB 2VJFB 1WESA 5LKTA 4NN2A 1G25A 3DPLR 4YADA 3NG2A 5H9MA 4LJNA 2H0DA 2ECTA 1LDKC 2K16A 5G04B 1WEPA 2LGKA 3ZPVE 2VPGA 1LDJB 5B8DA 4AYCB 3PHDA 4I7CA 3M63A 2VJFA 2YW8A 2E6RA 5TDRA 2C2VS 2KU3A 2LN0A 2PUYA 4FK5A 3T7LA 5H1UA 4FIPA 1Z60A 2KR4A 4O64A 5LKZA 4I7DA 2L5UA 4AYCA 4ZUXU 2L75A 2RI7A 2G45A 3ZPV1 3HCUA 3SHBA 3O35A 2ECIA 4LLBA 1WEMA 4WZ0A 3VK6A 2CSZA 3QZVA 2M3HA 3KNVA 4A49A 4BBQA 4GNDA 3ZYQA 5B75A 4A0CD 2JMJA 1FBVA 5H1VA 2KREA 4CA1A 4AVXA 2JMIA 3HCTA 1JM7B 4ZDTA 1ZBDB 2YT5A 3L1XA 3FL2A 2YREA 2LV9A 4N3WA 5G05B 4GNEA 1VYXA 2VPEA 3ZVZB 2NAAA 3O34A 2YURA 3SOWA 4W4UA 3ZTGA 5B77A 2MUMA 3L11A 1FP0A 1JM7A 2DX8A 4YBMA 3SOXA 2KWJA 1JOCA 4PTBA 2PNXA 4YBSA 1WGMA 5TRBA 1K2FA 2KFTA 4YAXA 3N9PA 2XEUA 3KV5A 4X3GA 3PUQA 4MSXA 2YUCA 4IC3A 1X4JA 3KV6A 3U5NA 1Z2QA 2F6NA 4IC2A 3N9NA 4R2YA 5LKUA 3U5PA 3EB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VP7 A;  2MD7 B;  3RPG B;  2KWN A;  3ZVY A;  1DVP A;  5FEY A;  5C11 A;  3ZNI A;  2Y1M A;  4N4F A;  2YHO A;  1BOR A;  2LGV A;  4BHW A;  3N9L A;  2MNZ A;  4XI1 A;  1X4U A;  4FO9 A;  1T1H A;  3N9M A;  2VJE B;  3N9Q A;  2CT2 A;  2QIZ A;  2K1J A;  3HTK C;  2LXH C;  2HYE D;  2VNF A;  2VPB A;  4GNF A;  3HCS A;  2YSJ A;  4R7E A;  2EGP A;  3C6W A;  5TBN A;  2LQ6 A;  3IHP A;  4GB0 A;  1V87 A;  2VJE A;  1WFK A;  4S3O C;  2VPD A;  2LRI C;  2G6Q A;  4UP5 A;  5B76 A;  2ZET C;  2KWK A;  4S3O B;  5FER A;  4F52 B;  2BAY A;  3MHS A;  2AN6 A;  4L58 A;  1U6G B;  2RSD A;  4MVT A;  2KGG A;  5H1T A;  2E6S A;  2M6M A;  2K17 A;  2FUI A;  4YAT A;  3LQI A;  4QF3 A;  5B79 A;  3DQV R;  2ECJ A;  2LGL A;  4AP4 A;  2I50 A;  4UI9 B;  3EB6 A;  5DIN A;  1WEE A;  1WIM A;  3O36 A;  5DKA A;  1F62 A;  2ECN A;  5JG6 A;  2ECV A;  1IYM A;  1X4I A;  4UP0 A;  3T6R A;  5FB0 A;  2MD8 C;  3LRQ A;  4ZQL A;  1WE9 A;  2JRJ A;  2XB1 A;  2L0B A;  2FSA A;  5C13 A;  2IDA A;  1MM3 A;  3M62 A;  3PUR A;  4L7X A;  4LAD B;  2MA5 A;  3RTR B;  1VD4 A;  2KWO A;  4PPE A;  3O70 A;  3RPG C;  1E4U A;  1XWH A;  5FB1 A;  3O33 A;  5B78 A;  2G43 A;  2UZG A;  2ECW A;  4YC9 A;  3U5O A;  2KE1 A;  2MNY A;  4QF2 A;  2YYR A;  4Q6F A;  3GV4 A;  5AIU A;  2CKL A;  2QJ0 A;  1WEU A;  2F42 A;  4WZ3 B;  1MM2 A;  2L43 A;  3V43 A;  2MA6 A;  1N87 A;  2M85 A;  2YU4 A;  1WEQ A;  4GNG A;  3SOU A;  3L1Z B;  4WZ2 A;  2KIZ A;  2EA6 A;  3C5K A;  2C2L A;  3O37 A;  4B86 C;  2LXP C;  2M1R A;  2JMD A;  3N9O A;  4V3L C;  1Z6U A;  3ASL A;  3I2D A;  5KH7 A;  5LKX A;  3MHH A;  4I7B A;  3O7A A;  4AUQ B;  5TDW A;  1WEW A;  2MIQ A;  2D8S A;  5EYA F;  3KQI A;  2Y1N A;  4FJC A;  3LQJ A;  1WEO A;  2YQL A;  4A4B A;  4WA6 A;  5J3X A;  1HYI A;  2LDR A;  2HDP A;  5KH3 A;  4LKA A;  4A4C A;  2ECG A;  2KGI A;  2YQM A;  5AIT A;  2F6J A;  2KYU A;  5D1M B;  3GL6 A;  1VFY A;  1WEV A;  4P5O B;  1WIL A;  1HYJ A;  2L80 A;  4YAB A;  3LQH A;  5LCW B;  2EOD A;  4R8P K;  1WEN A;  2QIC A;  1CHC A;  4C9Z A;  2CSY A;  2Y43 A;  4YBT A;  4CCG X;  5TAB A;  2H0D B;  5D1L B;  2MT5 A;  2OXQ C;  3M99 A;  2LGG A;  4B7Y C;  2K4D A;  2YHN A;  4TKP B;  2FUU A;  4V3K C;  5G0F A;  2YSM A;  4LK9 A;  1RMD A;  5I3L A;  3U5M A;  5KH9 A;  2CKL B;  5D1K B;  2VJF B;  1WES A;  5LKT A;  4NN2 A;  1G25 A;  3DPL R;  4YAD A;  3NG2 A;  5H9M A;  4LJN A;  2H0D A;  2ECT A;  1LDK C;  2K16 A;  5G04 B;  1WEP A;  2LGK A;  3ZPV E;  2VPG A;  1LDJ B;  5B8D A;  4AYC B;  3PHD A;  4I7C A;  3M63 A;  2VJF A;  2YW8 A;  2E6R A;  5TDR A;  2C2V S;  2KU3 A;  2LN0 A;  2PUY A;  4FK5 A;  3T7L A;  5H1U A;  4FIP A;  1Z60 A;  2KR4 A;  4O64 A;  5LKZ A;  4I7D A;  2L5U A;  4AYC A;  4ZUX U;  2L75 A;  2RI7 A;  2G45 A;  3ZPV 1;  3HCU A;  3SHB A;  3O35 A;  2ECI A;  4LLB A;  1WEM A;  4WZ0 A;  3VK6 A;  2CSZ A;  3QZV A;  2M3H A;  3KNV A;  4A49 A;  4BBQ A;  4GND A;  3ZYQ A;  5B75 A;  4A0C D;  2JMJ A;  1FBV A;  5H1V A;  2KRE A;  4CA1 A;  4AVX A;  2JMI A;  3HCT A;  1JM7 B;  4ZDT A;  1ZBD B;  2YT5 A;  3L1X A;  3FL2 A;  2YRE A;  2LV9 A;  4N3W A;  5G05 B;  4GNE A;  1VYX A;  2VPE A;  3ZVZ B;  2NAA A;  3O34 A;  2YUR A;  3SOW A;  4W4U A;  3ZTG A;  5B77 A;  2MUM A;  3L11 A;  1FP0 A;  1JM7 A;  2DX8 A;  4YBM A;  3SOX A;  2KWJ A;  1JOC A;  4PTB A;  2PNX A;  4YBS A;  1WGM A;  5TRB A;  1K2F A;  2KFT A;  4YAX A;  3N9P A;  2XEU A;  3KV5 A;  4X3G A;  3PUQ A;  4MSX A;  2YUC A;  4IC3 A;  1X4J A;  3KV6 A;  3U5N A;  1Z2Q A;  2F6N A;  4IC2 A;  3N9N A;  4R2Y A;  5LKU A;  3U5P A;  3EB5 A; 
#chains in the Genus database with same CATH topology
 2VP7 A;  2MD7 B;  3RPG B;  2KWN A;  3ZVY A;  1DVP A;  5FEY A;  5C11 A;  3ZNI A;  2Y1M A;  4N4F A;  2YHO A;  1BOR A;  2LGV A;  4BHW A;  3N9L A;  2MNZ A;  4XI1 A;  1X4U A;  4FO9 A;  1T1H A;  3N9M A;  2VJE B;  3N9Q A;  3LJU X;  2CT2 A;  2QIZ A;  3H7H A;  2K1J A;  3HTK C;  2LXH C;  2HYE D;  2VNF A;  2VPB A;  4GNF A;  3HCS A;  2YSJ A;  4R7E A;  2EGP A;  3C6W A;  5TBN A;  2LQ6 A;  3IHP A;  3PLW A;  2CSV A;  4GB0 A;  2CON A;  1V87 A;  2D8U A;  2VJE A;  1WFK A;  4S3O C;  2VPD A;  2LRI C;  2G6Q A;  4UP5 A;  4OGC A;  5B76 A;  2ZET C;  2KWK A;  4S3O B;  5FER A;  3FAO A;  4F52 B;  2E61 A;  4Z0R A;  2BAY A;  3MHS A;  2AN6 A;  4L58 A;  1U6G B;  4MVT A;  2RSD A;  2KGG A;  5H1T A;  2E6S A;  2M6M A;  2K17 A;  2FUI A;  4YAT A;  3LQI A;  4QF3 A;  2XOC A;  5B79 A;  3DQV R;  2ECJ A;  2LGL A;  4AP4 A;  2I50 A;  4UI9 B;  3EB6 A;  5DIN A;  1WEE A;  1WIM A;  3O36 A;  5DKA A;  2P57 A;  3SUB A;  1F62 A;  2ECN A;  5JG6 A;  3Q1D A;  2ECV A;  1IYM A;  1X4I A;  4UP0 A;  3T6R A;  5FB0 A;  2MD8 C;  3LRQ A;  4ZQL A;  1WE9 A;  2JRJ A;  2XB1 A;  2CRW A;  2L0B A;  2FSA A;  5C13 A;  2IDA A;  1MM3 A;  3M62 A;  2YVR A;  3PUR A;  1DCQ A;  4L7X A;  2XOY A;  3DDT A;  3FM8 C;  4LAD B;  2MA5 A;  3RTR B;  1VD4 A;  2KWO A;  4PPE A;  3O70 A;  3RPG C;  1E4U A;  1XWH A;  3T9K A;  1MBM A;  4H9D A;  5FB1 A;  3O33 A;  5B78 A;  2G43 A;  2UZG A;  2ECW A;  4YC9 A;  3U5O A;  5SVI B;  2KE1 A;  2MNY A;  3LDY A;  4QF2 A;  2YYR A;  3LVR E;  4Q6F A;  3GV4 A;  5AIU A;  2CKL A;  2QJ0 A;  1WEU A;  2F42 A;  2EXU A;  4WZ3 B;  3FEH A;  1MM2 A;  2L43 A;  3V43 A;  3LVQ E;  2MA6 A;  1N87 A;  2M85 A;  2YU4 A;  5SVI A;  2CRR A;  1WEQ A;  4GNG A;  3SOU A;  3L1Z B;  4WZ2 A;  2KIZ A;  2EA6 A;  4OGE A;  3C5K A;  2C2L A;  3O37 A;  4B86 C;  2LXP C;  2M1R A;  2FD4 A;  2JMD A;  3N9O A;  4V3L C;  1Z6U A;  3ASL A;  3I2D A;  5KH7 A;  5LKX A;  3MHH A;  2EGM A;  4I7B A;  3O7A A;  4AUQ B;  5TDW A;  1WEW A;  2MIQ A;  2D8S A;  5EYA F;  3KQI A;  2Y1N A;  4FJC A;  3FJU B;  3LQJ A;  2JM3 A;  1WEO A;  4Z0O A;  2YQL A;  4A4B A;  4WA6 A;  5J3X A;  1HYI A;  2LDR A;  2HDP A;  5KH3 A;  4LKA A;  2B0O E;  4A4C A;  2ECG A;  3DWD A;  2KGI A;  2YQM A;  5AIT A;  2F6J A;  2KYU A;  5D1M B;  3GL6 A;  1VFY A;  1WEV A;  4P5O B;  1WIL A;  1HYJ A;  2XOZ A;  2L80 A;  4YAB A;  3LQH A;  5LCW B;  2EOD A;  4R8P K;  1WEN A;  2QIC A;  1CHC A;  4C9Z A;  2CSY A;  2Y43 A;  4YBT A;  4CCG X;  5TAB A;  2H0D B;  5D1L B;  2MT5 A;  2OXQ C;  3M99 A;  2LGG A;  4B7Y C;  2K4D A;  2YHN A;  4TKP B;  2FUU A;  4V3K C;  5G0F A;  2YSM A;  4LK9 A;  4QQ4 A;  1RMD A;  5I3L A;  3U5M A;  5KH9 A;  2CKL B;  5D1K B;  2VJF B;  1WES A;  2FFW A;  5LKT A;  2MKE A;  4NN2 A;  1G25 A;  3DPL R;  4YAD A;  3NG2 A;  5H9M A;  4LJN A;  2IQJ A;  2H0D A;  2ECT A;  1LDK C;  2LAU A;  2K16 A;  5G04 B;  1WEP A;  2LGK A;  3ZPV E;  2XP0 A;  2VPG A;  3FAN A;  2DSM A;  1LDJ B;  5B8D A;  4AYC B;  3PHD A;  4I7C A;  3M63 A;  2VJF A;  2YW8 A;  2E6R A;  5TDR A;  2C2V S;  2KU3 A;  2LN0 A;  2PUY A;  4FK5 A;  3T7L A;  5H1U A;  4FIP A;  1Z60 A;  2KR4 A;  4O64 A;  5LKZ A;  4I7D A;  2L5U A;  4AYC A;  4ZUX U;  2M13 A;  2L75 A;  3MDB C;  2RI7 A;  2L7P A;  2G45 A;  3ZPV 1;  3HCU A;  3SHB A;  2RR4 A;  3O47 A;  3O35 A;  2ECI A;  4LLB A;  5K3Q A;  2JUN A;  3KDE C;  1WEM A;  4WZ0 A;  3VK6 A;  2CSZ A;  3QZV A;  2M3H A;  3KNV A;  4F1P A;  4A49 A;  3JUE A;  4BBQ A;  4GND A;  2OWA A;  4O62 A;  3ZYQ A;  5B75 A;  4A0C D;  2JMJ A;  1FBV A;  5H1V A;  2KRE A;  4CA1 A;  4AVX A;  2DJA A;  2JMI A;  3HCT A;  1JM7 B;  4ZDT A;  1ZBD B;  2YT5 A;  5SVX A;  3L1X A;  3FL2 A;  2KKX A;  2YRE A;  2LV9 A;  4N3W A;  5G05 B;  4GNE A;  1VYX A;  3M7K A;  2VPE A;  3ZVZ B;  2NAA A;  3O34 A;  2YUR A;  3SOW A;  4W4U A;  3ZTG A;  5B77 A;  2MUM A;  3L11 A;  1FP0 A;  1JM7 A;  2DX8 A;  4YBM A;  3SOX A;  2KKY A;  3E2D A;  2KWJ A;  1JOC A;  4PTB A;  2PNX A;  4YBS A;  1WGM A;  5TRB A;  1K2F A;  2KFT A;  4YAX A;  3N9P A;  2XEU A;  3KV5 A;  4X3G A;  3PUQ A;  5SVY A;  4MSX A;  2YUC A;  4IC3 A;  1X4J A;  3KV6 A;  3U5N A;  1Z2Q A;  2F6N A;  4IC2 A;  3N9N A;  4R2Y A;  5LKU A;  3U5P A;  3EB5 A; 
#chains in the Genus database with same CATH homology
 2VP7 A;  2MD7 B;  3RPG B;  2KWN A;  3ZVY A;  1DVP A;  5FEY A;  5C11 A;  3ZNI A;  2Y1M A;  4N4F A;  2YHO A;  1BOR A;  2LGV A;  4BHW A;  3N9L A;  2MNZ A;  4XI1 A;  1X4U A;  4FO9 A;  1T1H A;  3N9M A;  2VJE B;  3N9Q A;  2CT2 A;  2QIZ A;  2K1J A;  3HTK C;  2LXH C;  2HYE D;  2VNF A;  2VPB A;  4GNF A;  3HCS A;  2YSJ A;  4R7E A;  2EGP A;  3C6W A;  5TBN A;  2LQ6 A;  3IHP A;  4GB0 A;  1V87 A;  2VJE A;  1WFK A;  4S3O C;  2VPD A;  2LRI C;  2G6Q A;  4UP5 A;  5B76 A;  2ZET C;  2KWK A;  4S3O B;  5FER A;  4F52 B;  2BAY A;  3MHS A;  2AN6 A;  4L58 A;  1U6G B;  2RSD A;  4MVT A;  2KGG A;  5H1T A;  2E6S A;  2M6M A;  2K17 A;  2FUI A;  4YAT A;  3LQI A;  4QF3 A;  5B79 A;  3DQV R;  2ECJ A;  2LGL A;  4AP4 A;  2I50 A;  4UI9 B;  3EB6 A;  5DIN A;  1WEE A;  1WIM A;  3O36 A;  5DKA A;  1F62 A;  2ECN A;  5JG6 A;  2ECV A;  1IYM A;  1X4I A;  4UP0 A;  3T6R A;  5FB0 A;  2MD8 C;  3LRQ A;  4ZQL A;  1WE9 A;  2JRJ A;  2XB1 A;  2L0B A;  2FSA A;  5C13 A;  2IDA A;  1MM3 A;  3M62 A;  3PUR A;  4L7X A;  4LAD B;  2MA5 A;  3RTR B;  1VD4 A;  2KWO A;  4PPE A;  3O70 A;  3RPG C;  1E4U A;  1XWH A;  5FB1 A;  3O33 A;  5B78 A;  2G43 A;  2UZG A;  2ECW A;  4YC9 A;  3U5O A;  2KE1 A;  2MNY A;  4QF2 A;  2YYR A;  4Q6F A;  3GV4 A;  5AIU A;  2CKL A;  2QJ0 A;  1WEU A;  2F42 A;  4WZ3 B;  1MM2 A;  2L43 A;  3V43 A;  2MA6 A;  1N87 A;  2M85 A;  2YU4 A;  1WEQ A;  4GNG A;  3SOU A;  3L1Z B;  4WZ2 A;  2KIZ A;  2EA6 A;  3C5K A;  2C2L A;  3O37 A;  4B86 C;  2LXP C;  2M1R A;  2JMD A;  3N9O A;  4V3L C;  1Z6U A;  3ASL A;  3I2D A;  5KH7 A;  5LKX A;  3MHH A;  4I7B A;  3O7A A;  4AUQ B;  5TDW A;  1WEW A;  2MIQ A;  2D8S A;  5EYA F;  3KQI A;  2Y1N A;  4FJC A;  3LQJ A;  1WEO A;  2YQL A;  4A4B A;  4WA6 A;  5J3X A;  1HYI A;  2LDR A;  2HDP A;  5KH3 A;  4LKA A;  4A4C A;  2ECG A;  2KGI A;  2YQM A;  5AIT A;  2F6J A;  2KYU A;  5D1M B;  3GL6 A;  1VFY A;  1WEV A;  4P5O B;  1WIL A;  1HYJ A;  2L80 A;  4YAB A;  3LQH A;  5LCW B;  2EOD A;  4R8P K;  1WEN A;  2QIC A;  1CHC A;  4C9Z A;  2CSY A;  2Y43 A;  4YBT A;  4CCG X;  5TAB A;  2H0D B;  5D1L B;  2MT5 A;  2OXQ C;  3M99 A;  2LGG A;  4B7Y C;  2K4D A;  2YHN A;  4TKP B;  2FUU A;  4V3K C;  5G0F A;  2YSM A;  4LK9 A;  1RMD A;  5I3L A;  3U5M A;  5KH9 A;  2CKL B;  5D1K B;  2VJF B;  1WES A;  5LKT A;  4NN2 A;  1G25 A;  3DPL R;  4YAD A;  3NG2 A;  5H9M A;  4LJN A;  2H0D A;  2ECT A;  1LDK C;  2K16 A;  5G04 B;  1WEP A;  2LGK A;  3ZPV E;  2VPG A;  1LDJ B;  5B8D A;  4AYC B;  3PHD A;  4I7C A;  3M63 A;  2VJF A;  2YW8 A;  2E6R A;  5TDR A;  2C2V S;  2KU3 A;  2LN0 A;  2PUY A;  4FK5 A;  3T7L A;  5H1U A;  4FIP A;  1Z60 A;  2KR4 A;  4O64 A;  5LKZ A;  4I7D A;  2L5U A;  4AYC A;  4ZUX U;  2L75 A;  2RI7 A;  2G45 A;  3ZPV 1;  3HCU A;  3SHB A;  3O35 A;  2ECI A;  4LLB A;  1WEM A;  4WZ0 A;  3VK6 A;  2CSZ A;  3QZV A;  2M3H A;  3KNV A;  4A49 A;  4BBQ A;  4GND A;  3ZYQ A;  5B75 A;  4A0C D;  2JMJ A;  1FBV A;  5H1V A;  2KRE A;  4CA1 A;  4AVX A;  2JMI A;  3HCT A;  1JM7 B;  4ZDT A;  1ZBD B;  2YT5 A;  3L1X A;  3FL2 A;  2YRE A;  2LV9 A;  4N3W A;  5G05 B;  4GNE A;  1VYX A;  2VPE A;  3ZVZ B;  2NAA A;  3O34 A;  2YUR A;  3SOW A;  4W4U A;  3ZTG A;  5B77 A;  2MUM A;  3L11 A;  1FP0 A;  1JM7 A;  2DX8 A;  4YBM A;  3SOX A;  2KWJ A;  1JOC A;  4PTB A;  2PNX A;  4YBS A;  1WGM A;  5TRB A;  1K2F A;  2KFT A;  4YAX A;  3N9P A;  2XEU A;  3KV5 A;  4X3G A;  3PUQ A;  4MSX A;  2YUC A;  4IC3 A;  1X4J A;  3KV6 A;  3U5N A;  1Z2Q A;  2F6N A;  4IC2 A;  3N9N A;  4R2Y A;  5LKU A;  3U5P A;  3EB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...