5G05B

Cryo-em structure of combined apo phosphorylated apc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g05B00
3ZTGA 4BBQA 5C11A 2KWOA 3L1ZB 2NAAA 2YSJA 1E4UA 2G6QA 3HCTA 2YQMA 1DVPA 2VPGA 4GB0A 3RPGC 4YADA 2ECNA 2M85A 3ZVYA 2EODA 1XWHA 2FSAA 5LKXA 3L11A 2YREA 2LRIC 2MNYA 3V43A 2F6NA 2MD8C 3QZVA 1WE9A 4O64A 3N9NA 1WEEA 4S3OB 1JM7A 1WEMA 2YW8A 4QF2A 5TDRA 5KH9A 2XEUA 2K1JA 5LKZA 1ZBDB 3KQIA 4ZDTA 2C2LA 3EB6A 3LQJA 2OXQC 2QICA 2KGIA 4LLBA 3C6WA 2VP7A 5B77A 4YATA 5G0FA 2Y43A 2JMIA 1X4UA 2MNZA 2KU3A 4WZ2A 3N9PA 4AP4A 5TRBA 2UZGA 2LGKA 2LN0A 2VPEA 5LKUA 4FO9A 3C5KA 2YHOA 5JG6A 2VPDA 1JM7B 4CCGX 4R7EA 4UP5A 1Z60A 4YBMA 3IHPA 4WZ3B 1G25A 3M99A 3VK6A 2MA6A 3SOUA 3I2DA 4ZUXU 2YT5A 3SOWA 5I3LA 2JRJA 2KGGA 4B7YC 4YBTA 2E6RA 4I7CA 2Y1NA 1F62A 5D1KB 5TDWA 3MHHA 1HYIA 1CHCA 4A4BA 2ECJA 3ZPV1 4YAXA 3U5OA 3N9QA 5D1LB 5LCWB 2FUUA 3LQIA 4X3GA 1LDKC 3LRQA 2L5UA 2YYRA 5LKTA 3HCSA 2VNFA 4MVTA 4Q6FA 3O70A 4R8PK 4A49A 5B8DA 5B76A 3O7AA 2MD7B 4NN2A 4YC9A 4IC3A 2KIZA 2FUIA 3N9LA 2MA5A 2LGLA 4F52B 2L80A 2LV9A 2PUYA 2MIQA 2QJ0A 2L43A 4WA6A 4R2YA 2YUCA 3RPGB 4A4CA 2CSYA 2K16A 3T6RA 4GNFA 3U5MA 1WENA 3O35A 5H1VA 4I7BA 2JMDA 5H1UA 2VJFA 5FERA 4V3KC 4LJNA 4FK5A 4AVXA 3PHDA 3KV5A 4WZ0A 1WIMA 2KWKA 4IC2A 3M62A 3MHSA 3N9OA 2D8SA 1X4IA 5AIUA 5FB1A 5FB0A 5DINA 2KR4A 4V3LC 2M3HA 5KH7A 3GL6A 4CA1A 2LXHC 2KE1A 2C2VS 1FP0A 2MUMA 4FJCA 3L1XA 2QIZA 1N87A 2YHNA 3SHBA 4BHWA 5C13A 3HTKC 1WEPA 4AUQB 1IYMA 2VJEA 2L75A 3GV4A 4N3WA 5D1MB 3PUQA 1WEQA 4L7XA 1JOCA 1VD4A 1K2FA 5KH3A 2L0BA 2DX8A 2CSZA 2EGPA 3RTRB 2LGVA 3EB5A 3O37A 2LGGA 4QF3A 4N4FA 4ZQLA 2PNXA 2KFTA 3ZVZB 3U5NA 4FIPA 2BAYA 1HYJA 4PTBA 3ZNIA 1VFYA 2VJEB 1WEVA 4L58A 3PURA 4MSXA 2ECVA 5TABA 2M1RA 1X4JA 3O36A 1Z2QA 2G43A 3O33A 2F6JA 1WFKA 2VPBA 2K17A 4LK9A 4YBSA 2XB1A 5FEYA 5DKAA 4GNGA 2M6MA 4UI9B 3DPLR 3U5PA 4AYCA 2KYUA 2MT5A 2YURA 4S3OC 2CT2A 1WILA 4A0CD 2HYED 3DQVR 2LDRA 2H0DA 5H9MA 3M63A 2CKLA 2G45A 2ECTA 2EA6A 4I7DA 5TBNA 1V87A 2IDAA 2YSMA 1WEOA 3ZYQA 5B75A 1RMDA 4LKAA 4B86C 4W4UA 3HCUA 1VYXA 2ECWA 2F42A 3LQHA 5EYAF 2KREA 4P5OB 1U6GB 2KWJA 2ZETC 1WEUA 2Y1MA 2E6SA 5G05B 3FL2A 2LXPC 4YABA 5J3XA 2AN6A 3ZPVE 1LDJB 4PPEA 1WEWA 1FBVA 1WGMA 3ASLA 4XI1A 4AYCB 5H1TA 1BORA 3O34A 3KNVA 1T1HA 2H0DB 2YU4A 2CKLB 4GNEA 2VJFB 2YQLA 1WESA 5B78A 2KWNA 3N9MA 1MM3A 2HDPA 4UP0A 1Z6UA 5G04B 4TKPB 2K4DA 3NG2A 4C9ZA 2I50A 3SOXA 5AITA 3KV6A 2LQ6A 3T7LA 2RSDA 4LADB 5B79A 2RI7A 2JMJA 4GNDA 1MM2A 2ECGA 2ECIA
chains in the Genus database with same CATH superfamily
2JM3A 3ZTGA 4BBQA 5C11A 2KWOA 2EGMA 4QQ4A 3L1ZB 3FEHA 2NAAA 2YSJA 1E4UA 2G6QA 2CRWA 3HCTA 3JUEA 2YQMA 1DVPA 2VPGA 4GB0A 3RPGC 4YADA 2ECNA 2EXUA 2M85A 3ZVYA 2EODA 1XWHA 3FJUB 2FSAA 5LKXA 5SVIA 3L11A 2CONA 2YREA 3LVRE 2LRIC 2MNYA 3LDYA 3V43A 2F6NA 2MD8C 3O47A 3Q1DA 3QZVA 1WE9A 4O64A 3N9NA 1WEEA 4S3OB 1JM7A 1WEMA 2YW8A 4QF2A 5TDRA 5KH9A 2XEUA 2K1JA 5LKZA 1ZBDB 3KQIA 4ZDTA 2C2LA 3EB6A 3LQJA 2OXQC 2JUNA 2QICA 2KGIA 4LLBA 3C6WA 2VP7A 5B77A 4YATA 5G0FA 2Y43A 5SVIB 2JMIA 1X4UA 2MNZA 2KU3A 4WZ2A 3N9PA 3FAOA 4AP4A 5TRBA 2UZGA 2LGKA 2LN0A 2VPEA 5LKUA 4FO9A 3C5KA 2YHOA 2XOZA 5JG6A 2VPDA 1JM7B 4CCGX 4R7EA 4Z0RA 4UP5A 1Z60A 4YBMA 3IHPA 4WZ3B 1G25A 3M99A 3VK6A 2MA6A 3SOUA 3I2DA 4ZUXU 2YT5A 3DDTA 3SOWA 5I3LA 2JRJA 2KGGA 3E2DA 4B7YC 4YBTA 2E6RA 4I7CA 2Y1NA 1F62A 5D1KB 5TDWA 3MHHA 1HYIA 1CHCA 4A4BA 4OGCA 2ECJA 3ZPV1 4YAXA 3U5OA 3N9QA 5D1LB 5LCWB 2FUUA 3MDBC 3LQIA 4X3GA 1LDKC 3LRQA 2L5UA 2YYRA 5LKTA 3HCSA 2VNFA 4MVTA 5SVXA 4Q6FA 3O70A 4R8PK 4A49A 2OWAA 4O62A 5B8DA 5B76A 3O7AA 2DSMA 2MD7B 4H9DA 4NN2A 4YC9A 4IC3A 2KIZA 2FUIA 3N9LA 2MA5A 2LGLA 3SUBA 5K3QA 4F52B 2L80A 2LV9A 2PUYA 2MIQA 2QJ0A 2L43A 3KDEC 4WA6A 2CRRA 4R2YA 2YUCA 3RPGB 4A4CA 2CSYA 2K16A 3T6RA 4GNFA 3U5MA 1WENA 3O35A 5H1VA 4I7BA 2JMDA 5H1UA 2VJFA 5FERA 4V3KC 4LJNA 4FK5A 4AVXA 2D8UA 3PHDA 3KV5A 4WZ0A 1WIMA 2KWKA 4IC2A 3FANA 4F1PA 3M62A 3MHSA 3N9OA 1X4IA 2D8SA 5AIUA 2FD4A 5FB1A 5FB0A 5DINA 2KR4A 4V3LC 2M3HA 5KH7A 3GL6A 4CA1A 2XOYA 2LXHC 2KE1A 3DWDA 2C2VS 1FP0A 2MUMA 4FJCA 3L1XA 2MKEA 2QIZA 1N87A 2YHNA 3SHBA 4BHWA 5C13A 3HTKC 2XP0A 1WEPA 4AUQB 1IYMA 2VJEA 2L75A 3GV4A 4N3WA 5D1MB 3PUQA 1WEQA 4L7XA 1JOCA 1VD4A 1K2FA 5KH3A 2L0BA 2DX8A 2CSZA 2EGPA 3RTRB 2LGVA 3EB5A 3O37A 2LGGA 2XOCA 4QF3A 4N4FA 4ZQLA 2PNXA 2KFTA 3ZVZB 3U5NA 4FIPA 2BAYA 1HYJA 4PTBA 2B0OE 1DCQA 1VFYA 3ZNIA 2VJEB 1WEVA 4L58A 3PURA 4MSXA 2ECVA 2M1RA 5TABA 1X4JA 2KKXA 1Z2QA 3O36A 2G43A 3O33A 2F6JA 1WFKA 2VPBA 2K17A 4LK9A 4YBSA 2XB1A 3FM8C 3LJUX 5FEYA 5DKAA 4GNGA 2LAUA 2M6MA 4OGEA 4UI9B 3DPLR 2M13A 3U5PA 4AYCA 2KYUA 2MT5A 2YURA 4S3OC 2CT2A 1WILA 5SVYA 4A0CD 2HYED 3DQVR 2E61A 2LDRA 2H0DA 5H9MA 3M63A 2CKLA 2G45A 2ECTA 2EA6A 4I7DA 5TBNA 1V87A 2IDAA 2YSMA 1WEOA 3ZYQA 5B75A 1RMDA 4LKAA 4B86C 4W4UA 3HCUA 1VYXA 2ECWA 2F42A 3LQHA 5EYAF 3T9KA 2YVRA 2KREA 4P5OB 1U6GB 2KWJA 2ZETC 1WEUA 2Y1MA 2E6SA 2CSVA 5G05B 3FL2A 2LXPC 4YABA 2P57A 2L7PA 5J3XA 2AN6A 3ZPVE 1LDJB 4PPEA 1WEWA 2DJAA 1FBVA 2KKYA 1WGMA 1MBMA 3ASLA 4XI1A 4AYCB 5H1TA 1BORA 3O34A 2IQJA 3KNVA 1T1HA 2H0DB 2YU4A 2CKLB 4GNEA 2VJFB 2YQLA 1WESA 5B78A 2KWNA 2FFWA 3N9MA 1MM3A 2HDPA 4UP0A 1Z6UA 5G04B 4TKPB 3LVQE 2K4DA 3NG2A 4C9ZA 2I50A 3SOXA 3H7HA 5AITA 2RR4A 4Z0OA 3KV6A 2LQ6A 3T7LA 2RSDA 4LADB 5B79A 2RI7A 3M7KA 2JMJA 4GNDA 1MM2A 2ECGA 3PLWA 2ECIA
chains in the Genus database with same CATH topology
3ZTGA 4BBQA 5C11A 2KWOA 3L1ZB 2NAAA 2YSJA 1E4UA 2G6QA 3HCTA 2YQMA 1DVPA 2VPGA 4GB0A 3RPGC 4YADA 2ECNA 2M85A 3ZVYA 2EODA 1XWHA 2FSAA 5LKXA 3L11A 2YREA 2LRIC 2MNYA 3V43A 2F6NA 2MD8C 3QZVA 1WE9A 4O64A 3N9NA 1WEEA 4S3OB 1JM7A 1WEMA 2YW8A 4QF2A 5TDRA 5KH9A 2XEUA 2K1JA 5LKZA 1ZBDB 3KQIA 4ZDTA 2C2LA 3EB6A 3LQJA 2OXQC 2QICA 2KGIA 4LLBA 3C6WA 2VP7A 5B77A 4YATA 5G0FA 2Y43A 2JMIA 1X4UA 2MNZA 2KU3A 4WZ2A 3N9PA 4AP4A 5TRBA 2UZGA 2LGKA 2LN0A 2VPEA 5LKUA 4FO9A 3C5KA 2YHOA 5JG6A 2VPDA 1JM7B 4CCGX 4R7EA 4UP5A 1Z60A 4YBMA 3IHPA 4WZ3B 1G25A 3M99A 3VK6A 2MA6A 3SOUA 3I2DA 4ZUXU 2YT5A 3SOWA 5I3LA 2JRJA 2KGGA 4B7YC 4YBTA 2E6RA 4I7CA 2Y1NA 1F62A 5D1KB 5TDWA 3MHHA 1HYIA 1CHCA 4A4BA 2ECJA 3ZPV1 4YAXA 3U5OA 3N9QA 5D1LB 5LCWB 2FUUA 3LQIA 4X3GA 1LDKC 3LRQA 2L5UA 2YYRA 5LKTA 3HCSA 2VNFA 4MVTA 4Q6FA 3O70A 4R8PK 4A49A 5B8DA 5B76A 3O7AA 2MD7B 4NN2A 4YC9A 4IC3A 2KIZA 2FUIA 3N9LA 2MA5A 2LGLA 4F52B 2L80A 2LV9A 2PUYA 2MIQA 2QJ0A 2L43A 4WA6A 4R2YA 2YUCA 3RPGB 4A4CA 2CSYA 2K16A 3T6RA 4GNFA 3U5MA 1WENA 3O35A 5H1VA 4I7BA 2JMDA 5H1UA 2VJFA 5FERA 4V3KC 4LJNA 4FK5A 4AVXA 3PHDA 3KV5A 4WZ0A 1WIMA 2KWKA 4IC2A 3M62A 3MHSA 3N9OA 2D8SA 1X4IA 5AIUA 5FB1A 5FB0A 5DINA 2KR4A 4V3LC 2M3HA 5KH7A 3GL6A 4CA1A 2LXHC 2KE1A 2C2VS 1FP0A 2MUMA 4FJCA 3L1XA 2QIZA 1N87A 2YHNA 3SHBA 4BHWA 5C13A 3HTKC 1WEPA 4AUQB 1IYMA 2VJEA 2L75A 3GV4A 4N3WA 5D1MB 3PUQA 1WEQA 4L7XA 1JOCA 1VD4A 1K2FA 5KH3A 2L0BA 2DX8A 2CSZA 2EGPA 3RTRB 2LGVA 3EB5A 3O37A 2LGGA 4QF3A 4N4FA 4ZQLA 2PNXA 2KFTA 3ZVZB 3U5NA 4FIPA 2BAYA 1HYJA 4PTBA 3ZNIA 1VFYA 2VJEB 1WEVA 4L58A 3PURA 4MSXA 2ECVA 5TABA 2M1RA 1X4JA 3O36A 1Z2QA 2G43A 3O33A 2F6JA 1WFKA 2VPBA 2K17A 4LK9A 4YBSA 2XB1A 5FEYA 5DKAA 4GNGA 2M6MA 4UI9B 3DPLR 3U5PA 4AYCA 2KYUA 2MT5A 2YURA 4S3OC 2CT2A 1WILA 4A0CD 2HYED 3DQVR 2LDRA 2H0DA 5H9MA 3M63A 2CKLA 2G45A 2ECTA 2EA6A 4I7DA 5TBNA 1V87A 2IDAA 2YSMA 1WEOA 3ZYQA 5B75A 1RMDA 4LKAA 4B86C 4W4UA 3HCUA 1VYXA 2ECWA 2F42A 3LQHA 5EYAF 2KREA 4P5OB 1U6GB 2KWJA 2ZETC 1WEUA 2Y1MA 2E6SA 5G05B 3FL2A 2LXPC 4YABA 5J3XA 2AN6A 3ZPVE 1LDJB 4PPEA 1WEWA 1FBVA 1WGMA 3ASLA 4XI1A 4AYCB 5H1TA 1BORA 3O34A 3KNVA 1T1HA 2H0DB 2YU4A 2CKLB 4GNEA 2VJFB 2YQLA 1WESA 5B78A 2KWNA 3N9MA 1MM3A 2HDPA 4UP0A 1Z6UA 5G04B 4TKPB 2K4DA 3NG2A 4C9ZA 2I50A 3SOXA 5AITA 3KV6A 2LQ6A 3T7LA 2RSDA 4LADB 5B79A 2RI7A 2JMJA 4GNDA 1MM2A 2ECGA 2ECIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTG A;  4BBQ A;  5C11 A;  2KWO A;  3L1Z B;  2NAA A;  2YSJ A;  1E4U A;  2G6Q A;  3HCT A;  2YQM A;  1DVP A;  2VPG A;  4GB0 A;  3RPG C;  4YAD A;  2ECN A;  2M85 A;  3ZVY A;  2EOD A;  1XWH A;  2FSA A;  5LKX A;  3L11 A;  2YRE A;  2LRI C;  2MNY A;  3V43 A;  2F6N A;  2MD8 C;  3QZV A;  1WE9 A;  4O64 A;  3N9N A;  1WEE A;  4S3O B;  1JM7 A;  1WEM A;  2YW8 A;  4QF2 A;  5TDR A;  5KH9 A;  2XEU A;  2K1J A;  5LKZ A;  1ZBD B;  3KQI A;  4ZDT A;  2C2L A;  3EB6 A;  3LQJ A;  2OXQ C;  2QIC A;  2KGI A;  4LLB A;  3C6W A;  2VP7 A;  5B77 A;  4YAT A;  5G0F A;  2Y43 A;  2JMI A;  1X4U A;  2MNZ A;  2KU3 A;  4WZ2 A;  3N9P A;  4AP4 A;  5TRB A;  2UZG A;  2LGK A;  2LN0 A;  2VPE A;  5LKU A;  4FO9 A;  3C5K A;  2YHO A;  5JG6 A;  2VPD A;  1JM7 B;  4CCG X;  4R7E A;  4UP5 A;  1Z60 A;  4YBM A;  3IHP A;  4WZ3 B;  1G25 A;  3M99 A;  3VK6 A;  2MA6 A;  3SOU A;  3I2D A;  4ZUX U;  2YT5 A;  3SOW A;  5I3L A;  2JRJ A;  2KGG A;  4B7Y C;  4YBT A;  2E6R A;  4I7C A;  2Y1N A;  1F62 A;  5D1K B;  5TDW A;  3MHH A;  1HYI A;  1CHC A;  4A4B A;  2ECJ A;  3ZPV 1;  4YAX A;  3U5O A;  3N9Q A;  5D1L B;  5LCW B;  2FUU A;  3LQI A;  4X3G A;  1LDK C;  3LRQ A;  2L5U A;  2YYR A;  5LKT A;  3HCS A;  2VNF A;  4MVT A;  4Q6F A;  3O70 A;  4R8P K;  4A49 A;  5B8D A;  5B76 A;  3O7A A;  2MD7 B;  4NN2 A;  4YC9 A;  4IC3 A;  2KIZ A;  2FUI A;  3N9L A;  2MA5 A;  2LGL A;  4F52 B;  2L80 A;  2LV9 A;  2PUY A;  2MIQ A;  2QJ0 A;  2L43 A;  4WA6 A;  4R2Y A;  2YUC A;  3RPG B;  4A4C A;  2CSY A;  2K16 A;  3T6R A;  4GNF A;  3U5M A;  1WEN A;  3O35 A;  5H1V A;  4I7B A;  2JMD A;  5H1U A;  2VJF A;  5FER A;  4V3K C;  4LJN A;  4FK5 A;  4AVX A;  3PHD A;  3KV5 A;  4WZ0 A;  1WIM A;  2KWK A;  4IC2 A;  3M62 A;  3MHS A;  3N9O A;  2D8S A;  1X4I A;  5AIU A;  5FB1 A;  5FB0 A;  5DIN A;  2KR4 A;  4V3L C;  2M3H A;  5KH7 A;  3GL6 A;  4CA1 A;  2LXH C;  2KE1 A;  2C2V S;  1FP0 A;  2MUM A;  4FJC A;  3L1X A;  2QIZ A;  1N87 A;  2YHN A;  3SHB A;  4BHW A;  5C13 A;  3HTK C;  1WEP A;  4AUQ B;  1IYM A;  2VJE A;  2L75 A;  3GV4 A;  4N3W A;  5D1M B;  3PUQ A;  1WEQ A;  4L7X A;  1JOC A;  1VD4 A;  1K2F A;  5KH3 A;  2L0B A;  2DX8 A;  2CSZ A;  2EGP A;  3RTR B;  2LGV A;  3EB5 A;  3O37 A;  2LGG A;  4QF3 A;  4N4F A;  4ZQL A;  2PNX A;  2KFT A;  3ZVZ B;  3U5N A;  4FIP A;  2BAY A;  1HYJ A;  4PTB A;  3ZNI A;  1VFY A;  2VJE B;  1WEV A;  4L58 A;  3PUR A;  4MSX A;  2ECV A;  5TAB A;  2M1R A;  1X4J A;  3O36 A;  1Z2Q A;  2G43 A;  3O33 A;  2F6J A;  1WFK A;  2VPB A;  2K17 A;  4LK9 A;  4YBS A;  2XB1 A;  5FEY A;  5DKA A;  4GNG A;  2M6M A;  4UI9 B;  3DPL R;  3U5P A;  4AYC A;  2KYU A;  2MT5 A;  2YUR A;  4S3O C;  2CT2 A;  1WIL A;  4A0C D;  2HYE D;  3DQV R;  2LDR A;  2H0D A;  5H9M A;  3M63 A;  2CKL A;  2G45 A;  2ECT A;  2EA6 A;  4I7D A;  5TBN A;  1V87 A;  2IDA A;  2YSM A;  1WEO A;  3ZYQ A;  5B75 A;  1RMD A;  4LKA A;  4B86 C;  4W4U A;  3HCU A;  1VYX A;  2ECW A;  2F42 A;  3LQH A;  5EYA F;  2KRE A;  4P5O B;  1U6G B;  2KWJ A;  2ZET C;  1WEU A;  2Y1M A;  2E6S A;  5G05 B;  3FL2 A;  2LXP C;  4YAB A;  5J3X A;  2AN6 A;  3ZPV E;  1LDJ B;  4PPE A;  1WEW A;  1FBV A;  1WGM A;  3ASL A;  4XI1 A;  4AYC B;  5H1T A;  1BOR A;  3O34 A;  3KNV A;  1T1H A;  2H0D B;  2YU4 A;  2CKL B;  4GNE A;  2VJF B;  2YQL A;  1WES A;  5B78 A;  2KWN A;  3N9M A;  1MM3 A;  2HDP A;  4UP0 A;  1Z6U A;  5G04 B;  4TKP B;  2K4D A;  3NG2 A;  4C9Z A;  2I50 A;  3SOX A;  5AIT A;  3KV6 A;  2LQ6 A;  3T7L A;  2RSD A;  4LAD B;  5B79 A;  2RI7 A;  2JMJ A;  4GND A;  1MM2 A;  2ECG A;  2ECI A; 
#chains in the Genus database with same CATH topology
 2JM3 A;  3ZTG A;  4BBQ A;  5C11 A;  2KWO A;  2EGM A;  4QQ4 A;  3L1Z B;  3FEH A;  2NAA A;  2YSJ A;  1E4U A;  2G6Q A;  2CRW A;  3HCT A;  3JUE A;  2YQM A;  1DVP A;  2VPG A;  4GB0 A;  3RPG C;  4YAD A;  2ECN A;  2EXU A;  2M85 A;  3ZVY A;  2EOD A;  1XWH A;  3FJU B;  2FSA A;  5LKX A;  5SVI A;  3L11 A;  2CON A;  2YRE A;  3LVR E;  2LRI C;  2MNY A;  3LDY A;  3V43 A;  2F6N A;  2MD8 C;  3O47 A;  3Q1D A;  3QZV A;  1WE9 A;  4O64 A;  3N9N A;  1WEE A;  4S3O B;  1JM7 A;  1WEM A;  2YW8 A;  4QF2 A;  5TDR A;  5KH9 A;  2XEU A;  2K1J A;  5LKZ A;  1ZBD B;  3KQI A;  4ZDT A;  2C2L A;  3EB6 A;  3LQJ A;  2OXQ C;  2JUN A;  2QIC A;  2KGI A;  4LLB A;  3C6W A;  2VP7 A;  5B77 A;  4YAT A;  5G0F A;  2Y43 A;  5SVI B;  2JMI A;  1X4U A;  2MNZ A;  2KU3 A;  4WZ2 A;  3N9P A;  3FAO A;  4AP4 A;  5TRB A;  2UZG A;  2LGK A;  2LN0 A;  2VPE A;  5LKU A;  4FO9 A;  3C5K A;  2YHO A;  2XOZ A;  5JG6 A;  2VPD A;  1JM7 B;  4CCG X;  4R7E A;  4Z0R A;  4UP5 A;  1Z60 A;  4YBM A;  3IHP A;  4WZ3 B;  1G25 A;  3M99 A;  3VK6 A;  2MA6 A;  3SOU A;  3I2D A;  4ZUX U;  2YT5 A;  3DDT A;  3SOW A;  5I3L A;  2JRJ A;  2KGG A;  3E2D A;  4B7Y C;  4YBT A;  2E6R A;  4I7C A;  2Y1N A;  1F62 A;  5D1K B;  5TDW A;  3MHH A;  1HYI A;  1CHC A;  4A4B A;  4OGC A;  2ECJ A;  3ZPV 1;  4YAX A;  3U5O A;  3N9Q A;  5D1L B;  5LCW B;  2FUU A;  3MDB C;  3LQI A;  4X3G A;  1LDK C;  3LRQ A;  2L5U A;  2YYR A;  5LKT A;  3HCS A;  2VNF A;  4MVT A;  5SVX A;  4Q6F A;  3O70 A;  4R8P K;  4A49 A;  2OWA A;  4O62 A;  5B8D A;  5B76 A;  3O7A A;  2DSM A;  2MD7 B;  4H9D A;  4NN2 A;  4YC9 A;  4IC3 A;  2KIZ A;  2FUI A;  3N9L A;  2MA5 A;  2LGL A;  3SUB A;  5K3Q A;  4F52 B;  2L80 A;  2LV9 A;  2PUY A;  2MIQ A;  2QJ0 A;  2L43 A;  3KDE C;  4WA6 A;  2CRR A;  4R2Y A;  2YUC A;  3RPG B;  4A4C A;  2CSY A;  2K16 A;  3T6R A;  4GNF A;  3U5M A;  1WEN A;  3O35 A;  5H1V A;  4I7B A;  2JMD A;  5H1U A;  2VJF A;  5FER A;  4V3K C;  4LJN A;  4FK5 A;  4AVX A;  2D8U A;  3PHD A;  3KV5 A;  4WZ0 A;  1WIM A;  2KWK A;  4IC2 A;  3FAN A;  4F1P A;  3M62 A;  3MHS A;  3N9O A;  1X4I A;  2D8S A;  5AIU A;  2FD4 A;  5FB1 A;  5FB0 A;  5DIN A;  2KR4 A;  4V3L C;  2M3H A;  5KH7 A;  3GL6 A;  4CA1 A;  2XOY A;  2LXH C;  2KE1 A;  3DWD A;  2C2V S;  1FP0 A;  2MUM A;  4FJC A;  3L1X A;  2MKE A;  2QIZ A;  1N87 A;  2YHN A;  3SHB A;  4BHW A;  5C13 A;  3HTK C;  2XP0 A;  1WEP A;  4AUQ B;  1IYM A;  2VJE A;  2L75 A;  3GV4 A;  4N3W A;  5D1M B;  3PUQ A;  1WEQ A;  4L7X A;  1JOC A;  1VD4 A;  1K2F A;  5KH3 A;  2L0B A;  2DX8 A;  2CSZ A;  2EGP A;  3RTR B;  2LGV A;  3EB5 A;  3O37 A;  2LGG A;  2XOC A;  4QF3 A;  4N4F A;  4ZQL A;  2PNX A;  2KFT A;  3ZVZ B;  3U5N A;  4FIP A;  2BAY A;  1HYJ A;  4PTB A;  2B0O E;  1DCQ A;  1VFY A;  3ZNI A;  2VJE B;  1WEV A;  4L58 A;  3PUR A;  4MSX A;  2ECV A;  2M1R A;  5TAB A;  1X4J A;  2KKX A;  1Z2Q A;  3O36 A;  2G43 A;  3O33 A;  2F6J A;  1WFK A;  2VPB A;  2K17 A;  4LK9 A;  4YBS A;  2XB1 A;  3FM8 C;  3LJU X;  5FEY A;  5DKA A;  4GNG A;  2LAU A;  2M6M A;  4OGE A;  4UI9 B;  3DPL R;  2M13 A;  3U5P A;  4AYC A;  2KYU A;  2MT5 A;  2YUR A;  4S3O C;  2CT2 A;  1WIL A;  5SVY A;  4A0C D;  2HYE D;  3DQV R;  2E61 A;  2LDR A;  2H0D A;  5H9M A;  3M63 A;  2CKL A;  2G45 A;  2ECT A;  2EA6 A;  4I7D A;  5TBN A;  1V87 A;  2IDA A;  2YSM A;  1WEO A;  3ZYQ A;  5B75 A;  1RMD A;  4LKA A;  4B86 C;  4W4U A;  3HCU A;  1VYX A;  2ECW A;  2F42 A;  3LQH A;  5EYA F;  3T9K A;  2YVR A;  2KRE A;  4P5O B;  1U6G B;  2KWJ A;  2ZET C;  1WEU A;  2Y1M A;  2E6S A;  2CSV A;  5G05 B;  3FL2 A;  2LXP C;  4YAB A;  2P57 A;  2L7P A;  5J3X A;  2AN6 A;  3ZPV E;  1LDJ B;  4PPE A;  1WEW A;  2DJA A;  1FBV A;  2KKY A;  1WGM A;  1MBM A;  3ASL A;  4XI1 A;  4AYC B;  5H1T A;  1BOR A;  3O34 A;  2IQJ A;  3KNV A;  1T1H A;  2H0D B;  2YU4 A;  2CKL B;  4GNE A;  2VJF B;  2YQL A;  1WES A;  5B78 A;  2KWN A;  2FFW A;  3N9M A;  1MM3 A;  2HDP A;  4UP0 A;  1Z6U A;  5G04 B;  4TKP B;  3LVQ E;  2K4D A;  3NG2 A;  4C9Z A;  2I50 A;  3SOX A;  3H7H A;  5AIT A;  2RR4 A;  4Z0O A;  3KV6 A;  2LQ6 A;  3T7L A;  2RSD A;  4LAD B;  5B79 A;  2RI7 A;  3M7K A;  2JMJ A;  4GND A;  1MM2 A;  2ECG A;  3PLW A;  2ECI A; 
#chains in the Genus database with same CATH homology
 3ZTG A;  4BBQ A;  5C11 A;  2KWO A;  3L1Z B;  2NAA A;  2YSJ A;  1E4U A;  2G6Q A;  3HCT A;  2YQM A;  1DVP A;  2VPG A;  4GB0 A;  3RPG C;  4YAD A;  2ECN A;  2M85 A;  3ZVY A;  2EOD A;  1XWH A;  2FSA A;  5LKX A;  3L11 A;  2YRE A;  2LRI C;  2MNY A;  3V43 A;  2F6N A;  2MD8 C;  3QZV A;  1WE9 A;  4O64 A;  3N9N A;  1WEE A;  4S3O B;  1JM7 A;  1WEM A;  2YW8 A;  4QF2 A;  5TDR A;  5KH9 A;  2XEU A;  2K1J A;  5LKZ A;  1ZBD B;  3KQI A;  4ZDT A;  2C2L A;  3EB6 A;  3LQJ A;  2OXQ C;  2QIC A;  2KGI A;  4LLB A;  3C6W A;  2VP7 A;  5B77 A;  4YAT A;  5G0F A;  2Y43 A;  2JMI A;  1X4U A;  2MNZ A;  2KU3 A;  4WZ2 A;  3N9P A;  4AP4 A;  5TRB A;  2UZG A;  2LGK A;  2LN0 A;  2VPE A;  5LKU A;  4FO9 A;  3C5K A;  2YHO A;  5JG6 A;  2VPD A;  1JM7 B;  4CCG X;  4R7E A;  4UP5 A;  1Z60 A;  4YBM A;  3IHP A;  4WZ3 B;  1G25 A;  3M99 A;  3VK6 A;  2MA6 A;  3SOU A;  3I2D A;  4ZUX U;  2YT5 A;  3SOW A;  5I3L A;  2JRJ A;  2KGG A;  4B7Y C;  4YBT A;  2E6R A;  4I7C A;  2Y1N A;  1F62 A;  5D1K B;  5TDW A;  3MHH A;  1HYI A;  1CHC A;  4A4B A;  2ECJ A;  3ZPV 1;  4YAX A;  3U5O A;  3N9Q A;  5D1L B;  5LCW B;  2FUU A;  3LQI A;  4X3G A;  1LDK C;  3LRQ A;  2L5U A;  2YYR A;  5LKT A;  3HCS A;  2VNF A;  4MVT A;  4Q6F A;  3O70 A;  4R8P K;  4A49 A;  5B8D A;  5B76 A;  3O7A A;  2MD7 B;  4NN2 A;  4YC9 A;  4IC3 A;  2KIZ A;  2FUI A;  3N9L A;  2MA5 A;  2LGL A;  4F52 B;  2L80 A;  2LV9 A;  2PUY A;  2MIQ A;  2QJ0 A;  2L43 A;  4WA6 A;  4R2Y A;  2YUC A;  3RPG B;  4A4C A;  2CSY A;  2K16 A;  3T6R A;  4GNF A;  3U5M A;  1WEN A;  3O35 A;  5H1V A;  4I7B A;  2JMD A;  5H1U A;  2VJF A;  5FER A;  4V3K C;  4LJN A;  4FK5 A;  4AVX A;  3PHD A;  3KV5 A;  4WZ0 A;  1WIM A;  2KWK A;  4IC2 A;  3M62 A;  3MHS A;  3N9O A;  2D8S A;  1X4I A;  5AIU A;  5FB1 A;  5FB0 A;  5DIN A;  2KR4 A;  4V3L C;  2M3H A;  5KH7 A;  3GL6 A;  4CA1 A;  2LXH C;  2KE1 A;  2C2V S;  1FP0 A;  2MUM A;  4FJC A;  3L1X A;  2QIZ A;  1N87 A;  2YHN A;  3SHB A;  4BHW A;  5C13 A;  3HTK C;  1WEP A;  4AUQ B;  1IYM A;  2VJE A;  2L75 A;  3GV4 A;  4N3W A;  5D1M B;  3PUQ A;  1WEQ A;  4L7X A;  1JOC A;  1VD4 A;  1K2F A;  5KH3 A;  2L0B A;  2DX8 A;  2CSZ A;  2EGP A;  3RTR B;  2LGV A;  3EB5 A;  3O37 A;  2LGG A;  4QF3 A;  4N4F A;  4ZQL A;  2PNX A;  2KFT A;  3ZVZ B;  3U5N A;  4FIP A;  2BAY A;  1HYJ A;  4PTB A;  3ZNI A;  1VFY A;  2VJE B;  1WEV A;  4L58 A;  3PUR A;  4MSX A;  2ECV A;  5TAB A;  2M1R A;  1X4J A;  3O36 A;  1Z2Q A;  2G43 A;  3O33 A;  2F6J A;  1WFK A;  2VPB A;  2K17 A;  4LK9 A;  4YBS A;  2XB1 A;  5FEY A;  5DKA A;  4GNG A;  2M6M A;  4UI9 B;  3DPL R;  3U5P A;  4AYC A;  2KYU A;  2MT5 A;  2YUR A;  4S3O C;  2CT2 A;  1WIL A;  4A0C D;  2HYE D;  3DQV R;  2LDR A;  2H0D A;  5H9M A;  3M63 A;  2CKL A;  2G45 A;  2ECT A;  2EA6 A;  4I7D A;  5TBN A;  1V87 A;  2IDA A;  2YSM A;  1WEO A;  3ZYQ A;  5B75 A;  1RMD A;  4LKA A;  4B86 C;  4W4U A;  3HCU A;  1VYX A;  2ECW A;  2F42 A;  3LQH A;  5EYA F;  2KRE A;  4P5O B;  1U6G B;  2KWJ A;  2ZET C;  1WEU A;  2Y1M A;  2E6S A;  5G05 B;  3FL2 A;  2LXP C;  4YAB A;  5J3X A;  2AN6 A;  3ZPV E;  1LDJ B;  4PPE A;  1WEW A;  1FBV A;  1WGM A;  3ASL A;  4XI1 A;  4AYC B;  5H1T A;  1BOR A;  3O34 A;  3KNV A;  1T1H A;  2H0D B;  2YU4 A;  2CKL B;  4GNE A;  2VJF B;  2YQL A;  1WES A;  5B78 A;  2KWN A;  3N9M A;  1MM3 A;  2HDP A;  4UP0 A;  1Z6U A;  5G04 B;  4TKP B;  2K4D A;  3NG2 A;  4C9Z A;  2I50 A;  3SOX A;  5AIT A;  3KV6 A;  2LQ6 A;  3T7L A;  2RSD A;  4LAD B;  5B79 A;  2RI7 A;  2JMJ A;  4GND A;  1MM2 A;  2ECG A;  2ECI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...