5G05B

Cryo-em structure of combined apo phosphorylated apc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g05B00
4LLBA 5D1LB 3O33A 2F6NA 4YAXA 4R8PK 2LQ6A 4CCGX 1JM7A 2LXPC 2VJEA 2C2LA 4YABA 1WEMA 3C6WA 1WESA 2H0DA 3DPLR 1HYJA 4AYCB 2KWJA 4MSXA 5FB1A 3L1ZB 2KWOA 2LXHC 2YURA 1LDJB 5DINA 5TABA 2XEUA 2E6RA 4WZ2A 5B76A 3U5PA 2C2VS 5B78A 5H1VA 1Z2QA 2IDAA 5FB0A 5D1KB 5B79A 3N9NA 1JOCA 4YATA 4FK5A 3ZVYA 1RMDA 4WZ3B 5KH9A 2KR4A 2ECNA 5DKAA 4XI1A 5TRBA 1Z6UA 2YUCA 2CT2A 4LK9A 2UZGA 1WFKA 1CHCA 2L5UA 2NAAA 2KU3A 4S3OB 3ASLA 4AYCA 5KH7A 1WGMA 3U5OA 2MA5A 4CA1A 4ZUXU 1WEUA 1JM7B 2PNXA 2CKLB 2EA6A 1N87A 2H0DB 1E4UA 4IC2A 1VYXA 1Z60A 2E6SA 3HCSA 5LCWB 1WEPA 4TKPB 4GNEA 2VPBA 3RPGB 5G04B 4V3KC 1VD4A 3LQHA 2ECIA 4QF2A 2VJFB 4YBTA 4I7CA 4MVTA 1BORA 2Y1NA 4WZ0A 3U5MA 1DVPA 2QJ0A 3L11A 4GNDA 2VPEA 4R2YA 5H1UA 5J3XA 2F6JA 2LRIC 3KV5A 2JMDA 2YHOA 2G6QA 4A49A 5D1MB 1WEWA 4BBQA 4AUQB 4GNFA 4ZDTA 3EB5A 1WE9A 3KNVA 5FERA 3M63A 2KGIA 3LRQA 2LDRA 4YC9A 2L80A 1XWHA 2VJFA 3GL6A 2VPGA 4F52B 1WEEA 2F42A 2QIZA 2YT5A 4LKAA 3N9PA 5LKXA 2Y43A 3U5NA 2MT5A 2ZETC 5B77A 3ZPVE 2EODA 4W4UA 1FBVA 3SOWA 5FEYA 2LV9A 2DX8A 2JRJA 4N4FA 4YBSA 1VFYA 2YYRA 2HDPA 5TDWA 1V87A 2ECGA 3ZTGA 3ZNIA 4FO9A 1MM2A 4N3WA 4UI9B 2M85A 2YSJA 2YQLA 4YBMA 3T6RA 1WEVA 3M99A 3T7LA 5G05B 2G43A 5LKZA 3HTKC 4L7XA 2BAYA 5I3LA 2KWKA 4L58A 2K1JA 4UP0A 5EYAF 2FUUA 2CSZA 4FJCA 3PUQA 4LJNA 4NN2A 3PURA 2K17A 1MM3A 1X4IA 2JMIA 4A4BA 2MA6A 3I2DA 3N9OA 2AN6A 2MUMA 2ECVA 3LQIA 2D8SA 2L0BA 2YW8A 3O34A 3KQIA 1WILA 2YHNA 1K2FA 2LGLA 3VK6A 2FSAA 3C5KA 3O37A 3HCTA 3N9QA 3ZVZB 3MHSA 2LGVA 4I7BA 4V3LC 3O35A 4UP5A 4GNGA 2KREA 4A4CA 2YQMA 3O7AA 5LKTA 2YU4A 4P5OB 3RTRB 2QICA 3SOXA 5KH3A 1ZBDB 2KWNA 2KFTA 4X3GA 5JG6A 3PHDA 4WA6A 2L43A 2I50A 4O64A 1F62A 3L1XA 5LKUA 2MD8C 2MD7B 3NG2A 5C11A 1HYIA 1WEOA 5B75A 2MNYA 3EB6A 1FP0A 2LGGA 2MIQA 2VJEB 1IYMA 3ZPV1 4A0CD 3MHHA 3QZVA 2VNFA 4B86C 4I7DA 4ZQLA 5TBNA 3RPGC 4BHWA 3V43A 5AITA 4B7YC 5H1TA 5C13A 2KYUA 2ECTA 2RI7A 2K4DA 2ECWA 3LQJA 5TDRA 4PTBA 1WIMA 2M3HA 2LN0A 2KGGA 3O70A 4LADB 2HYED 2YSMA 3SOUA 4IC3A 4S3OC 1X4JA 3ZYQA 3N9MA 2M1RA 2K16A 2G45A 1U6GB 5B8DA 3GV4A 2MNZA 2JMJA 3N9LA 2KIZA 2VPDA 2LGKA 1LDKC 3FL2A 5H9MA 2EGPA 4PPEA 3KV6A 4AP4A 2Y1MA 2YREA 4QF3A 1WEQA 3M62A 1X4UA 2RSDA 2KE1A 1G25A 4C9ZA 1T1HA 4AVXA 4Q6FA 3DQVR 2L75A 3IHPA 2PUYA 5G0FA 2OXQC 1WENA 2CKLA 3O36A 2ECJA 2M6MA 3SHBA 4FIPA 4YADA 3HCUA 2FUIA 5AIUA 2XB1A 2VP7A 4R7EA 4GB0A 2CSYA
chains in the Genus database with same CATH superfamily
4LLBA 5D1LB 3O33A 2F6NA 4YAXA 4R8PK 2LQ6A 4CCGX 1JM7A 2LXPC 2VJEA 2C2LA 4YABA 1WEMA 3C6WA 1WESA 2H0DA 3DPLR 1HYJA 4AYCB 2KWJA 4MSXA 5FB1A 3L1ZB 2KWOA 2LXHC 2YURA 5SVXA 1LDJB 5DINA 5TABA 2XEUA 2E6RA 4WZ2A 5B76A 3LJUX 2KKXA 3U5PA 2C2VS 5B78A 5H1VA 1Z2QA 2IDAA 5FB0A 5D1KB 5SVIB 5B79A 3N9NA 1JOCA 4YATA 4FK5A 3ZVYA 1RMDA 4WZ3B 5KH9A 2KR4A 2ECNA 5DKAA 4XI1A 5TRBA 1Z6UA 2YUCA 2CT2A 4LK9A 2UZGA 1WFKA 1CHCA 2L5UA 2NAAA 2KU3A 4S3OB 3ASLA 4AYCA 5KH7A 4Z0RA 1WGMA 3U5OA 2MA5A 4CA1A 4ZUXU 1WEUA 1JM7B 2PNXA 2CKLB 2EA6A 2IQJA 1N87A 2H0DB 1E4UA 4IC2A 1VYXA 1Z60A 2E6SA 3HCSA 5LCWB 1WEPA 4TKPB 4GNEA 2VPBA 3RPGB 2KKYA 5G04B 4V3KC 3DWDA 1VD4A 3LQHA 2ECIA 4QF2A 2VJFB 4YBTA 4I7CA 1MBMA 2XOZA 2FD4A 4MVTA 1BORA 2L7PA 2Y1NA 4WZ0A 3U5MA 1DVPA 2QJ0A 4OGCA 3L11A 2E61A 3FANA 2MKEA 4GNDA 2VPEA 4Z0OA 4R2YA 5H1UA 5J3XA 2F6JA 2LRIC 3KV5A 2JMDA 2YHOA 2G6QA 4A49A 2JM3A 5D1MB 1WEWA 4BBQA 2CSVA 4AUQB 4GNFA 4ZDTA 3EB5A 1WE9A 3KNVA 5FERA 3M63A 2XOCA 3H7HA 2KGIA 3LRQA 2LDRA 4YC9A 2L80A 1XWHA 2VJFA 3GL6A 2VPGA 4F52B 3MDBC 1WEEA 2F42A 2QIZA 2YT5A 4LKAA 3N9PA 5K3QA 3DDTA 5LKXA 2Y43A 3U5NA 2MT5A 3E2DA 2ZETC 5B77A 3ZPVE 2EODA 3PLWA 4W4UA 1FBVA 3SOWA 5FEYA 2LV9A 2DX8A 2JRJA 4N4FA 3T9KA 4YBSA 1VFYA 2YYRA 3LVQE 4OGEA 2HDPA 5TDWA 1V87A 2ECGA 3ZTGA 4F1PA 3ZNIA 4FO9A 1MM2A 4N3WA 4UI9B 2M85A 2YSJA 2YQLA 4YBMA 3T6RA 1WEVA 3M99A 3T7LA 5G05B 2G43A 5LKZA 3JUEA 3HTKC 2EXUA 2BAYA 4L7XA 5I3LA 2KWKA 4L58A 2K1JA 4UP0A 5EYAF 2CONA 2FUUA 2JUNA 2XP0A 1DCQA 2CSZA 2YVRA 4FJCA 3PUQA 4LJNA 4NN2A 3PURA 2K17A 3M7KA 1MM3A 1X4IA 3Q1DA 4H9DA 2JMIA 4A4BA 2MA6A 3I2DA 3N9OA 2AN6A 2MUMA 2ECVA 3LQIA 2D8SA 2L0BA 2YW8A 3O34A 3KQIA 1WILA 2YHNA 1K2FA 2LGLA 3VK6A 2FSAA 3C5KA 3O37A 3HCTA 3N9QA 4O62A 3ZVZB 3MHSA 2LGVA 2RR4A 2EGMA 4I7BA 4V3LC 2FFWA 3O35A 4UP5A 4GNGA 2KREA 4A4CA 2YQMA 2OWAA 3O7AA 2P57A 5LKTA 2YU4A 4P5OB 3RTRB 2QICA 3SOXA 5SVIA 5KH3A 1ZBDB 2KWNA 2KFTA 4X3GA 2M13A 5JG6A 3PHDA 3LDYA 2DSMA 4WA6A 2L43A 2I50A 4O64A 1F62A 3L1XA 5LKUA 2MD8C 2MD7B 3NG2A 5C11A 1HYIA 1WEOA 5B75A 2DJAA 5SVYA 2MNYA 3SUBA 3EB6A 1FP0A 2LGGA 2MIQA 2VJEB 2B0OE 1IYMA 3ZPV1 4A0CD 3MHHA 3QZVA 2VNFA 4B86C 4I7DA 4ZQLA 2CRRA 5TBNA 3FEHA 3RPGC 4BHWA 3V43A 5AITA 4B7YC 5H1TA 5C13A 2KYUA 2ECTA 2RI7A 2K4DA 2ECWA 3LQJA 5TDRA 4PTBA 1WIMA 2M3HA 2LN0A 2KGGA 3O70A 4LADB 2CRWA 2HYED 2YSMA 3SOUA 4IC3A 3KDEC 4S3OC 1X4JA 3ZYQA 3N9MA 2M1RA 2K16A 2G45A 1U6GB 5B8DA 3GV4A 2MNZA 2JMJA 3FM8C 3N9LA 2D8UA 2KIZA 3FJUB 2XOYA 2VPDA 2LGKA 1LDKC 3FL2A 5H9MA 2LAUA 2EGPA 3FAOA 4PPEA 3KV6A 4AP4A 2Y1MA 2YREA 4QF3A 1WEQA 3M62A 1X4UA 2RSDA 2KE1A 1G25A 4C9ZA 1T1HA 4AVXA 4Q6FA 3DQVR 4QQ4A 2L75A 3IHPA 2PUYA 5G0FA 2OXQC 1WENA 2CKLA 3O47A 3O36A 2ECJA 2M6MA 3SHBA 4FIPA 4YADA 3HCUA 2FUIA 5AIUA 3LVRE 2XB1A 2VP7A 4R7EA 4GB0A 2CSYA
chains in the Genus database with same CATH topology
4LLBA 5D1LB 3O33A 2F6NA 4YAXA 4R8PK 2LQ6A 4CCGX 1JM7A 2LXPC 2VJEA 2C2LA 4YABA 1WEMA 3C6WA 1WESA 2H0DA 3DPLR 1HYJA 4AYCB 2KWJA 4MSXA 5FB1A 3L1ZB 2KWOA 2LXHC 2YURA 1LDJB 5DINA 5TABA 2XEUA 2E6RA 4WZ2A 5B76A 3U5PA 2C2VS 5B78A 5H1VA 1Z2QA 2IDAA 5FB0A 5D1KB 5B79A 3N9NA 1JOCA 4YATA 4FK5A 3ZVYA 1RMDA 4WZ3B 5KH9A 2KR4A 2ECNA 5DKAA 4XI1A 5TRBA 1Z6UA 2YUCA 2CT2A 4LK9A 2UZGA 1WFKA 1CHCA 2L5UA 2NAAA 2KU3A 4S3OB 3ASLA 4AYCA 5KH7A 1WGMA 3U5OA 2MA5A 4CA1A 4ZUXU 1WEUA 1JM7B 2PNXA 2CKLB 2EA6A 1N87A 2H0DB 1E4UA 4IC2A 1VYXA 1Z60A 2E6SA 3HCSA 5LCWB 1WEPA 4TKPB 4GNEA 2VPBA 3RPGB 5G04B 4V3KC 1VD4A 3LQHA 2ECIA 4QF2A 2VJFB 4YBTA 4I7CA 4MVTA 1BORA 2Y1NA 4WZ0A 3U5MA 1DVPA 2QJ0A 3L11A 4GNDA 2VPEA 4R2YA 5H1UA 5J3XA 2F6JA 2LRIC 3KV5A 2JMDA 2YHOA 2G6QA 4A49A 5D1MB 1WEWA 4BBQA 4AUQB 4GNFA 4ZDTA 3EB5A 1WE9A 3KNVA 5FERA 3M63A 2KGIA 3LRQA 2LDRA 4YC9A 2L80A 1XWHA 2VJFA 3GL6A 2VPGA 4F52B 1WEEA 2F42A 2QIZA 2YT5A 4LKAA 3N9PA 5LKXA 2Y43A 3U5NA 2MT5A 2ZETC 5B77A 3ZPVE 2EODA 4W4UA 1FBVA 3SOWA 5FEYA 2LV9A 2DX8A 2JRJA 4N4FA 4YBSA 1VFYA 2YYRA 2HDPA 5TDWA 1V87A 2ECGA 3ZTGA 3ZNIA 4FO9A 1MM2A 4N3WA 4UI9B 2M85A 2YSJA 2YQLA 4YBMA 3T6RA 1WEVA 3M99A 3T7LA 5G05B 2G43A 5LKZA 3HTKC 4L7XA 2BAYA 5I3LA 2KWKA 4L58A 2K1JA 4UP0A 5EYAF 2FUUA 2CSZA 4FJCA 3PUQA 4LJNA 4NN2A 3PURA 2K17A 1MM3A 1X4IA 2JMIA 4A4BA 2MA6A 3I2DA 3N9OA 2AN6A 2MUMA 2ECVA 3LQIA 2D8SA 2L0BA 2YW8A 3O34A 3KQIA 1WILA 2YHNA 1K2FA 2LGLA 3VK6A 2FSAA 3C5KA 3O37A 3HCTA 3N9QA 3ZVZB 3MHSA 2LGVA 4I7BA 4V3LC 3O35A 4UP5A 4GNGA 2KREA 4A4CA 2YQMA 3O7AA 5LKTA 2YU4A 4P5OB 3RTRB 2QICA 3SOXA 5KH3A 1ZBDB 2KWNA 2KFTA 4X3GA 5JG6A 3PHDA 4WA6A 2L43A 2I50A 4O64A 1F62A 3L1XA 5LKUA 2MD8C 2MD7B 3NG2A 5C11A 1HYIA 1WEOA 5B75A 2MNYA 3EB6A 1FP0A 2LGGA 2MIQA 2VJEB 1IYMA 3ZPV1 4A0CD 3MHHA 3QZVA 2VNFA 4B86C 4I7DA 4ZQLA 5TBNA 3RPGC 4BHWA 3V43A 5AITA 4B7YC 5H1TA 5C13A 2KYUA 2ECTA 2RI7A 2K4DA 2ECWA 3LQJA 5TDRA 4PTBA 1WIMA 2M3HA 2LN0A 2KGGA 3O70A 4LADB 2HYED 2YSMA 3SOUA 4IC3A 4S3OC 1X4JA 3ZYQA 3N9MA 2M1RA 2K16A 2G45A 1U6GB 5B8DA 3GV4A 2MNZA 2JMJA 3N9LA 2KIZA 2VPDA 2LGKA 1LDKC 3FL2A 5H9MA 2EGPA 4PPEA 3KV6A 4AP4A 2Y1MA 2YREA 4QF3A 1WEQA 3M62A 1X4UA 2RSDA 2KE1A 1G25A 4C9ZA 1T1HA 4AVXA 4Q6FA 3DQVR 2L75A 3IHPA 2PUYA 5G0FA 2OXQC 1WENA 2CKLA 3O36A 2ECJA 2M6MA 3SHBA 4FIPA 4YADA 3HCUA 2FUIA 5AIUA 2XB1A 2VP7A 4R7EA 4GB0A 2CSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLB A;  5D1L B;  3O33 A;  2F6N A;  4YAX A;  4R8P K;  2LQ6 A;  4CCG X;  1JM7 A;  2LXP C;  2VJE A;  2C2L A;  4YAB A;  1WEM A;  3C6W A;  1WES A;  2H0D A;  3DPL R;  1HYJ A;  4AYC B;  2KWJ A;  4MSX A;  5FB1 A;  3L1Z B;  2KWO A;  2LXH C;  2YUR A;  1LDJ B;  5DIN A;  5TAB A;  2XEU A;  2E6R A;  4WZ2 A;  5B76 A;  3U5P A;  2C2V S;  5B78 A;  5H1V A;  1Z2Q A;  2IDA A;  5FB0 A;  5D1K B;  5B79 A;  3N9N A;  1JOC A;  4YAT A;  4FK5 A;  3ZVY A;  1RMD A;  4WZ3 B;  5KH9 A;  2KR4 A;  2ECN A;  5DKA A;  4XI1 A;  5TRB A;  1Z6U A;  2YUC A;  2CT2 A;  4LK9 A;  2UZG A;  1WFK A;  1CHC A;  2L5U A;  2NAA A;  2KU3 A;  4S3O B;  3ASL A;  4AYC A;  5KH7 A;  1WGM A;  3U5O A;  2MA5 A;  4CA1 A;  4ZUX U;  1WEU A;  1JM7 B;  2PNX A;  2CKL B;  2EA6 A;  1N87 A;  2H0D B;  1E4U A;  4IC2 A;  1VYX A;  1Z60 A;  2E6S A;  3HCS A;  5LCW B;  1WEP A;  4TKP B;  4GNE A;  2VPB A;  3RPG B;  5G04 B;  4V3K C;  1VD4 A;  3LQH A;  2ECI A;  4QF2 A;  2VJF B;  4YBT A;  4I7C A;  4MVT A;  1BOR A;  2Y1N A;  4WZ0 A;  3U5M A;  1DVP A;  2QJ0 A;  3L11 A;  4GND A;  2VPE A;  4R2Y A;  5H1U A;  5J3X A;  2F6J A;  2LRI C;  3KV5 A;  2JMD A;  2YHO A;  2G6Q A;  4A49 A;  5D1M B;  1WEW A;  4BBQ A;  4AUQ B;  4GNF A;  4ZDT A;  3EB5 A;  1WE9 A;  3KNV A;  5FER A;  3M63 A;  2KGI A;  3LRQ A;  2LDR A;  4YC9 A;  2L80 A;  1XWH A;  2VJF A;  3GL6 A;  2VPG A;  4F52 B;  1WEE A;  2F42 A;  2QIZ A;  2YT5 A;  4LKA A;  3N9P A;  5LKX A;  2Y43 A;  3U5N A;  2MT5 A;  2ZET C;  5B77 A;  3ZPV E;  2EOD A;  4W4U A;  1FBV A;  3SOW A;  5FEY A;  2LV9 A;  2DX8 A;  2JRJ A;  4N4F A;  4YBS A;  1VFY A;  2YYR A;  2HDP A;  5TDW A;  1V87 A;  2ECG A;  3ZTG A;  3ZNI A;  4FO9 A;  1MM2 A;  4N3W A;  4UI9 B;  2M85 A;  2YSJ A;  2YQL A;  4YBM A;  3T6R A;  1WEV A;  3M99 A;  3T7L A;  5G05 B;  2G43 A;  5LKZ A;  3HTK C;  4L7X A;  2BAY A;  5I3L A;  2KWK A;  4L58 A;  2K1J A;  4UP0 A;  5EYA F;  2FUU A;  2CSZ A;  4FJC A;  3PUQ A;  4LJN A;  4NN2 A;  3PUR A;  2K17 A;  1MM3 A;  1X4I A;  2JMI A;  4A4B A;  2MA6 A;  3I2D A;  3N9O A;  2AN6 A;  2MUM A;  2ECV A;  3LQI A;  2D8S A;  2L0B A;  2YW8 A;  3O34 A;  3KQI A;  1WIL A;  2YHN A;  1K2F A;  2LGL A;  3VK6 A;  2FSA A;  3C5K A;  3O37 A;  3HCT A;  3N9Q A;  3ZVZ B;  3MHS A;  2LGV A;  4I7B A;  4V3L C;  3O35 A;  4UP5 A;  4GNG A;  2KRE A;  4A4C A;  2YQM A;  3O7A A;  5LKT A;  2YU4 A;  4P5O B;  3RTR B;  2QIC A;  3SOX A;  5KH3 A;  1ZBD B;  2KWN A;  2KFT A;  4X3G A;  5JG6 A;  3PHD A;  4WA6 A;  2L43 A;  2I50 A;  4O64 A;  1F62 A;  3L1X A;  5LKU A;  2MD8 C;  2MD7 B;  3NG2 A;  5C11 A;  1HYI A;  1WEO A;  5B75 A;  2MNY A;  3EB6 A;  1FP0 A;  2LGG A;  2MIQ A;  2VJE B;  1IYM A;  3ZPV 1;  4A0C D;  3MHH A;  3QZV A;  2VNF A;  4B86 C;  4I7D A;  4ZQL A;  5TBN A;  3RPG C;  4BHW A;  3V43 A;  5AIT A;  4B7Y C;  5H1T A;  5C13 A;  2KYU A;  2ECT A;  2RI7 A;  2K4D A;  2ECW A;  3LQJ A;  5TDR A;  4PTB A;  1WIM A;  2M3H A;  2LN0 A;  2KGG A;  3O70 A;  4LAD B;  2HYE D;  2YSM A;  3SOU A;  4IC3 A;  4S3O C;  1X4J A;  3ZYQ A;  3N9M A;  2M1R A;  2K16 A;  2G45 A;  1U6G B;  5B8D A;  3GV4 A;  2MNZ A;  2JMJ A;  3N9L A;  2KIZ A;  2VPD A;  2LGK A;  1LDK C;  3FL2 A;  5H9M A;  2EGP A;  4PPE A;  3KV6 A;  4AP4 A;  2Y1M A;  2YRE A;  4QF3 A;  1WEQ A;  3M62 A;  1X4U A;  2RSD A;  2KE1 A;  1G25 A;  4C9Z A;  1T1H A;  4AVX A;  4Q6F A;  3DQV R;  2L75 A;  3IHP A;  2PUY A;  5G0F A;  2OXQ C;  1WEN A;  2CKL A;  3O36 A;  2ECJ A;  2M6M A;  3SHB A;  4FIP A;  4YAD A;  3HCU A;  2FUI A;  5AIU A;  2XB1 A;  2VP7 A;  4R7E A;  4GB0 A;  2CSY A; 
#chains in the Genus database with same CATH topology
 4LLB A;  5D1L B;  3O33 A;  2F6N A;  4YAX A;  4R8P K;  2LQ6 A;  4CCG X;  1JM7 A;  2LXP C;  2VJE A;  2C2L A;  4YAB A;  1WEM A;  3C6W A;  1WES A;  2H0D A;  3DPL R;  1HYJ A;  4AYC B;  2KWJ A;  4MSX A;  5FB1 A;  3L1Z B;  2KWO A;  2LXH C;  2YUR A;  5SVX A;  1LDJ B;  5DIN A;  5TAB A;  2XEU A;  2E6R A;  4WZ2 A;  5B76 A;  3LJU X;  2KKX A;  3U5P A;  2C2V S;  5B78 A;  5H1V A;  1Z2Q A;  2IDA A;  5FB0 A;  5D1K B;  5SVI B;  5B79 A;  3N9N A;  1JOC A;  4YAT A;  4FK5 A;  3ZVY A;  1RMD A;  4WZ3 B;  5KH9 A;  2KR4 A;  2ECN A;  5DKA A;  4XI1 A;  5TRB A;  1Z6U A;  2YUC A;  2CT2 A;  4LK9 A;  2UZG A;  1WFK A;  1CHC A;  2L5U A;  2NAA A;  2KU3 A;  4S3O B;  3ASL A;  4AYC A;  5KH7 A;  4Z0R A;  1WGM A;  3U5O A;  2MA5 A;  4CA1 A;  4ZUX U;  1WEU A;  1JM7 B;  2PNX A;  2CKL B;  2EA6 A;  2IQJ A;  1N87 A;  2H0D B;  1E4U A;  4IC2 A;  1VYX A;  1Z60 A;  2E6S A;  3HCS A;  5LCW B;  1WEP A;  4TKP B;  4GNE A;  2VPB A;  3RPG B;  2KKY A;  5G04 B;  4V3K C;  3DWD A;  1VD4 A;  3LQH A;  2ECI A;  4QF2 A;  2VJF B;  4YBT A;  4I7C A;  1MBM A;  2XOZ A;  2FD4 A;  4MVT A;  1BOR A;  2L7P A;  2Y1N A;  4WZ0 A;  3U5M A;  1DVP A;  2QJ0 A;  4OGC A;  3L11 A;  2E61 A;  3FAN A;  2MKE A;  4GND A;  2VPE A;  4Z0O A;  4R2Y A;  5H1U A;  5J3X A;  2F6J A;  2LRI C;  3KV5 A;  2JMD A;  2YHO A;  2G6Q A;  4A49 A;  2JM3 A;  5D1M B;  1WEW A;  4BBQ A;  2CSV A;  4AUQ B;  4GNF A;  4ZDT A;  3EB5 A;  1WE9 A;  3KNV A;  5FER A;  3M63 A;  2XOC A;  3H7H A;  2KGI A;  3LRQ A;  2LDR A;  4YC9 A;  2L80 A;  1XWH A;  2VJF A;  3GL6 A;  2VPG A;  4F52 B;  3MDB C;  1WEE A;  2F42 A;  2QIZ A;  2YT5 A;  4LKA A;  3N9P A;  5K3Q A;  3DDT A;  5LKX A;  2Y43 A;  3U5N A;  2MT5 A;  3E2D A;  2ZET C;  5B77 A;  3ZPV E;  2EOD A;  3PLW A;  4W4U A;  1FBV A;  3SOW A;  5FEY A;  2LV9 A;  2DX8 A;  2JRJ A;  4N4F A;  3T9K A;  4YBS A;  1VFY A;  2YYR A;  3LVQ E;  4OGE A;  2HDP A;  5TDW A;  1V87 A;  2ECG A;  3ZTG A;  4F1P A;  3ZNI A;  4FO9 A;  1MM2 A;  4N3W A;  4UI9 B;  2M85 A;  2YSJ A;  2YQL A;  4YBM A;  3T6R A;  1WEV A;  3M99 A;  3T7L A;  5G05 B;  2G43 A;  5LKZ A;  3JUE A;  3HTK C;  2EXU A;  2BAY A;  4L7X A;  5I3L A;  2KWK A;  4L58 A;  2K1J A;  4UP0 A;  5EYA F;  2CON A;  2FUU A;  2JUN A;  2XP0 A;  1DCQ A;  2CSZ A;  2YVR A;  4FJC A;  3PUQ A;  4LJN A;  4NN2 A;  3PUR A;  2K17 A;  3M7K A;  1MM3 A;  1X4I A;  3Q1D A;  4H9D A;  2JMI A;  4A4B A;  2MA6 A;  3I2D A;  3N9O A;  2AN6 A;  2MUM A;  2ECV A;  3LQI A;  2D8S A;  2L0B A;  2YW8 A;  3O34 A;  3KQI A;  1WIL A;  2YHN A;  1K2F A;  2LGL A;  3VK6 A;  2FSA A;  3C5K A;  3O37 A;  3HCT A;  3N9Q A;  4O62 A;  3ZVZ B;  3MHS A;  2LGV A;  2RR4 A;  2EGM A;  4I7B A;  4V3L C;  2FFW A;  3O35 A;  4UP5 A;  4GNG A;  2KRE A;  4A4C A;  2YQM A;  2OWA A;  3O7A A;  2P57 A;  5LKT A;  2YU4 A;  4P5O B;  3RTR B;  2QIC A;  3SOX A;  5SVI A;  5KH3 A;  1ZBD B;  2KWN A;  2KFT A;  4X3G A;  2M13 A;  5JG6 A;  3PHD A;  3LDY A;  2DSM A;  4WA6 A;  2L43 A;  2I50 A;  4O64 A;  1F62 A;  3L1X A;  5LKU A;  2MD8 C;  2MD7 B;  3NG2 A;  5C11 A;  1HYI A;  1WEO A;  5B75 A;  2DJA A;  5SVY A;  2MNY A;  3SUB A;  3EB6 A;  1FP0 A;  2LGG A;  2MIQ A;  2VJE B;  2B0O E;  1IYM A;  3ZPV 1;  4A0C D;  3MHH A;  3QZV A;  2VNF A;  4B86 C;  4I7D A;  4ZQL A;  2CRR A;  5TBN A;  3FEH A;  3RPG C;  4BHW A;  3V43 A;  5AIT A;  4B7Y C;  5H1T A;  5C13 A;  2KYU A;  2ECT A;  2RI7 A;  2K4D A;  2ECW A;  3LQJ A;  5TDR A;  4PTB A;  1WIM A;  2M3H A;  2LN0 A;  2KGG A;  3O70 A;  4LAD B;  2CRW A;  2HYE D;  2YSM A;  3SOU A;  4IC3 A;  3KDE C;  4S3O C;  1X4J A;  3ZYQ A;  3N9M A;  2M1R A;  2K16 A;  2G45 A;  1U6G B;  5B8D A;  3GV4 A;  2MNZ A;  2JMJ A;  3FM8 C;  3N9L A;  2D8U A;  2KIZ A;  3FJU B;  2XOY A;  2VPD A;  2LGK A;  1LDK C;  3FL2 A;  5H9M A;  2LAU A;  2EGP A;  3FAO A;  4PPE A;  3KV6 A;  4AP4 A;  2Y1M A;  2YRE A;  4QF3 A;  1WEQ A;  3M62 A;  1X4U A;  2RSD A;  2KE1 A;  1G25 A;  4C9Z A;  1T1H A;  4AVX A;  4Q6F A;  3DQV R;  4QQ4 A;  2L75 A;  3IHP A;  2PUY A;  5G0F A;  2OXQ C;  1WEN A;  2CKL A;  3O47 A;  3O36 A;  2ECJ A;  2M6M A;  3SHB A;  4FIP A;  4YAD A;  3HCU A;  2FUI A;  5AIU A;  3LVR E;  2XB1 A;  2VP7 A;  4R7E A;  4GB0 A;  2CSY A; 
#chains in the Genus database with same CATH homology
 4LLB A;  5D1L B;  3O33 A;  2F6N A;  4YAX A;  4R8P K;  2LQ6 A;  4CCG X;  1JM7 A;  2LXP C;  2VJE A;  2C2L A;  4YAB A;  1WEM A;  3C6W A;  1WES A;  2H0D A;  3DPL R;  1HYJ A;  4AYC B;  2KWJ A;  4MSX A;  5FB1 A;  3L1Z B;  2KWO A;  2LXH C;  2YUR A;  1LDJ B;  5DIN A;  5TAB A;  2XEU A;  2E6R A;  4WZ2 A;  5B76 A;  3U5P A;  2C2V S;  5B78 A;  5H1V A;  1Z2Q A;  2IDA A;  5FB0 A;  5D1K B;  5B79 A;  3N9N A;  1JOC A;  4YAT A;  4FK5 A;  3ZVY A;  1RMD A;  4WZ3 B;  5KH9 A;  2KR4 A;  2ECN A;  5DKA A;  4XI1 A;  5TRB A;  1Z6U A;  2YUC A;  2CT2 A;  4LK9 A;  2UZG A;  1WFK A;  1CHC A;  2L5U A;  2NAA A;  2KU3 A;  4S3O B;  3ASL A;  4AYC A;  5KH7 A;  1WGM A;  3U5O A;  2MA5 A;  4CA1 A;  4ZUX U;  1WEU A;  1JM7 B;  2PNX A;  2CKL B;  2EA6 A;  1N87 A;  2H0D B;  1E4U A;  4IC2 A;  1VYX A;  1Z60 A;  2E6S A;  3HCS A;  5LCW B;  1WEP A;  4TKP B;  4GNE A;  2VPB A;  3RPG B;  5G04 B;  4V3K C;  1VD4 A;  3LQH A;  2ECI A;  4QF2 A;  2VJF B;  4YBT A;  4I7C A;  4MVT A;  1BOR A;  2Y1N A;  4WZ0 A;  3U5M A;  1DVP A;  2QJ0 A;  3L11 A;  4GND A;  2VPE A;  4R2Y A;  5H1U A;  5J3X A;  2F6J A;  2LRI C;  3KV5 A;  2JMD A;  2YHO A;  2G6Q A;  4A49 A;  5D1M B;  1WEW A;  4BBQ A;  4AUQ B;  4GNF A;  4ZDT A;  3EB5 A;  1WE9 A;  3KNV A;  5FER A;  3M63 A;  2KGI A;  3LRQ A;  2LDR A;  4YC9 A;  2L80 A;  1XWH A;  2VJF A;  3GL6 A;  2VPG A;  4F52 B;  1WEE A;  2F42 A;  2QIZ A;  2YT5 A;  4LKA A;  3N9P A;  5LKX A;  2Y43 A;  3U5N A;  2MT5 A;  2ZET C;  5B77 A;  3ZPV E;  2EOD A;  4W4U A;  1FBV A;  3SOW A;  5FEY A;  2LV9 A;  2DX8 A;  2JRJ A;  4N4F A;  4YBS A;  1VFY A;  2YYR A;  2HDP A;  5TDW A;  1V87 A;  2ECG A;  3ZTG A;  3ZNI A;  4FO9 A;  1MM2 A;  4N3W A;  4UI9 B;  2M85 A;  2YSJ A;  2YQL A;  4YBM A;  3T6R A;  1WEV A;  3M99 A;  3T7L A;  5G05 B;  2G43 A;  5LKZ A;  3HTK C;  4L7X A;  2BAY A;  5I3L A;  2KWK A;  4L58 A;  2K1J A;  4UP0 A;  5EYA F;  2FUU A;  2CSZ A;  4FJC A;  3PUQ A;  4LJN A;  4NN2 A;  3PUR A;  2K17 A;  1MM3 A;  1X4I A;  2JMI A;  4A4B A;  2MA6 A;  3I2D A;  3N9O A;  2AN6 A;  2MUM A;  2ECV A;  3LQI A;  2D8S A;  2L0B A;  2YW8 A;  3O34 A;  3KQI A;  1WIL A;  2YHN A;  1K2F A;  2LGL A;  3VK6 A;  2FSA A;  3C5K A;  3O37 A;  3HCT A;  3N9Q A;  3ZVZ B;  3MHS A;  2LGV A;  4I7B A;  4V3L C;  3O35 A;  4UP5 A;  4GNG A;  2KRE A;  4A4C A;  2YQM A;  3O7A A;  5LKT A;  2YU4 A;  4P5O B;  3RTR B;  2QIC A;  3SOX A;  5KH3 A;  1ZBD B;  2KWN A;  2KFT A;  4X3G A;  5JG6 A;  3PHD A;  4WA6 A;  2L43 A;  2I50 A;  4O64 A;  1F62 A;  3L1X A;  5LKU A;  2MD8 C;  2MD7 B;  3NG2 A;  5C11 A;  1HYI A;  1WEO A;  5B75 A;  2MNY A;  3EB6 A;  1FP0 A;  2LGG A;  2MIQ A;  2VJE B;  1IYM A;  3ZPV 1;  4A0C D;  3MHH A;  3QZV A;  2VNF A;  4B86 C;  4I7D A;  4ZQL A;  5TBN A;  3RPG C;  4BHW A;  3V43 A;  5AIT A;  4B7Y C;  5H1T A;  5C13 A;  2KYU A;  2ECT A;  2RI7 A;  2K4D A;  2ECW A;  3LQJ A;  5TDR A;  4PTB A;  1WIM A;  2M3H A;  2LN0 A;  2KGG A;  3O70 A;  4LAD B;  2HYE D;  2YSM A;  3SOU A;  4IC3 A;  4S3O C;  1X4J A;  3ZYQ A;  3N9M A;  2M1R A;  2K16 A;  2G45 A;  1U6G B;  5B8D A;  3GV4 A;  2MNZ A;  2JMJ A;  3N9L A;  2KIZ A;  2VPD A;  2LGK A;  1LDK C;  3FL2 A;  5H9M A;  2EGP A;  4PPE A;  3KV6 A;  4AP4 A;  2Y1M A;  2YRE A;  4QF3 A;  1WEQ A;  3M62 A;  1X4U A;  2RSD A;  2KE1 A;  1G25 A;  4C9Z A;  1T1H A;  4AVX A;  4Q6F A;  3DQV R;  2L75 A;  3IHP A;  2PUY A;  5G0F A;  2OXQ C;  1WEN A;  2CKL A;  3O36 A;  2ECJ A;  2M6M A;  3SHB A;  4FIP A;  4YAD A;  3HCU A;  2FUI A;  5AIU A;  2XB1 A;  2VP7 A;  4R7E A;  4GB0 A;  2CSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...