3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
1GM5A 4DB4A 1AA9A 3GLGA 4L8GA 3O8DA 2KB0A 5FI1B 3LXXA 4I1SA 4KYIB 4YLGA 3VTKA 2BMEA 4Q1DA 4TL9A 1T8TA 3SHWA 1LY1A 3RWMB 2AR7A 2IXFA 4CZ2A 2PZFA 1CF4A 1JPJA 1R5OA 4OJKA 2OCAA 1OYWA 2R44A 4OHYA 2ERXA 3PV0A 2VH5R 3P26A 4KO8A 1YRBA 2ZJYA 4Z1MA 1KKMA 3SHFA 5KSOA 4P4SA 4DDVA 4DCVA 1ZJ6A 3QKRB 1KIMA 1ZNZA 1AZTA 2V7QD 1P3JA 3BB4A 4B48A 3BAFA 1KSJA 2XNSA 1E9SA 3KUCA 1UBFA 1FP6A 2JGNA 4LYFA 1RJ9B 2BEKA 3U3RA 1F48A 2ZE7A 2OG2A 1G291 4HDQB 1SHZA 1SHKA 1U8YA 3DMNA 3SQWA 2P57A 2J87A 3FTQA 2IYYA 4JS0A 2QM8A 3U3JA 2X19A 2HLDA 1JALA 1IXZA 2VTKA 4AURA 3KQLA 2WAYA 1EGAA 2DHRA 1GIAA 4R2HA 3EWAA 1L2TA 5DISB 4JVSB 3OE7A 3GMTA 3KJEA 4A8JB 4B75A 3I62A 3X1XA 4QNRA 1E2DA 3B8HA 2ZRGA 1IN8A 1Z0AA 1K8RA 4PO9A 1Q0UA 2BMDA 3NWJA 3CRQA 2NO1A 3TMKA 3EPLA 4TYNA 1DG3A 1KI3A 4Q21A 3RYTC 2CVFA 1TEXA 2QP3A 3RRMA 3RRZA 5D3MA 4TMKA 1UEIA 3KJHA 4PX9A 2XZLA 2PLRA 4W5WA 4ESVA 1W0JA 5FBQB 1P75A 3DZDA 3JZMA 2D2EA 2JLWA 4DLZA 4EQ6B 1NJFA 3GJ7A 2JDID 4M1OA 5CM8B 4D26A 4OQFA 2GJ8A 1SQ5A 4TQAA 1TADA 2GRJA 2J59A 2VP5A 1LV7A 4GP7A 1RC8A 2GK7A 1E2PA 3FGNA 1HTWA 2JJ1D 2EFHB 2DB3A 4Q4HA 1ZVQA 2XXAA 1KO4A 4EPTA 2O0JA 3OIWA 4AI6A 2ANBA 2IHYA 3OIYA 4ZDIA 2ZS9A 1XMJA 2V55B 5EP3A 2PMKA 4M9QA 1S4QA 3W3ZB 3CZQA 3HDTA 5P21A 1OIVA 2C95A 1OH5A 3UMRA 4Q4AB 4GOJA 3QBVA 2I4IA 2QN6A 1PUJA 4Q4JB 1KJWA 1MV5A 2CJWA 4N0DA 4BFYA 4HI0E 2DWQA 2PJZA 1OHHD 2XTMA 4MYTA 5SZKB 3C15C 1UPTA 1KI7A 3EZ7A 5FOXA 5TARA 1W5SA 4BRWA 4KBFA 4P32A 4FWTA 3LFUA 3DL0A 4KHZA 1CJKC 3PITA 3PUZA 5GJCA 3W6PA 3AF3A 2ZR0A 4ACAA 1KI9A 3FKSD 4PPGA 4Q1FA 4A0RA 4XIGS 2A3RA 3CR8A 3OIVA 5CJPA 3I5XA 1AGRA 5BN5A 5L3SB 2XOKD 4W7SA 1CRPA 4D25A 1C1YA 1OV4A 2B6HA 2V4ZA 3ZJYA 3I5YA 1SVSA 3TGPA 1XXHE 4KFTA 4Q7KA 1N25A 4DJTA 2ZS8A 1E99A 1XTJA 2P6NA 3BGWA 4HLDA 4A15A 5F98A 1HEIA 3K0AA 2EFDB 1ESMA 3C5CA 4NKRA 1SULA 1DAIA 4OKSA 3A36A 3C41J 3D7MA 4C0SA 1K5GA 1T91A 4PSAA 1LFDB 1CKEA 3HPRA 1W36B 3AVVA 3T12A 4WOPA 3QJYA 1XP8A 1ZNYA 1XFAA 2FV8A 4LHWA 3ZZ0A 1E0JA 1NLZA 4PFSA 4FIDA 1JR3A 1R2QA 2HDNB 1ZBDA 3PFIA 2CDNA 1T8UA 5FH9A 2FPKA 3KKQA 4WBSA 4ARZB 2O5VA 1FZQA 1Q44A 5DO9A 3RRNA 3BS4A 4HEJA 4LV6A 5KDOA 2I3BA 3B9PA 5JSZA 1VIAA 4NDZA 4WXRA 3I73A 2RGGA 1LNZA 2WM9B 2ZE8A 2YVUA 4GSYA 3MWKA 2G1JA 2RB4A 3RSOA 1UBCA 1JR3D 2PL3A 3P4YA 4DBLC 1I4TD 2IT1A 1XCMA 1M7BA 3R9WA 1G5TA 4MGZR 2CHGA 3GLIA 3QKSA 5KNDA 3MWLA 3DKVA 2JIZA 4GT1A 1NVVR 3A4MA 3CPHA 3NVAA 4GZMA 4N0EA 4QBIA 4DDTA 1BS1A 2NZJA 4CW7A 1OSNA 1II8B 1ZCAA 2CE7A 2ORWA 4JLAA 4RCZA 4DKXA 1NRJB 4PPQA 3VAAA 4DDWA 4LJ6A 1CP2A 1YZGA 5EE3A 2OLKA 1AKEA 4XWKA 3CW2A 5JJKA 2EFEB 3K0FA 3EIEA 2GXSA 2ZRAA 4EJSA 1NN3A 3Q3JB 2Q9BA 4V0OA 1V43A 3DZ8A 3CRW1 2FGKA 2QRNA 1I2DA 1TQ6A 3SOPA 3DVLA 1G18A 4US0R 4DHEA 2QPOA 2ZJ2A 1N6LA 4JZKA 4B6FA 4OI1A 2QP4A 4ZDJA 2BBWA 4EUNA 2QTFA 4TLCA 2UZ3A 2OILA 4KLZA 3LLMA 3K1JA 3MRSA 4ZDKA 2QBYA 3TKLA 1DO2A 1ZNXA 2GZHA 1Q12A 2RGNC 3ZVNA 3PJRA 3FMFA 5TVKA 2RGCA 2UVQA 2ZJOA 3AB3A 2JLXA 4Q1EA 1G7RA 2CHVA 4G5SA 1YZKA 2ZI3A 4EAQA 3R9XA 3VR4A 3ADCA 1X3SA 4JKIA 1GRRA 1M2OB 3G82C 2XB2A 1HV8A 4OI0A 1KZGB 2QQEA 1E0SA 1O3YA 4BFTA 4CEIA 2QPAA 4HZUA 2ZR7A 4IEIA 5CIWA 1OXXK 2JA1A 2LCFA 5CLLA 1KDTA 1OF1A 1US8B 2ZRMA 2VRWA 4TYYA 3IQWA 3U4QB 1QG4A 3C5HA 1MO5A 2KBEA 2JIZD 1GVNB 2OFXA 5LB2A 1V5WA 1EXMA 2O8EA 3OZXA 4TTQA 3HPQA 1XB2A 2P3SA 1UDXA 4FW9A 2CLSA 1EG7A 2YINC 5CJ2A 5HPYB 1OH7A 3R8CA 1E1QA 3I8XA 2OAQ1 4P3YA 3U2QA 5JHGB 2RGAA 3GLFA 2BCGY 1ZUHA 1AZSC 2P67A 4US1R 2AFHE 1NG1A 1F2TA 1A4RA 1ZMXA 2J1LA 4YMSA 3PUWA 2GBLA 4NYJR 1Z2CA 5BYJA 1COWD 1VKJA 4PR0A 4M0LA 1N3BA 1N0UA 2Z0MA 1S3SA 3NEJA 1NY6A 2IWRA 3TLXA 2P2LA 1W2GA 3MUFA 1EX7A 4B35A 1R0YA 1DAEA 2IYVA 4IOLA 4U5XA 5EP2A 2C9YA 4M22A 2GAOA 4MUBA 4QGFA 3R7WB 2QE7D 4KFSA 2O8BA 4PC6A 2K5UA 5JCPA 1X8LA 1U0JA 3SU8A 1W4RA 2GF0A 2A5GA 3DO6A 3EZ9A 3IIJA 1XBTA 1KNXA 1DAMA 2NPFA 5FUYA 4TLEA 4ERNA 4QBGB 1JXOA 2HCJB 4EFNA 1NKTA 1UF9A 1ZRHA 1G4AE 4E09A 4URUR 3SEAA 2Z4RA 2GK6A 3MWYW 1XZPA 3U3MA 1FFHA 3FDIA 1N0VC 2C9OA 1U99A 2FEMA 5H70A 2RCNA 3LH5A 2CLCX 3ETLA 5FTNA 2NG1A 1YHNA 2GEVA 4A82A 4F93B 2OWAA 3B13B 4Y0VA 3TRFA 2IW3A 2BWJA 3K0CC 3ZS9A 1JQLB 2BMFA 4JLDA 1QF9A 5G3YA 3WNCA 4IVQA 3TW4A 4C4PA 1DEKA 2OESA 1PVOA 1SVWA 1IHUA 2GF9A 3QXCA 4PC1A 4M9SA 6Q21A 4JSYA 3CH4B 3SNHA 1CR1A 3BH0A 3SQXA 4WXPA 4EFLA 2PX3A 1MABA 3THOA 3AP1A 2ZJBA 4NBSA 2RGNA 1Z0IA 3H2YA 1BIFA 2C98A 4O2RA 2AFIE 3CNOA 3OEHA 1A2KC 1E96A 1G20E 3LVRE 1SVIA 1UKEA 1XF9A 3H84A 4DLUA 2BJWA 4A6PA 4F92B 4CEHA 3HR8A 1T0JB 3RANA 3TUZC 1A1VA 2IXEA 1E2IA 2CL0X 3QF4A 1KO5A 2O8CA 4WZAE 2FJUA 3GJ3A 2WKPA 4BEBA 1HURA 2ZM5A 5AR1A 1SVMA 3V4FA 1XD9A 3B1XA 2JJ1A 3MLEA 1KI4A 4PC3A 2H17A 4JLOA 3SR0A 2GNOA 4CVNA 5CDFE 2YWHA 1KO7A 2ZQ5A 3FMOB 3EW9A 3SC3A 3WYAA 4F7WA 1L7VC 2VP9A 5B64A 2GCOB 1KJZA 2QP9X 2IEZA 2IYTA 2Q3FA 4IFEA 1CLUA 3AV0B 4V0ME 3ICEA 4XVQA 1GUAA 1Z83A 1NVXQ 1MH1A 2JJ2D 4YONB 3ZVRA 5BWMA 3BRWD 4OBEA 1YRAA 3QKTA 3MDBC 3LJUX 3B7GA 2CLDX 2DCUA 1GITA 5JLJA 1S9HA 1TU3A 5LPNA 1GG2A 4IDNA 4TZ6A 3TBKA 4TLAA 1XTQA 2N42A 3HYRA 4DSOA 1GL7A 4RD4A 3U6KA 4EPXA 1KZ7B 1VYVA 2A7QA 2F1IA 4R9UC 3HU3A 1PLLA 1HE1C 2WMNB 1C4OA 4OQLA 3BOSA 4BLSA 1RRFA 3C7KA 2WV9A 4YC7A 4O3MA 4QXAA 3QSYA 2OV2A 1DO0A 3GJ4A 4OHWA 2ECKA 4M21A 4P0TA 4W5JA 5L3RA 2ZI7A 1RVDA 2AN9A 2FZ4A 4DIEA 4PZLA 3P20A 4B76A 5FBVB 2F55A 5EQTA 1GOTA 1JECA 4J0QA 1TX4B 4MGKR 3VHXA 3QXHA 3Q7PA 3CH5A 4BFVA 1KDPA 2A5FA 3N2IA 3L0IB 4TQ9A 3EC2A 3ASZA 3EZFA 3K0EA 2YKGA 4EPWA 1SVKA 5TY0A 2FDCA 2YWEA 2CNWA 4QJ4A 2XSZA 1KYIA 1IONA 4OYHA 2YV5A 1T6NA 3QXSA 5KUTA 2BBSA 2Q6TA 4PC2A 4Q7MB 2NPIA 1N5KA 2QENA 3AF2A 3EG5A 4KI0A 3U5ZB 3CR7A 3N5CA 4M1MA 4LHZA 5FTKA 1ZD9A 3S1AB 3MG9A 1F5NA 2ZU0C 3CF2A 1PZNA 1X1SA 3I4LA 3V9PA 2YC2C 5HE9A 2BKUA 3GCGA 1P2VA 3SBDA 4KCGA 4UXJA 1PLJA 2P6RA 4FN5A 1Z06A 1WDTA 1Q1BA 2AWOA 5IK2D 1W0KD 2ZJ5A 3P1JA 3P4XA 4Q4LA 4US2R 4FINA 5C4GB 4NP6A 4DDUA 4DB2A 1W44A 2KJQA 1XXHB 5GVRA 5LD2C 1FTSA 4NZYA 4FMDB 2AXPA 2WWGA 2DPXA 2D06A 1E4YA 3TQFA 5FPTA 4LJ8A 3WBKA 3HYTA 3FYHA 4DCSA 2MSCB 4NMMA 3T1QA 2ZI4A 3SDZA 4NCIA 5DN6D 3AVTA 5KHOC 3HU1A 4JSTA 3KJIA 5FTJA 1G41A 1E94E 2W2TA 4TYQA 5JFGA 2FPMA 3L82B 4F4JA 1DAGA 1AS2A 4I99A 4HAWA 4OK5A 4DRZA 1WBDA 1KGDA 3PG5A 3Q5DA 2B7CA 3X1ZA 1IN4A 3QVVA 4ZCMA 2ZRIA 2HT6A 1XJCA 2IYZA 3B6EA 4YDSA 4B3FX 5EXXA 4B2IA 4GBMA 5L8VA 3U44B 2CK3A 4PO1A 1QHGA 4URVR 1GNRA 4RFSB 5JRZA 1XEWY 1KY2A 3THXA 2QAGA 4NYJQ 1BYUA 5FBWB 5JEEA 1BKDR 3B1WA 1YKSA 1U0HC 2QAGC 2QY9A 3Q7QA 1EESA 2BBTA 1KI8A 3EPJA 1WB9A 2A9KA 2IS2A 3UKDA 2F1HA 5TXGA 4B71A 4XWOA 3TE6A 4MYCA 4E22A 4FI3C 1E79D 2VP4A 1DBSA 3AKYA 4MGYR 4ASUD 3T34A 2NO9A 5AK0A 4RD3A 4P31A 2JLQA 2YWGA 1RRCA 1IJFA 3PEVA 3ND8A 3VR1A 3X1WA 2BOVA 4RD1A 2JASA 4JJZA 2ZJ8A 4CEJB 1D9XA 1NSFA 1QHIA 1Q20A 5CIQA 5CK5A 1H8HA 3I3SR 1EWRA 3W9YA 1Z47A 4CIDA 3U6BA 1G19A 1AS0A 1W5TA 1E2LA 2D62A 2ZPTX 3AF0A 1XPOA 1QHHA 4LBZA 3FE2A 2A5YB 2GEDA 2IYSA 2YOHA 5JZVA 3THWB 3MAAC 3GLHA 4JVLA 4IDPA 5C18A 2ZE5A 3VX3A 1E0KA 2OXRA 5F9HA 1FMJA 2ONKA 4LZZA 1CR4A 1E2HA 1M74A 5JS8A 1OXVA 1Z3IX 1NBMA 3LO5A 3IUYA 3TSOA 1N5JA 2G88A 1N5IA 2AWNA 2VP2A 2XOKA 2J5XA 1ZD8A 4QC2A 3TR5A 5EZ5A 5JWHA 2YJTD 5GVSA 3B82A 3T15A 4GP6A 3A1VA 2ZYUX 1W1WA 3KXKA 3PVSA 1TAGA 1IAQA 2ZYTX 2PCJA 2A78A 4TMWA 4FCWA 3IPYA 1YE8A 2H16A 5DH9A 3L0OA 3WP1B 4IEEA 4OHXA 1E9DA 1Q3TA 2J0VA 4BASA 1FX0B 2IS6A 3KQNA 1WE2A 2R9VA 5HTKA 5CLQA 1G5RA 1QHXA 3E1SA 2FFHA 4I1VA 4EPVA 3CRMA 1Z6YA 2F3RA 4GDFA 2G9NA 4JLBA 3EIHA 2EFGA 5M04A 1FQKA 1GFIA 2I1VB 1J99A 4YMVA 4V0MA 1H8HD 2BHRA 4C30A 5DNYB 3TAUA 1D8TA 3AM1A 3AF4A 3CNNA 2OM2A 3GJXC 4A2QA 1XWIA 2ZAMA 2ZAOA 2ZUBA 3LDAA 4XD7D 1CJVC 2JLRA 3K0SA 3A37A 1M7HA 4QKQA 1N6HA 3OHMA 1UKYA 1RW4A 5AUOB 1F2UB 2LWIA 1S96A 4TN1A 5FPYA 2NO6A 5DI3B 4WAUA 2QROA 4BFUA 5EJEA 4IRUB 3M1IA 4LPKA 4XOIA 221PA 3U60B 4LX0A 3BORA 2W6ID 2GXUA 4O0MA 3MD0A 5F2EA 5IRCD 2X8AA 1GZSA 2CHQA 4V0LA 4LUCA 1Y63A 5FOTA 3T1TA 1KI1A 1AGPA 3OEEA 4Q00A 1G3IA 4NL4H 1LVGA 3RLFA 4BPBA 3LX5A 2HYDA 3AKCA 2ZROA 5TV2A 1JNYA 1N6NA 2X2EA 4B44A 4CGZA 3IO5A 3RS2A 3ZGXA 2G83A 3AVPA 4NH0A 1QRAA 1FP7A 3KXLA 4QBFA 4TL8A 4HLCA 5HE8A 2R6GA 3KTAB 4DC9A 3K09A 1ANKA 2VSOA 5A0FA 5B58C 1EFCA 4XTCS 4LV5B 1N6OA 1AN0A 3HP1A 2CRWA 4PHHA 1J90A 4N1AA 3LBHA 4K81B 3JUEA 2QMEA 1ZD1A 3B1VA 1OB5A 1P61B 4PQRA 4YMWA 1CJTC 3VR5A 2F9MA 3SFZA 1TEVA 3NHAA 2RHMA 3GJ8A 4DLWA 1YZNA 4D4MA 1SGWA 4RY2A 4B33A 5JECA 5LDDC 2O8DA 1YR9A 2RKOA 3LQRA 1NI3A 5HCIA 3M0EA 4BZXA 2PEYA 4JKYA 5FUVA 2ANCA 1VG8A 1SKYB 4LHYA 2GVDC 4TL7A 3ZQ6A 4OHVA 521PA 2QTVB 4YQFA 1Z07A 3QG1A 4LK2A 2DBYA 3OE7D 2V7QA 3UWOA 3CF0A 4URZR 2JAQA 2OO7A 3NH9A 3KFXA 2ZI6A 3B78A 1VTKA 5JJLA 2Z43A 1A5TA 4HLUA 4IDOA 2OE2A 4BFZA 1E1RA 1E32A 3DEFA 4B3DA 3MGCA 3NDBB 1OH6A 4H1UA 1GAJA 3GEEA 1ELOA 3SJBA 1CXZA 1U94A 5UKDA 1LB1B 4D4JA 4AG5A 2IUUA 4TL6A 3LLUA 1OXSC 4TT3D 3RRYA 5SZIA 4AYTA 3FM8C 3IDQA 4A2WA 3TSWA 1M7GA 2AK2A 2XNDD 2F9LA 4IOKA 1X8JA 2W0MA 5C4MA 3QQ5A 2ZRNA 3LBIA 2P5SA 2JLZA 1II9A 4A9AA 4LBVA 5AJVB 5J4LA 2KSQA 4IFBA 4OQNA 5TB5A 4DVGA 3FPAA 3K53A 1RZ3A 4KLNA 2VHQA 5DYIA 3TJZA 3K70D 4MH0R 4LJAA 2XZOA 2XB4A 1DELA 3X1DA 5E7JA 2QTHA 3I92A 4PHGA 3CPJB 3LBNA 2C9CA 1NN5A 2CVHA 4ACBA 1JR3E 1LF0A 2RAPA 5KDDA 2KBFA 4BQSA 4V0NA 3AEZA 2QAJA 3UATA 1VG1A 3OESA 4OL0A 4NYMQ 2WKQA 5KPDA 4M8NE 2XAUA 2V1XA 2KI5A 2GBLC 4BZQA 2WJHA 3MFYA 2EYUA 3RS4A 3L2OB 1KMHA 3TVDA 4C0QC 4GFDA 1E2MA 4KVGA 5JMTA 4AY2A 2ZREA 4HB0A 4X8MA 2HUPA 2FSGA 3U7FB 4D81A 3C4JA 3QKSB 3IQXA 4C0AC 4I4LA 1F3OA 3DDCA 1SXJC 4QNMA 3ZZTA 4P4TA 3GLFE 2QRZA 2ZUDA 1II8A 1S1MA 4JLNA 3EWSA 1IN7A 1IOZA 4HZIA 1Z0KA 2WPDD 2FE4A 4TWZA 1NN1A 4L9WA 2OZEA 4Z51A 3RNLA 1ESNA 2H5EA 3K0FB 2ORVA 4PHTA 3WY9A 3B2EA 3PEWA 3LVQE 1Z8FA 2IUTA 2Q3HA 3GD7A 4FD2A 4LPSA 3TW8B 621PA 3GP8A 1P4SA 2FZLA 1S3GA 1MO6A 4JJKA 3CKLA 2IYRA 1TF7A 5G53C 3MJHA 3EX7C 3VKWA 5GJBA 2WBLC 2OBMA 3WP0A 3FFAA 1UEJA 1UKZA 3M4YA 3SYKA 1H8ED 2ZU6A 3BH7A 3D31A 3GJ6A 2ZSBA 1OFHA 2FA9A 2X77A 5FUWA 4IVPA 1W4AA 2VA8A 3KDSE 4UXHA 3RHFA 5K8LA 1ZIPA 3KXIA 1P2UA 1DE0A 1M1YE 2RGBA 1OYYA 5DYGA 2QEQA 4QG7A 5L3VA 3OFND 2O0HA 3CM0A 3A1UA 3VR6A 2C5LA 2XX3A 4NU0A 4B3BA 2Z6VA 1XJQA 1T5IA 3AVXA 121PA 2HF9A 5AUQA 1R0XA 1U9IA 2WWHA 1N6RA 2IYXA 4Q9HA 4HZUB 4UJ5A 2HXYA 1O87A 4MRSA 4XTRA 5JI3E 2ZSAA 1KDRA 1TF5A 2EWWA 1NF3A 2OSBA 1U8ZA 3MWJA 3EPHA 5L3QB 3FMPB 4JT2A 2G77B 4QOSA 4UNNA 3ZYCA 4A8JC 1J70A 4OQMA 2C03A 1FQJA 3PEYA 1F60A 3H86A 4DT1B 2GWHA 2OBLA 1CJMA 3IBYA 2F43A 1NVWQ 3SYLA 1VECA 1TTTA 4LC0A 2D74A 4LY6A 1HQYE 3KX2A 1X1RA 4YMTA 5JCZA 1Z63A 4B3XA 2MMCA 4LJ7A 2CMKA 1DTSA 1W46A 1EK0A 3B1ZA 1P62B 5JRJA 1JJ7A 2Q0HA 1UADA 3BXZA 1S8FA 1D6JA 3VNUA 1II0A 1XPUA 4A92A 2ZTSA 4YDHB 3TR0A 2UZIR 3IKJA 4TTPA 4POAA 4RCYA 3NH6A 1NLYA 1JQJC 2F3TA 3TUIC 1DAKA 5EZ6B 1KY3A 2AD1A 4Q9JA 4B47A 2QQ0A 1KK1A 2WOOA 2O8BB 5FOVA 2PCLA 3DOEA 4B3GA 1XMSA 3THYA 4QM6A 2JCSA 3B5JA 3WNDA 3T9KA 5J4YA 3RABA 1UFQA 4PAQA 3W6OA 1J7KA 1XTKA 3AGQA 4LV8B 1IXRC 1QBKC 3D6TB 4FMBB 4LDJA 4XSHA 5AJWA 1MRSA 1EFHA 1VHTA 4L16A 5EE5B 3VX4A 2D2FA 1KHTA 2A5JA 1CBUA 1GKYA 4HDOB 3WYGA 2J7PD 3RC8A 3V00A 4L4UA 1IN6A 2R6CA 1GSIA 3NBFA 1M6NA 2IBMA 4XJXA 3T1OA 5BXQC 4D0LB 4WW0A 5CYOA 1CEEA 4A6XA 3CNLA 1G7TA 1XD8A 2WOJA 3OAAA 4A0HA 1FTNA 4Q48A 4JLJA 1LW7A 4YMUA 5EUMA 1CTQA 4B43A 4ZIRB 1E9AA 3RS5A 3K70C 2AD5A 4MA4A 5G40A 5FL7A 3TAHA 1E9EA 2PBRA 4DLXA 1B0UA 1N2CE 2HT1A 1AS3A 2C2HA 3TVTA 2IYLD 3I72A 1MABB 1GL9B 1RYFA 3KKOA 4RKFA 3LW8A 3CZPA 1VDZA 4JBXA 4OK3A 5CDFA 2EFCB 3W8RA 4Z8XA 4D4KA 4QFVA 2YOFA 5B2ZA 1GL6A 4PZYA 4EQ6A 2IYQA 3QPVA 1CULC 5JWOA 3ZDQA 4JYBA 4D2IA 1W47A 2V6JA 1NIPA 2FH5B 4GMDA 2BC9A 3QIAA 1JB1A 1YR7A 1ZM2A 3BFKA 1ZU4A 3AKDA 2EU8A 4H9GA 1G9XA 3RC3A 2W6IA 1QHNA 3N2EA 2XXAB 4KFUA 1LTQA 1NIJA 1X8KA 1Z28A 4HB2A 2FN4A 2FWRA 1KI6A 3K70B 2GDJA 2IEYA 2G3YA 1P2SA 4Q19A 4TYPA 4EIWA 1K5DA 4BLQA 4C0JA 1D9ZA 2VPPA 2WSMA 1UM8A 5KSPA 2GCOA 1XEXB 3WMGA 2WWFA 1YU9A 4KITB 1E1QD 3BFVA 1R4AA 4Q4JA 3I8SA 2P0EA 2CJWB 4NE2A 4BZPA 5HR5A 5IT5A 4G1UC 1YJ5A 5DE3A 1QHSA 3LAWA 4M1TA 4IHQA 3ECCA 5LD2B 3OF5A 1UKVY 2EW1A 2J0UB 2PT7A 2F6RA 2IC5A 4M9ZA 5FI0B 1KAGA 1N6PA 1G7SA 3WMFA 4XVUA 2QGZA 3TIFA 1WA5A 1W7AA 5FPSA 2J46A 1Z29A 1S2MA 4R2IA 4V03A 4CF7A 3SJAA 3WMEA 5HCNA 3L0PA 4Q01A 5D3QA 3C8UA 5EXTA 3KL4A 3REFA 3UMFA 2FOLA 3B9QA 1KJYA 3DWDA 3GLGB 3ND9A 3LY5A 5KO2A 3WYFA 3MMPA 2GZAA 1QZXA 1G6OA 4O25A 4HUQB 3K9HA 3L8ZA 1VYTA 1S0UA 4RZXA 1HE8B 3EA5A 3EXAA 1J2JA 1IXSB 3BB1A 1VMAA 2J7PA 3AP2A 4Q03A 4F1PA 4MRPA 4RVCA 2D7DA 2C8VA 2PZEA 2QMHA 4TMTA 1W36D 1KK0A 1OHHA 2V6IA 1KMQA 4DCUA 4ESHA 1J8YF 1U81A 1NP6A 1R8QA 3QKRA 4OQXA 2ZE6A 2GJSA 1ZM9A 3GQBA 3VU9A 3VR2A 3EC1A 1HT1E 2XTNA 3QNUA 3T35A 4MUAA 3U3OA 3O8BA 3P27A 4M2LA 1KOFA 2H92A 3PEUA 3E5HA 4KJZA 1P6XA 2DWPA 2HCBA 2TMKA 3SFVA 4B2LA 5GADl 2BM1A 4XWAA 5H8WA 3BFXA 3UG6A 4IDQA 1Q1QA 1OKKD 1TUIA 2R65A 4A8JA 2VYFA 2ZRPA 1MO3A 4II7A 3JVVA 4GRAA 1G3UA 1RFLA 1BMFD 1EFRA 3NG1A 1RRGA 4ILEA 2AK3A 4QGAA 4TTRA 1W0JD 5E95A 3UK6A 3KKMA 1WMSA 4GMXA 1GP2A 2OFWA 4MITA 1NNEA 5JJIA 4Y0AA 1NJGA 3ZVLA 5DLQC 5D3MB 1OH8A 4S35A 1PLKA 3H0KA 1OE0A 1U9IC 4WZBE 4LGMA 2ZRFA 1LF5A 3BERA 1TNDA 2VO1A 2XJ4A 2HYIC 3HR7A 4A0FA 4C3ZA 4DUGD 1MRNA 1GDDA 5KNCA 3UMSA 4AK9A 2BEJA 2PZGA 2ATVA 1PUIA 3LNCA 2JLSA 2A30A 1WQ1R 4HUTA 4DWJA 2IX3A 2GCPA 3EARA 2HXSA 3PENA 3PR1A 3PUVA 4DSTA 1EWQA 4TZ0A 4GOXA 3C16C 4BRUA 1ZCBA 4JT4A 1IY1A 3K0CA 3U7HB 3Q72A 4JLKA 1MO4A 4Q4AA 3QOFA 3W5IA 3T06B 5KOYA 1N5LA 1SXJB 2VHJA 2RMKA 3NXSA 1ZUIA 2G6BA 2C99A 2IS4A 4QJ5A 1A7JA 1YZTA 3GEHA 3FVQA 3EIQA 1EX6A 8OHMA 4AD8A 2N46A 1Q3HA 1P9NA 4PXAA 4C9BA 4Z1MD 3CWQA 4GL2A 1I4DD 4I81A 4TQUS 2W0SA 1P9WA 2F1RA 4UNPA 1NN0A 2ATXA 1W0KA 2N1BA 3JZAA 1C9KA 3GFPA 1JJVA 1NBME 1T3HA 2X1VA 4Q1AA 4C7OB 4H1VA 1Z5ZA 1Q22A 1VHLA 3LRPA 3RWOA 1GKIA 2QG6A 4FXPA 1G17A 1G7CA 5J47A 2PJRA 2CL6X 4DUGA 2OHFA 3U4QA 3SI7A 3VMFA 1RYHA 4Q02A 3CX7A 1P72A 3NTUA 4TMZA 4JLMA 5L3SA 3GLGE 1XDBA 3KQKA 4PPFA 2ZSEA 3AH8A 1E6CA 3FHCB 4NYIR 1E9RA 2C77A 3GLHE 2WWWA 5BYKA 1NSTA 1R0ZA 2CCGA 3K0AB 5KNBA 4QM7A 5HZKA 5TDHA 3ZD6A 3Q5EA 3SUBA 3TQCA 4JYCA 4EPYA 3AVWA 2MMGA 2NIPA 4BLOA 4D82A 3RS7A 3DOFA 1BH2A 1BOFA 5JWRA 5F3WB 4DLVA 5FPKA 1DARA 2GKSA 2I1QA 3JVUA 2GXQA 3OFNA 1PJRA 4L9SA 2FGJA 3BH6A 4C2UA 3O8CA 2H7VA 2HF8A 4B74A 1RE0A 2OLJA 4CT5A 1DADA 3BIFA 4URXR 1VG0B 4PSVA 3WRYC 4KVAA 3QXJA 2E9SA 4ON9A 1GRQA 4Q9KA 3I61A 1VCIA 5K8IA 2WVJA 3PUYA 4PAMA 2VHTA 3GJ0A 5FOSA 4E03A 3KUDA 4QHTA 2R6DA 4XD7A 2QSZA 4Z8YA 1AK2A 1OW3B 3KB2A 5JSZB 3OAAD 4GOKA 4QBHA 1IY2A 3ZS8A 2XITA 4FCVA 4B6EA 1HY3A 2WJJA 1E2JA 1NVUQ 2WSSD 3T5GA 2AXNA 4CT4B 2YOGA 2HV8A 3A1WA 1D2MA 3T1VA 5KSZA 1KTVA 4NTZA 2GJ9A 2ZRKA 4P33A 1QHYA 2GJKA 4X8HA 5FL3A 3IIKA 4HB4A 4PTLA 2G0NA 3EA0A 3IILA 3GLIB 4MRRA 2JLYA 2H1LA 1OLOA 4ZCIA 3V4RA 1R6BX 5K8TA 3QUSA 4HLUC 1NG9A 3A1SA 2QT1A 4D0NA 4TT3A 3TK1A 2OBNA 4MRVA 3SE0A 4NYMR 4BUJA 5KPJA 1LS1A 4WZ6A 1RPZA 1HUQA 1WCV1 1XMIA 2ZSFA 4ZI3A 4BGDA 2JLVA 3A1TA 2P6UA 1F2UA 2W2XA 1ZUNB 2NMVA 1Z6XA 5FR2A 3UIEA 1AM4D 2CRRA 4LSGA 4QJ3A 821PA 3TSZA 3ONWA 1UDWA 4AYXA 4F4IA 1YVDA 2O8FB 5GJWC 4IDHA 721PA 3EAQA 3PUXA 4QFMA 4CDGA 5AJXA 4XSGA 2FG5A 4CEHB 1SKQA 2E87A 2PX0A 4D6PA 2IYUA 2Z4SA 3F3YA 4ZKDA 1HH4A 2QBYB 2O8CB 2FPLA 5JHHB 3W5JA 5BW8A 1E3MA 2D3WA 1OJLA 1P7CA 4NCNA 1MKYA 1TPZA 2CE2X 3KTAA 3KQHA 3LV8A 3NC0C 3IHLA 3WXMA 5HZHA 3K09C 4MYUA 2BVNA 1XD2A 2IXGA 4Q1CA 5FOWA 4G5QA 3KKPA 2C96A 1D2NA 4LC1A 5DN6A 1Z6GA 2XZPA 3ZIAA 2B0OE 1OIWA 4GNKA 3L43A 3LD9A 2J0QA 1NKSA 4C0HA 2QPTA 4CEIB 1T3SA 4MDFA 2IUSA 2B92A 5B57C 1E2KA 5KSYA 2O8DB 2RHDA 1U98A 2XTZA 1L4UA 3LW7A 4NYIQ 2VF8A 4R98A 1JAHA 3CIOA 2ZVQX 4BWYA 1NMZA 2MSEB 1YR6A 2VP6A 2JJ8A 3UPUA 4Q9LA 4UJ3A 2O8EB 4PHFA 4D4LA 4S2EA 3I1FA 1OKKA 3FWYA 3X2SA 2R62A 3N70A 1VCMA 1Z0DA 3KZ1E 2F1JA 3U61B 2ZS7A 1R5BA 3SJZA 1IBRA 4W5HA 1XU4A 1XTIA 4ZCLA 4UXIA 2IL1A 3LA6A 3GLFB 4BEJA 1R8SA 2OCBA 4JL8A 4DLYA 1YQTA 3W3AA 2V9PA 4LYJA 4Q47A 4GI7A 1Z08A 3GLIE 4NCJA 2Y8EA 5E7IA 3K9LA 1A82A 2YHSA 3VKHA 4C0BA 2ZRHA 5H1YA 1XEWX 2KWIA 1ZU5A 2DWOA 2FMXA 3REGA 1XJ0A 5KDLA 2EYQA 1CR2A 3NBYC 2VHCA 4PO8A 4R71A 1KDOA 3R7WA 2G0TA 1N0WA 4P4SB 3QF7A 5C1BA 2XEXA 2ZRBA 4B73A 5E3HA 4HSEA 5DI9A 1TQ2A 2DFKB 4IOJA 1GRNA 1I4LD 3VFDA 2FFBA 3LX8A 1RJ9A 3BB3A 2XSZD 3KB1A 1CRQA 4UKDA 5E7MA 5KTYA 2CCJA 5KYKA 2PT5A 1G3RA 2EWVA 2JEOA 5BN4A 5IK2A 4BLRA 3CLVA 3DHWC 3RAPR 1ZINA 1VCNA 3GFOA 3PXGA 5J4KA 3U7GA 5IDVA 1T9HA 2ZSDA 2CL7X 4JIMA 5A5GA 1T0HB 3AUXA 1T5LA 4ZPXA 4KBGA 2AX4A 3AVYA 4FCTA 3VHLB 4HAYA 2WJVA 2QSYA 1DAHA 1XXHA 2ERYA 2RGXA 2ZRJA 1G6HA 1E2EA 3NC1C 4MKFA 5J4HA 1TUEA 2Q9AA 3ZQJA 1DPFA 3DM5A 1NVVQ 5AUNB 2ZUCA 1N6IA 4IOMA 2A2ZA 1HYQA 3RS0A 1J8MF 1TU4A 4M9XA 1I2MA 3FKSA 4X8LA 1SVLA 5K8UA 2IHBA 3OIUA 4LJ5A 1PV4A 3QENA 2ZJAA 4L5BA 4DSUA 4LCBA 1Z0FA 3QF4B 1XTRA 4Z54A 3CRVA 3R8FA 1ZP6A 2OEPA 4QGGA 2VIIA 4PAOA 3BWDD 4Q4HB 2HJVA 1FUUA 2IA5A 1E79A 5EUQB 5LBIA 1VPLA 2VEDA 4F4CA 4DXAA 3IIMA 2GJAA 2PMDA 1WXQA 4AKIA 1G3QA 4G5GA 1NBMD 1KK3A 4DCTA 4AKGA 3THXB 2RH5A 5H68A 3PCRB 1M34E 2NGRA 1G64A 3AKEA 2O0KA 2RGEA 3W6NA 1JXMA 2CK3D 3CONA 1TF2A 1ZC3A 2QGNA 1G1MA 4R7ZA 1UBGA 1DCQA 1G8YA 4FWIB 3WHKA 2GESA 2W83A 1BYIA 1ZM7A 4ZKEA 2WICA 2H57A 5LB4A 2REOA 3HU2A 4CYMA 1E9BA 1OFIA 3DPUA 4DEYA 4TMVA 4WVFA 4B34A 5FTLA 5BQ5A 1G5PA 4M1KA 1G21E 2FF7A 3KQUA 2ZRCA 2VSXA 3UWKA 1GTVA 3ADBA 5FBLB 1S1CA 4B3CA 1GWNA 2NZ8A 4A4DA 2BV3A 2JATA 3RDPA 2IF2A 1GILA 1P2TA 4HATA 3TUJC 1IQPA 2WWYA 3NDPA 2DFNA 2WSSA 1VG9B 4DLTA 1CIPA 4DT1A 3KFVA 1R7RA 1OXTA 4JLPA 3TNFA 2VF7A 4PPNA 2GILA 3PQCA 4HAVA 4P4UA 1T4GA 1E2GA 2OFOA 1F6BA 4KFRA 2B8TA 2WWXA 3THWA 1W36C 1OIXA 2CEAA 1L4YA 5ANRB 4PQYA 3ADKA 5CK4A 3OEED 2B7BA 2MSDB 3K9NA 4K8OA 1OFUX 4ARZA 3EZ6A 2P5TB 3CX8A 1W49A 2REBA 4OHZA 2FFQA 1H8EA 3QE0A 2QE7A 3S1AA 1QVAA 4U00A 2JDIA 4YXWA 1AIPA 3P32A 2QMOA 2REXB 1X6VA 2FSFA 3GEIA 1Q57A 2B21A 3T5DA 3DM9B 5TMPA 1KK2A 3UANA 5FPHA 3Q8XB 4TSFD 3ZH9B 1U2RA 2SHKA 2BCJQ 1FX0A 4TLBA 4EPRA 1FMLA 3WBJA 2QORA 4IKEA 4Q9IA 5EE9A 1E69A 4G5RA 3CBQA 5AUPB 1W4CA 4GZLA 4ZDWA 3NEYA 2E1RA 4Q66C 4M4SA 1R5NA 1JAIA 2QT0A 3WRXC 3NBZC 1FPMA 1SKYE 3H1TA 1G8PA 1UBEA 4B32A 4K46A 3U3KA 4RD0A 3MSXA 1YZLA 4RZUA 5A4JA 1FL9A 5DSZA 2WZQA 4EJSB 4WIAA 5EP1A 1FW6A 3QPWA 1KO1A 1DG1G 5DI3A 3NIBA 4NCHA 4PQFA 3EASA 1ODFA 2Q3MA 4RKEA 1LS6A 1XCPA 4JL6A 1JEEA 1NMXA 2YC4C 2BM0A 4Q7LA 4C0KA 2WTUA 2UKDA 3QG5A 1IY0A 1W2HA 1IM2A 2V1UA 2Q21A 3TH5A 3BD9A 2W2VA 4LJYA 1Q21A 1UJ2A 1AQUA 1MT0A 2A5DA 4FMDF 1CS4C 4RFVA 5J40A 1XX6A 1NLFA 2R8RA 4M1YA 5FFMA 2VSFA 4A36A 2J9RA 3NBXX 2XJ9A 2GETA 2ZVPX 4IVRA 3FMIA 3BC1A 1FUKA 2BIFA 4QL3A 4RFSA 3AF1A 4IXNA 3GJ5A 5CB6A 5J5CA 1UAAA 3UXMA 1Z22A 2GVZC 1ZNWA 2ODNA 4JMPA 4LI0A 4PZZA 4B2PA 1XZQA 2IK8A 3CX6A 1KI6B 4DLSA 2ORIA 5HKKA 3FKQA 3G0HA 1P60A 1HQCA 1VYUA 4FMCF 4UNQA 1M8PA 2FFAA 4KODA 1XEXA 4EKDA 2QZ4A 4CRWB 2C04A 2V3CC 4A2PA 5E4FA 1US8A 1Z6AA 1YR8A 2HLDD 5DGXA 1E0AA 1JEDA 4ABYA 4G3XA 1OFTA 1QVRA 3DMDA 3LXRA 1ZM3A 1KSHA 5C46F 2NQ2C 5CB8A 3WHLA 2ASEA 5JBQA 1MR3F 1CR0A 4F91B 1D5CA 1E1RD 2WIAA 1Y3AA 1P73A 3BJIC 3RS3A 5JS7A 421PA 4URWR 4EDHA 1OT3A 4HYYA 5IF9A 4U7DA 3E70C 1RIFA 2JLUA 1YZUA 2ZYVX 4JBWA 1NY5A 2CXXA 1QHHB 2NTYC 3DKPA 2VBCA 1QDEA 3RSLA 2XGJA 3F0TA 5BN3A 1FNNA 4N3NA 4M53A 2C78A 2FSHA 3GLHB 1F2TB 4TSFA 1A2BA 2IS1A 2RGDA 1L8QA 4X8OA 1ZW6A 4AKEA 4AYWA 2JJ2A 2GAAA 3CRRA 3FFBA 4HUQA 2WWIA 4RJLA 2GZDA 1WF3A 2YNMA 4RD2A 2DFTA 3BK7A 4BLTA 3F5FA 2EQBA 3SYNA 4AG6A 1WBBA 4DSNA 4NPHA 4JL5A 1E9FA 3QEOA 4O2LA 2GHIA 1HT2E 2WPDA 2XNDA 2BKEA 4LHXA 1TQDA 1GNPA 1U90A 3CUEF 3QVUA 4HAUA 3FHOA 4ZI2A 3ZD7A 2IQJA 2PEZA 3GFTA 2ODWA 4QHSA 3VU9B 1ETUA 1OB2A 1YZQA 4RD6A 1AJEA 2R6AA 1DOAA 2WJYA 2ZJZA 4NONA 1SXJE 4QGHA 4PANA 1VCOA 4I1UA 4DIDA 2LKDA 5EXSA 3VR3A 2FNAA 3UG7A 3Q85A 5CITA 3K8YA 4UNSA 1XEFA 2FSIA 3LWNA 3AQ4A 3MCAA 4OI2A 3IGFA 1D2EA 2ZI5A 4OK6A 2ZR9A 1Z0JA 4KXFB 1R10A 3AGPA 2W00A 3VKGA 4HAZA 1N6KA 4HAXA 3AVOA 3CO5A 5FL7D 3RVBA 1E2QA 3W8NA 1H65A 3AVUA 1JBKA 2WMOB 4JVMA 4NHOA 2CCKA 1NL3A 2WAXA 2VQSA 1TL7C 4TMXA 4ITRC 2Z83A 2ONJA 4BLPA 1G16A 3IO3A 3ZLJA 2GXAA 1XRJA 5EE0A 1WP9A 1ZC4A 2ZETA 1WRBA 4UQOA 2D4HA 3K9GA 1DVRA 3H4MA 4BFSA 2QUZA 4E5UA 2QM7A 1E98A 4MQBA 3AUYA 4U02A 1ZM4A 3O8RA 1FOEB 5EE1A 4A1FA 4MDEA 4BECA 4ASUA 4D0GA 2D7CA 4DEXA 2QNRA 2V8OA 4QRHA 4NCKA 3GPLA 2OUKA 2ZANA 1SXJD 3M6AA 3W90A 2DYKA 3EZ2A 1W4BA 3MJRA 3PIRA 2J0SA 2WJIA 3D8BA 1K6MA 3FOZA 2W6JA 1DS6A 3A58B 3F8TA 3Q9LA 4URYR 1EFTA 4M1WA 4MRNA 1JPNA 2W6JD 4E07A 4ZV4A 1G8HA 2AHOA 1SVOA 4KV9A 5C2JB 5JEDA 1SXJA 2FEOA 3NKVA 4DZZA 5AWFC 1R0WA 5DHFA 1E2FA 2CBZA 3BE4A 3U7EB 4HB3A 2DFLA 4LRWA 1GNQA 4D80A 3ZIAD 4Q5IA 2ZIAA 1SZPA 5HKKD 4A0GA 4EJSC 1JR6A 3IBGA 2FU5C 3B60A 1CJUC 1OXUA 4C7OA 2J41A 2GEUA 4RSGA 1IN5A 2ZXUA 1T3LA 4TLDA 1CU1A 3L0SA 4LBYA 4QHYA 3SJCA 3KKNA 4PC7A 2HJGA 5IHPA 1EFRD 2CNWD 3SN6A 5F9FA 2OCYC 4YXWD 2OAP1 4G01B 5KU1A 4L15A 3R20A 4C2TA 4LHVA 2LKCA 3FB4A 1E4VA 5ELXA 3ADDA 4JLVA 2R2AA 4EFMA 2F43B 4G0NA 2IF0A 2B8WA 3ASYA 3QY0A 4RZ2A 3O47A 3ICQB 2EVWX 1XMVA 3IPXA 1Q1ZA 3OEHD 4DLRA 3B1YA 2QL6A 2H18A 5G41A 3A6PC 3W34A 3BBPA 2QA5A 4AIIA 3KJGA 4PSKA 4V02A 4LWZA 2VHUA 3SZRA 3T61A 5J4VA 1VIYA 1Z6TA 5AJYA 1ZYUA 2BJVA 3I32A 4KYUA 2L0XA 4RZ3A 2OXCA 3HJNA 4Q1BA 4BFWA 5FOUA 4DCNA 2YZ2A 1IJEA 3QI2A 1B23P 2O52A 1OPXA 2QMUA 1XPRA 3THYB 2Q9CA 3QKUA 2OCPA 2BDTA 4GPTA 3D3QA 3CPEA 5FR1A 1KSFX 2NO0A 2G1KA 4KSBA 3CF6R 4UNRA 4MGIR 1BMFA 1KMHB 2DY1A 3A4NA 2ZEJA 1HA3A 1KNQA 2J45A 2F7SA 3IHWA 2IWHA 3SBEA 3FHTA 1RRPA 1FNMA 3B85A 4ZO4A 1TQ4A 1Q1EA 3QEJA 3FEHA 2BBOA 4MKHA 2YYZA 3QPUA 1KAOA 3AVQA 4KU4A 2R6FA 3SS8A 2NO7A 3QBTA 2VL7A 4G5OA 4ZIRA 2WKRA 1AQYA 3X1YA 5AJZA 5EXPA 2AKYA 1KSGA 2ZI9A 2AL7A 2GA8A 1ZAKA 4Q7JB 1ONBA 4F38A 4AKHA 3J81k 3E2IA 4MKGA 3VQTA 1G4UR 2WJGA 1G3MA 1Z2AA 2J7KA 4XH9B 2GTPA 1E2NA 2IYWA 1W48A 3CWZA 5CYPA 1X86B 3ZZUA 2O8FA 3LQQA 1KO8A 5DIFA 2WHXA 1EFUA 1AKYA 5SZHB 1G8FA 4HDCA 4MKIA 2FX3A 4C0LA 3U44A 3A4LA 5G3ZA 2YWFA 3IEUA 1G8GA 1MOZA 2OT3B 1ZIOA 3ZVMA 1U0LA 2QAGB 3C14C 4BFXA 4TYWA 4IXMA 4Q18A 2ZRLA 5CM9C 3QXXA 1JI0A 3HWSA 2DR3A 1XD2B 4OI4A 1XTSA 5B30A 5JI2E 3G5UA 1TMKA 2QI9C 2KE5A 5DHAA 4M1SA 1E9CA 2H8KA 1U8AA 3L8YA 4IW3B 2NOAA 1DAFA 5SZJA 4KSCA 2V54A 2P65A 4JVNA 3A8TA 2WIBA 1GKUB 2ZITA 1KI2A 4LJ9A 3R9IA 4W9MC 4KAXA 2BMJA 2ODBA 4LBWA 4OJQA 5FTMA 4BE7B 4MYHA 2ODEA 2J0UA 2AKAB 2PLFA 4LOAA 4V0KA 5GJVC 4AWXA 4AC9A 2W58A 4HLQB 1XCGB 1P5ZB 5L3QA 5FBRB 1NMYA 2X2FA 4LYAA 2VLIA 2Z5FA 2GCNA 4CEJA 4I1OA 3NHBA 1COWA 1S9DA 4IJMA 1XNJA 2PH1A 4LYHA 1QG2A 5FUXA 3WNBA 2VP0A 3EPKA 3IEVA 2HEIA 1P9RA 1RKBA 2ZRDA 4LJ4A 4FMCB 4XVRA 2J3EA 2ZYWX 3CB4A 1BO6A 2QU8A 3AP3A 1KKLA 3VNVA 4WA7A 4JBYA 5EP4A
chains in the Genus database with same CATH superfamily
1EJ2A 3UJ7A 3GLGA 3O8DA 5FI1B 3G1WA 3QKWA 3TRHA 3LXXA 4DMUB 4I1SA 2EZ9A 4PZ0A 3RTDA 1YJQA 3HCRA 2BMEA 1U9CA 3PGLA 4MR7A 3H17A 4WZZA 4ZU1X 3VTKA 3WC4A 4E5NA 1T8TA 2GPBA 5LBUA 1KJIA 3UTMA 4N82A 5JYBA 5BXYA 2LAIA 2JFGA 3I0NA 1E66A 4FE7A 4CM9D 2AR7A 2FRXA 3DLBA 3DDUA 3T3DA 4B7XA 1GQQA 5CMWA 5ANLA 2E4YA 2OCAA 5HW0A 3VRHA 1VPDA 4H77A 3PV0A 4YV7A 4KB5A 4DJJA 5F52A 4Z1MA 1F20A 5JPIA 4EI9A 1AQIA 1PN3A 1QLWA 4OAPA 3HFSA 1CJSA 4RK4A 4K6HA 2HGSA 1ZNZA 1WDWB 5LP6B 2IQCA 5CFNA 3CWCA 1L3BA 2RHHA 4O4LB 5AO9A 1Y5RA 1GPBA 2YUCA 2I6XA 2YWDA 2F90A 3ZDBA 2BEKA 4BNLA 3ZHOA 1F48A 2Y93A 1Z34A 1G291 5SVIB 1T2AA 5MF6A 4OHMA 3SQWA 2J87A 2Y2UA 3U3JA 2I76A 2X19A 2OV3A 2DP4E 1KKUA 1IXZA 2O2JA 2O20A 3IPRA 4KL8S 3V2IA 4DMLA 2AUNA 3NZSA 3D6JA 1OD6A 1KDZA 1RM0A 4EG0A 4YAXA 2R2GA 4R2HA 1L2TA 2D1RA 4Z0OA 1HXIA 2WW8A 4B75A 2HFJA 5AM5A 8ABPA 1UP6A 3I5AA 1QS0A 4C5AA 4G65A 1E2DA 3QVWA 3KAPA 4B3HA 1GGMA 1WY6A 4CG0A 1Z0AA 3DZBA 4R7TA 1MM3A 4CM1A 1Q0UA 2BMDA 3HKBB 3HMQA 2NO1A 1Z5SC 3NWJA 1RZVA 4RZIA 3HM9A 4KC0A 4RC9A 1B89A 1DG3A 1KI3A 2H2IA 4KZPA 5DBOA 4YB8A 1YJ8A 3BDAA 1JSLA 4GLOA 3U7QB 3H6GA 1RXEA 4KUHA 1NSYA 5D3MA 1O08A 5HYVA 2F1OA 5F33A 5CA1F 3DYIA 2G36A 3PLWA 5AK5A 4BV9A 5HOEA 4GCOA 2NLOA 1W0JA 1K86A 3RUDA 4CF5A 5CCEA 1P75A 2AI3A 3UQ3A 3ROKA 1IWPB 2XCBA 3K9IA 1WEKA 3SVTA 1ECPA 2DHQA 5CM8B 4DLZA 1EFAA 2JLWA 4NG4A 3TJMA 2D0IA 3BQNB 3AIKA 2GJ8A 1SQ5A 2JBAB 2MINA 4HLNA 2VP5A 2P9FA 1V8BA 1GQYA 1XV5A 1VBNA 1E2PA 1Y8AA 4X9XA 1S02A 1T1JA 1WDKA 5IBQA 3RVPA 1XRRA 4YYEA 1UJJA 2Q9UA 2X7HA 4HDNA 4LNUB 2LRIC 2XXAA 2O0JA 3D3JA 4ZEWA 5G0FA 2EAUA 2OCGA 3M6XA 3HIZA 4EPZA 3V1UA 1K0FA 2ZS9A 4AIFA 1SFRA 2E4XA 3HUDA 3ICWA 5AI4A 5DNWA 3VI4B 2DBAA 2F6JA 5I9BA 3W3ZB 2PHZA 3CZQA 1M83A 1LDGA 3P9CA 1OIVA 3WNZA 2JFVA 2N75A 4Q4AB 4G5HA 3GNQA 4ED9A 3G8YA 3QBVA 1EINA 3G0CA 2YY6A 2QN6A 2BZGA 3EHRA 1E2UA 4N7BA 4N0DA 2ECQA 1FDUA 3IMGA 3DUFB 3R0VA 4GNEA 4V3KC 3KQOA 5SZKB 4Q3AA 3GAMA 1KI7A 3GDHA 1WPGA 3KSUA 5FOXA 2FQXA 2I3ZA 3NJRA 5NLLA 3DSWA 3WLOA 1J00A 4KBFA 4DV1B 4FWTA 2JG3A 3MPOA 4X24A 3LFUA 1MXFA 1CJKC 3PITA 3MJWA 3NVMB 3W5VA 4E85A 5GJCA 5K3CA 1Z2DA 1KMNA 2HD4A 2P35A 4K28A 4BNGA 1VLHA 5IKXA 1L8OA 1N2OA 1Y3HA 4OH7A 2HRDA 3HB4X 1PNTA 4EG4A 4HRLA 3GRCA 4Q34A 4GX0A 1VBFA 2X9LA 4NLLA 3F5QA 4RK5A 5CJPA 3URKA 2AYXA 2H11A 4YIKA 1GGEA 5AJTA 5K0SA 4QQ4A 2O2GA 3FKJA 3M6LA 1N2CB 3R5XA 5BQOA 1CUGA 1RWMA 2C9ZA 4YO7A 4DSAA 5L3SB 1PR6A 3CS3A 5LWQA 5JV5A 2XOKD 4IAOA 2R03A 1ZL2A 1OV4A 2B6HA 1SKBA 2QDKA 3KWJA 1NU8A 3PS9A 2NYAA 2PS0A 4L4SA 1JKJA 4KIFA 4CTNA 3EXEA 2PXCA 3O4IA 4Z4GA 5MFPA 1M6HA 4DJTA 1QRUA 2FQWA 1E99A 2FX5A 4A15A 5ENNA 3PKZA 3CVQA 1X9IA 3AHCA 3ENWA 3NI2A 1Q6ZA 2XZTA 1L5MA 2ZWIA 3C5CA 4HQDA 3LI2A 4PPYA 2Z6AA 1DIGA 3C41J 2VDWB 3D7MA 4XDZA 1K5GA 4F9EA 1QOPB 1CKEA 1W36B 5I7WA 2GEJA 2Z5VA 3UH0A 5JC1A 4CLOB 1XP8A 2J3MA 5LQRA 1EA5A 3AF6A 1Q7TA 3PL1A 1NLZA 2JAOA 1ZK2A 1YUNA 2UXDB 3Q2KA 1LD8A 4U7JA 1R2QA 3QELB 2HDNB 2DBVO 3IVRA 5ANRA 1KOLA 1FYDA 2ZJ6A 2VUUA 3TZQA 3PDIA 2VUTA 1T8UA 1MVOA 3HB9A 8GPBA 2YDYA 5FH9A 1L5HB 4LXYA 2YJ4A 3PTAA 2NW6A 3ROFA 2O5VA 3SZMA 1TRKA 2Z4TA 3FLAA 1PQ4A 2RHRA 4I3HA 4LV6A 2MSKA 3LPZA 2I3BA 3B9PA 3BJRA 2VT6A 2GASA 5ALQA 2O23A 3I73A 2V7EA 1LNZA 1KEVA 4REMA 2OBYA 4X84A 3I5XA 4GSYA 2ZSKA 3VZRA 3OWOA 1JNXX 1LK5A 3MWKA 4FZ5A 3D3WB 4ZGGA 2RB4A 4WUVA 3RSOA 3S0JA 1MZPA 2OC9A 1JR3D 3VR0A 1DXYA 5KI6A 4DMRA 1I4TD 1XCMA 2ZJ4A 1EZZA 1M7BA 4N5QA 5DF1A 5DGIA 3R9WA 1SCDA 1RHUA 4FZ3A 4MGZR 4PYMA 4YYZA 2UYCA 4GT1A 3RF7A 3P9PA 4EI2A 4RH0A 13PKA 1CHDA 1U28A 1WUKS 1ZBQA 3NVAA 5EQFA 3S5JA 5JISA 4NMLA 4R8PK 4AJNA 1BS1A 3C48A 3A4IA 4YT4A 3DDZX 2O2IA 3H5IA 4UTRA 2Y1MA 5JAMA 2ORWA 1E7YA 5F77A 4DA9A 2XQ0A 1Y8ZA 3VAAA 3HQ4O 1H6DA 3PPWA 4NZPA 1CP2A 1OLSA 2VHVA 2KLHA 5L7TA 2GF2A 1WPRA 5JNWA 5D1LB 3JWIA 4EW1A 5ES4B 5JJKA 3EIEA 1QQ6A 5A7DB 1WAMA 3F8SA 2OD7A 1NN3A 4LKAA 4IICA 2HOQA 3RYHA 3WSTA 1SHUX 1U5BB 4ZGBA 1F2DA 1V43A 4V3BA 1QWSA 2PLNA 1ZUNA 2FGKA 2QRNA 2DSNA 4G4SP 2RH8A 1DO8A 1MEEA 3FNRA 3SOPA 3DVLA 1WBJB 3PGMA 4BNDA 4D3DA 3CSSA 1TNBA 3MYVA 4HGRA 4ID9A 3EA4A 1D0SA 2VJBA 4K5QA 1KFBB 5AIJA 5DMXA 3DLPX 5BQXA 3OQPA 3Q0EA 4DR6B 4OI1A 2QP4A 2LNIA 3PUHA 2EJVA 3V4PB 3HXOA 1ZGAA 4TLCA 4DFDA 4KMMA 5JY1A 1P3DA 4FFRA 1LX7A 5GM1A 2IH2A 3I6IA 4YQYA 2DZDA 4UQYA 2G9RA 4HT3B 1FK8A 3E33A 5FF9A 1TKCA 3F1LA 3FMFA 5TVKA 5C32A 2UVQA 3ID6C 3E9YA 3OIGA 4KXXA 4MEJA 3AB3A 1JQ3A 1YTLA 2JLXA 1Z7BA 4G5SA 4ZZ1A 1QH8B 1YZKA 4IIXA 2ECJA 3LCVB 4K86A 1AUPA 5JD6A 5H82A 3ADCA 3L1JA 3ACCA 4U39A 3V7YA 3EH1A 3MT0A 3QVMA 3OTWA 1HV8A 4M7CA 2WP0A 4CMCA 1R4MB 3QARA 4G11A 2HDHA 2JBHA 5IFKA 5LXTB 2WUWE 5FJJA 4CEIA 1MH9A 1PFKA 1ZFNA 2JA1A 1DV1A 4GOLD 1XPJA 1HFEL 2PGOA 3Q98A 4KLRA 1US8B 4LY9A 4UVDA 2VRWA 4ARBA 5CNMA 3AOGA 3IQWA 4BTBA 1NWCA 1QFJA 1QG4A 2IPXA 3DV2A 3BG5A 3ESRA 3G0GA 4XI1A 4J8FA 2A9QA 3D9IA 4BVKA 3HCCA 3RS8A 3PX3A 2CV1A 2JIZD 1TNUA 2PA0A 1GVNB 4IGAA 2OFXA 4QREA 2PUHA 5LQMA 4R8MA 3O36A 1JAZA 1EXMA 3EUEA 4JJEA 1CS0B 3WRYA 3HPQA 3E9ZA 1KDYA 5CDTA 3FOCA 1F0YA 1RWVA 1XB2A 2J67A 2G7ZA 1PR9A 1UDXA 4HN4B 4JR2A 8MHTA 3UENA 3BGIA 3IBEA 5D86A 1ZLXA 4ARVA 1E1QA 4EA9A 4MJLA 3I8XA 4P3YA 4NJOA 5CERB 1IU9A 2FN9A 1JQBA 3CIFA 4UE2A 2RGAA 5JHGB 2DPGA 4JXZA 4LFAB 1Z5VA 5A0VA 2KLBA 5LNK1 4MR8B 1YULA 1EBUA 2P67A 2H7YA 4US1R 2AFHE 3RVKA 4D98A 1ZISA 1GTMA 1E5QA 3B9RA 1A9XB 2J1LA 3K5PA 3PUWA 4L0QA 4UUAA 1VKJA 4KK3A 1FFDA 1N4SA 1TB4A 4PR0A 3UW1A 4Y2GA 3JYOA 2IWRA 4I5GA 3UFXB 4CJXA 4DQ0A 3TNYA 4MVWA 4IYPA 1A5AB 4NV1A 4EPXA 3MYRA 2EG5A 1AU9A 5AN8A 2Q3LA 1RI1A 4MUBA 2PY6A 4QGFA 4JBNA 4ZGWA 3LG2A 2LW7A 1CZHA 4RHYA 3SX4A 3B1KA 4B4OA 4LJRA 1X8LA 2P6PA 1MFPA 4WH0A 3DO6A 1VLLA 2VZ8A 2X6RA 1W34A 1GGVA 3I6MA 3IS3A 3R7NA 4TKMA 2XODA 3MTQA 2AG1A 3RKRA 3SZUA 3WWPA 2HB6A 2HADA 2NX2A 4D3ZA 2DR0A 3CQCB 4A55A 5D66A 5EHNA 1H3FA 2GK6A 3MWYW 4M0KA 3CLKA 1FFHA 5CLJA 1U99A 1XQ1A 5H70A 2RCNA 3LH5A 2R11A 3O1HB 4XJSA 1H42A 1RI4A 1XRMA 1DC7A 2NG1A 1Q11A 2IEIA 1WV0A 2XV1A 3FI0A 2N1MA 3R0XA 5EXDA 5KWJA 3AY7A 2ZCVA 5CEJA 2XUQA 2JANA 1ES9A 4J6FA 2D59A 4EG7A 4ZTZB 1AF7A 1Z75A 3TW4A 4C4PA 4RGQA 3HCUA 1UH5A 3RU2A 5JARA 1P5JA 2GGSA 4QOGA 3QWBA 2WU0A 1HT0A 2ZJ7A 4W82A 5IYZB 1IHUA 1TQ8A 4QUHA 2JFYA 3M6UA 6Q21A 4RQTA 5JBIA 2X0NA 3CH4B 2UYYA 2VEOA 5JJCA 3OKPA 2QL7A 1GG5A 2ZPAA 4WXPA 2X1HA 5ALHA 4D8VA 1LPNA 3ZCXA 4YAEA 2ZJBA 1E8YA 1PT7A 2XEVA 3QGMA 3S6JA 3T9AA 2C98A 1BQEA 3CNOA 4F1KA 4L85A 3TE7A 1KFEB 4GM0A 1ZA1A 1UKEA 4BVAA 4CEHA 4HMOA 4ACKA 1ADGA 2VC2B 1T0JB 3QYPA 3VOAA 3ZCRA 3KELA 2IXEA 2VZLA 4WRRA 4MO9A 4NBVA 5EKSA 1JN0A 4F3RA 2WQ6A 5BT9A 3V2HA 2XEHA 3BDIA 1HURA 2AFIA 3U4HA 4M7OA 4C43A 3G0HA 5F9MA 4R51A 1KI4A 1YIOA 3QYJA 5G4LA 2C2YA 4CF3A 4CVNA 1UPCA 1XYGA 3KZVA 3IVCA 3EW9A 4IJVA 1YFJA 4MS3B 1L7VC 1OREA 4Y1GA 4BAUA 2GBCA 4XARA 5ITWA 1RQXA 4Z4CA 3KCQA 2QP9X 3O26A 1HSZA 4V0ME 3KOUA 3MVEA 4LNHA 4XIYA 4ZO9A 4RLYA 4XVQA 3AWDA 1GUAA 4EW6A 1NVXQ 2EFYA 2XRMA 4YONB 1QORA 2X41A 1UN8A 3BRWD 1OI2A 4RYLA 5B1DA 1HG1A 3GZSA 2V7VA 3S27A 3LJUX 1U0EA 4V3LC 2B94A 3B7GA 4BB9A 2OV1A 4BOYA 3OM9A 3RBXA 2B0CA 2MYNA 1NI5A 5KVQA 5HKOA 5JLJA 4M55A 1C0PA 1S9HA 3EVBA 4YCLA 3Q2OA 1L5WA 3GEMA 5HX7A 5LPNA 1GG2A 5BNIA 3HYRA 3M1LA 4J2TA 1YQEA 4ZQHA 4FHCA 1G3NB 4RK0A 5J2UB 1IMOA 2Q1TA 4F53A 1GZ5A 1A8PA 2JW5A 2C4VA 3OU2A 1PLLA 1NOKA 2QHXA 1OT5A 1RYYA 4FADA 4BRSA 2BN4A 1RKUA 4BLSA 2X5KO 1VKNA 3BOSA 3PVLA 5KINB 4Y7DA 5GINE 3FETA 2WV9A 1Y8MA 4RPHA 2YUTA 4YC7A 3HO1A 2OA0A 5MN5A 1Q15A 4JHJA 4ACLA 1DO0A 5L3RA 3SQNA 3IT1A 2ZKLA 4ZVUA 2R8PA 2ZI7A 2Y71A 1RVDA 1JJBA 4OSPA 3F5MA 5JTUA 1NT4A 4B76A 5IH7A 5EEHA 2F55A 1Z18A 2HA6A 1GOTA 4Z0NA 1ZLYA 4ZT5A 4J0QA 3SOZA 2EIJE 2Y6VA 5BN1A 2QJWA 3T5VA 4EMSA 3QXHA 4QWMA 2FZVA 3EGIA 1UK7A 1SUSA 4JIGA 1MOQA 4TQ9A 1Y98A 4DKJA 3EHQA 3T7RA 4YHHB 2OOEA 1WUHS 4R1TA 3LCJA 2OV6A 5T7BA 2DT8A 2YWEA 2VNJA 4Y2PA 5AW9A 4CCYB 4DDKA 3CGHA 2EJBA 3T7IA 1DPGA 2J4FA 4I43A 2XSZA 2WILA 4L3OA 2YV5A 1T6NA 3AEQB 1SZAA 4PC2A 4S04A 2NPIA 4RY8A 2ACWA 3EG5A 3AF2A 3E34A 1QYXA 1O95C 4QDTA 2HE0A 1T5OA 3N7UA 3IHTA 4NJMB 4I2ZA 2A86A 4LHZA 1EP9A 2IIQA 4EBFA 2FO1E 1TA0A 3S1AB 1ZD9A 3BK1A 3MG9A 1F5NA 3G02A 4PFKA 4YLEA 5EJGA 1X1SA 3FWVA 2HMSA 3HTKC 4R1UA 4AJEA 1TO6A 3DSRA 4FYXA 2IHVA 4RACA 3ZKAA 4S1NA 1P33A 2XH8A 3S2UA 3VNQA 3PNPA 2MUMA 1PWHA 4UXJA 3SO8A 2C2OA 3M3HA 1PLJA 1T9GS 2J5RA 4FN5A 5KYUA 2WXNA 4Y6WA 3BWCA 5JBNA 5HGXA 5B2FA 1V5IA 3G49A 1Q1BA 2HI0A 3OCVA 4EZBA 3PGA1 4G2TA 5C7OO 1L9XA 1ZOSA 4WASA 3I2KA 4BDTA 4F6LA 1QO0D 2BFCB 4I5DA 1ZKDA 4R1PA 4Q4LA 5G1OA 2AJAA 3KVRA 5C4GB 4NP6A 5IEJA 4HI9A 4NY1A 5BORA 1XXHB 4RHXA 4NZYA 4FMDB 1I3OA 5A9SA 5LYJB 1TEHA 4BHTA 1P5RA 4LJ8A 3WBKA 3RYCB 5CFPA 1VXOA 5CURA 4BVGA 2XPYA 2Q4OA 3PSAA 4IRXA 3FIUA 4GYJA 1VI5A 5ES3A 4DCSA 1RAHA 3AXTA 3T1QA 4RJIA 4BWRA 1ULBA 1XCBA 1VKRA 2PX6A 4RWZA 3SDZA 1QC5B 4B40A 2G09A 2GTIA 1VHJA 1YJXA 5HFNA 5KHOC 3SHTA 3A3KA 3C43A 4BFCA 3OPQA 1N9GB 3HB7A 3HXDA 3K2BA 2XADA 1E94E 2W2TA 4MUJA 1DJNA 4QDZA 2WM8A 1NVKA 1U2SA 2H08A 1BRTA 3L82B 3R6WA 1TN6A 1DKPA 1STOA 1A5ZA 1YCSB 3WLNA 4DLBA 4HAWA 3GMDA 1QWOA 1Z62A 1RMYA 3A6JA 1WBDA 5WRFA 3HHPA 2WXOA 3OE1A 2B7CA 4YJ2B 5EA2A 3CUWA 5LUBA 4ZQLA 4Y9DA 2KWOA 4JEMA 1SWWA 4ESEA 2HT6A 4ZCMA 1L5GB 1PAQA 1JPVA 1UMBA 2JGDB 2UYQA 3C74A 2Z6QA 2FUG6 1Q7CA 4PO1A 1U7WA 1QHGA 5T64A 3QPBA 1GNRA 4ECAA 3ZVYA 3I9V1 4LY3A 4LLBA 2P2GA 2QAGA 5ECDA 3LC0A 4CEMA 5FBWB 1BKDR 5JEEA 1ZESA 2HBRA 2PV7A 3JVDA 1RJGA 1EESA 2Z98A 1XTTA 2XB6A 3K9WA 1WXXA 1KI8A 4IIYA 5DBGA 2YSMA 1I6WA 1B7GO 1BEUB 2FG7C 3HEAA 1NPTO 4KYVA 4Y6GB 5C1PA 1L4MA 1JEQA 4HP8A 4XWOA 2B0JA 4MYCA 1E7UA 3OZ7A 4EHBA 1ST3A 4FI3C 1OWLA 2IYFA 3A31A 5I9SA 5C7YA 1DBSA 2BH2A 3TSYA 4X60A 5ESXA 4ZOCA 2P3QA 3NTQA 4U6SA 2NO9A 5AK0A 5BQ3A 4P31A 2JLQA 1MB4A 2KM1A 3W9GA 4WMLA 4D42A 3V1YA 1LDKC 1SCNE 4KPUB 4CMBA 2V5FA 3FU3A 1JIIA 3VR1A 1WEVA 4RD1A 3I1YA 3ZDXB 1NJ2A 3PFCA 2V65A 5EWMA 1KIAA 3GW4A 1O57A 4CIDA 3H1FA 1DWOA 4C7KA 1MM2A 1UAYA 5I8ZA 4CF6A 1W5TA 2C8KA 2R2LA 4ALMA 3ZHYA 1RRKA 1RXVA 1QVZA 2ZPTX 3AF0A 1QHHA 1R4NA 2GD0A 5H7XA 5K8VA 4BEWA 1GQOA 2FPWA 4ZUXU 4QTYA 3AUAA 3JPYA 4H7EA 2P5YA 4JJ6A 4JVLA 4A8TA 5C18A 2Y05A 2ZE5A 1U3CA 1E0KA 2OXRA 4RZQA 1ZR4A 5F9HA 1FMJA 5IJ0B 2AEFA 1A5SB 1E2HA 1OILA 3EAFA 3OFSA 2O59A 3Q79A 1KARA 3FMVA 3PQEA 2G1AA 4B94A 4BU1A 3LO5A 1V35A 3ZXYA 3SBTB 3PXCX 1ISPA 1R6AA 4HPWA 4RKYA 3I2IA 1ZGGA 3LRTA 4WCFA 3NIGB 2ETXA 3T1TA 5F35A 1GT6A 4YRIA 2F00A 3AYXB 1NTRA 4EY6A 3RUIA 4ANUA 4GTPA 3R7BA 3T7JA 2FETA 1GGFA 2I6FA 3D3EA 2VDUE 1W1WA 3OLZA 3PB3A 1QAOA 5EKQD 3N1UA 3NRBA 4LJ4A 2EINE 1CUHA 2GN0A 4L6CA 1KDVA 3T1YB 3GZNB 1N4DA 4TM7A 3X2QE 4FCWA 2H16A 3PZRA 3L0OA 4PYLA 1EVQA 1E9DA 1T3GA 5DCWA 1Z3YA 5TT0A 5T4YA 1JVSA 1FX0B 1X13A 3JYHA 1WE2A 2R9VA 4I1IA 4INJA 3AT1A 3FNGA 1QHXA 4RAQA 5EYLA 5HTKA 5KC8A 1FBVA 4DC0A 2WJZB 4Y2SA 4CI0B 4L5CA 4NEHB 2H00A 4R0NA 4PRZA 3I2DA 3AR7A 5M04A 3L41A 1AV6A 1GFIA 5CEAA 1RPTA 4YJ3B 2JHCA 1BX3A 4OKIA 2BHRA 4OAOA 2IHUA 1RD4A 5DM70 5DNYB 4F2WA 1MPTA 1TCUA 5C13A 1D8TA 1U8UA 2ZBUA 3CNNA 2P9PG 1I5OA 4GKBA 5ERYA 4ZU3A 4EH1A 4Z49A 1XWIA 2ZAMA 3UT5B 5EJEA 3B7TA 3LDAA 2Q4RA 3IP7A 4IHAA 4EOGA 5K01A 3K0SA 4XX1A 2FQQA 1R74A 1RW4A 1NVMB 3CX3A 1F2UB 2V3VA 2LWIA 1TGYA 3EDOA 1J5XA 2NO6A 3DAYA 2WMOA 1GN8A 2W93A 4TN1A 1T9GR 4WAUA 4XOIA 5DI3B 2V4HC 1KJNA 4LX0A 5CXSA 2DM6A 1EUZA 3DDTA 5JQWA 2YHCA 2GXUA 4QOEA 5E0KB 4UBJA 5F2EA 3TD2A 3ITKA 2Y6UA 3DSUA 1GZSA 1QZTA 4LUCA 1Y63A 5D5HA 5BWBA 3LGXA 5KZMB 3FUJA 1NM5C 2CL5A 4Y6PA 3ITEA 2A0YA 3ZCPA 2PUCA 1C8KA 1E61A 4UE3S 4PLFA 4M38A 3AKCA 5ARCA 4OXIA 5TV2A 3ZU7B 2O7RA 2DUJA 2M6SA 4Q6WA 2UYGA 4FCCA 4HWPA 5EL0A 3KXLA 1FP7A 1TYQG 2YXDA 4QBFA 1T2FA 4TL8A 4DC9A 1ZPDA 3YASA 1P0MA 1UC4B 1QJ4A 1WEEA 2H1HA 3G2UA 4ZCTA 4CG2A 3CLJA 3ULQA 1TD9A 3RO3A 4QE3A 1YYHA 3VMMA 4K81B 1XN1A 1N7GA 1PFWA 3R76A 3V2GA 4D9JA 2VUHB 3QLUA 5AW2A 3B1VA 1KEKA 4RCVA 4BTAA 1HORA 4QFDA 2RJOA 2VRCD 2YY5A 3BMCA 3DEHA 3EWNA 3R9MA 3FRHA 1TM4E 1POWA 4PG6A 3SR4A 3NHAA 1PDOA 3IQFA 3P5BA 4BO6A 3CQ9A 2Q6OA 3ZYMA 4X1IB 1H2VC 1YZNA 4FFPA 2O8DA 4K1LA 2FW1A 1H4SA 1YR9A 3BEDA 4FS3A 4I50F 2BFAA 1ODLA 1BDBA 2WSYB 2W4MA 2PEYA 4MWCA 2R1TB 2ZTUA 3GA7A 1UXKA 2WWVD 2GN8A 4LZPA 4NOJA 2R8XA 5AXBA 4OHVA 521PA 3ZQ6A 2WU3A 3BCRA 4R0VA 5BV8A 1GPH1 1Z07A 5F1YA 4JFRA 2G06A 4TKZA 4RGBA 1SR8A 2V7QA 3ZW8A 1Y1RA 1LSUA 2OEVA 4ZI7F 1U02A 3QTBA 4BE4A 3B78A 1VTKA 5JJLA 2Z43A 1YQWA 1A5TA 3K0BA 4HLUA 4IDOA 4IS3A 3JXJA 4UI9K 3FUEA 1JG1A 2FUKA 4HVTA 5P8WA 2Q5JA 2HK7A 3KTDA 1VKHA 1DJPA 2LCIA 1FDWA 1SQSA 2IFTA 3TGOA 1GAJA 2RHTA 3JQPA 4G1VA 4LRTB 1RWWA 3EH2A 1AHPA 3MTJA 4TT3D 3ANYB 1UR5A 2XA2A 3GJTA 4MYRA 4RIFA 4C08A 1BZYA 3FR7A 3TSWA 4CQJA 4G24A 2AUTA 1XLUA 2XUZA 5LQSA 1M7GA 1C2TA 2IVZA 3D4BA 3OP1A 2OEWA 2QTZA 5FPPA 3QQ5A 1VL6A 2WYUA 4BO8A 3VOSA 2PSJA 4IPTA 1GAQA 7REQA 1PF7E 1JDSA 4CLOA 1XL0A 3LRXA 3LT4A 3QX3A 4IFBA 5LZ4A 3UC9A 1OC2A 5TB5A 4DVGA 5BNZA 1UBHS 2JZOA 3K53A 1RZ3A 3EJNA 2H4HA 4KLNA 1T1GA 4IUYA 4LJAA 2XB4A 1AF4A 3F6BX 3X1DA 5E7JA 2QTHA 2RBKA 4BNHA 3I92A 1VL2A 3E3OA 2VTBA 4KDCA 4NFHA 3RE1A 3L8EA 2YW8A 4XKBA 1F0KA 4BKUA 1VGRA 2KBFA 1SUDA 1E7WA 3DW3X 2ABWA 1MX9A 2GPSA 3L93A 4GC9A 4IWNA 4LJLA 4V0NA 3ZKWA 3JSAA 2YJGA 4W5RA 5BQPA 3ZUGA 3R5JA 3OESA 4RV9A 5JOQA 1LEHA 2PBZA 1W87A 2UYHA 2CV2A 5EXEA 4M8NE 1Y5MA 5L6MB 1EP1B 3EXIA 1VZ3A 3ZX5A 1A9YA 2XGMA 4GYYA 2JGAA 3RPGB 2NAAA 2PS3A 2WJHA 3AM3A 3GGDA 3GPCA 1NTOA 4YR9A 1U2GC 2IY9A 1KMHA 5JMTA 2VAXA 1UBNA 3FOBA 2FG6C 3IKLA 4MIYA 5CA0F 1R0BA 2FSGA 2PZBA 3D9QX 4S1VA 2ATIA 2OKGA 1TCAA 1YS7A 3DMGA 4I4LA 4U9IS 1NYLA 2QNBA 3T0GA 4QNMA 1RKQA 2DUMA 3P9ZA 4P5PA 5CRVA 1II8A 2GR9A 2OQ2A 4Y2HA 5C8YA 3EN0A 4D9EA 3EWSA 1IN7A 1J21A 3LJKA 5SYMA 3N6RA 4MPRA 1TYEB 3STTA 1N36B 4AZSA 5FV4A 3TQSA 1C41A 2RFMA 2BLNA 3CVJA 4LC9A 4R6XA 4C4XA 2PX5A 1DKNA 4XGIA 4PN3A 3K0FB 1BVYF 2H5EA 2YZGA 3COWA 3KAJA 3ESQA 1O8BA 3FCUB 1QJCA 5BYAA 3G0IA 3RYHB 1BXGB 3RT7A 3WY9A 3DMTC 1LA2A 3TW8B 1HYGA 4LPSA 4OVKA 3GP8A 3CZCA 2PUVA 2ZIXA 2M6KA 1O9HA 2FZLA 1MO6A 1P31A 3K5WA 3CEJA 3LK7A 4JJKA 1E3EA 1NDUA 1TF7A 1ZGJA 1DGQA 2OB2A 3H9CA 3KQQA 2N3ZA 3MJHA 4DREA 2SBTA 3HP7A 1YC2A 4QQKA 4MZDA 5GJBA 2YWRA 2YFKA 3LUDA 2OBMA 3LUJA 3NDJA 4KQMA 3V1MA 5JCOC 5M29A 4W99A 3R4VA 1T9KA 1SUFA 2IZOA 2PD6A 3P4UA 2YIDA 5EINA 2ZU6A 5GMOA 4GGMX 3T7KA 1EIWA 3VOBA 4U04A 3D31A 5IM5A 2E6KA 5EKXA 5ALDA 4IH4A 4O6VA 5DM60 3AG1E 4BJ3A 5HK9A 5J2TB 3A7EA 3SS7X 1KH3A 1U0SY 4R1MA 3L77A 3RHFA 3WKEA 5K8LA 1ZIPA 1I24A 3O03A 4E12A 5JCJD 4I14A 3ER9A 2XYVA 5DYGA 1DUSA 3I5UA 2JFPA 2F8LA 2G9UA 2JAXA 3M33A 4GYOA 1CRZA 1D4FA 1H2TC 4KLCA 4TXNA 3RVQA 3A1UA 4C87A 3WNBA 2RJ3A 1CFZA 4B3BA 5JNLA 3EXG1 1XJQA 3N2GA 121PA 3AQIA 4Q93A 1QPZA 2P40A 3KKKA 3G2VA 2DFPA 1O77A 3PF8A 1FEZA 1E1CA 1EZ1A 2FRDC 3CEMA 4BNNA 4DX2A 1NNUA 3BA1A 3LZCA 4RS4A 4Q9HA 3OJWA 4E5MA 3ORYA 2VGYA 3PFHA 2WD9A 4HZUB 4IG4A 4UJ5A 1O87A 2VJ8A 3MJDA 2PNNA 4JI5B 4MIKA 1M8KA 2QYJA 1GCIA 3GHHA 4WWPA 1NF3A 2AGVA 3AY0A 4AAYA 4ENUA 2HREA 3WTCA 2ZRQA 3UAXA 3NIDB 1E6LA 1H93A 1HBJA 1A9PA 2W8ZA 2WDZA 4BBAA 5B76A 3FMPB 3EPHA 4HEHA 4OMDA 4QOSA 4RMIA 1SNYA 4UNNA 4HOQA 3ZYCA 4QO7A 1WILA 1Y48E 1OCOE 4GB9A 2W11A 3H86A 4IKPA 4N8SA 4C7XA 3ZJVA 1MX1A 3RCBA 5J5AA 1XTUA 3JARB 4KKVA 2H1RA 1JIKA 3JV7A 3KM0A 1IL0A 2VTDA 3D8NA 3R44A 2CT8A 2ZB4A 5HJ2A 5K0CA 4YMTA 1WNTA 3L7AA 4B3XA 3S99A 1A0OA 5H16A 2C4MA 2XCRB 5JPDA 3QVXA 5CTJA 1DTSA 3ENKA 3R4CA 5JRJA 1EM6A 1P62B 2K2QB 1JJ7A 2Q0HA 3B1ZA 4MA0A 4Y18A 4CTJA 3VNUA 4BS9A 4KVMA 3E9MA 1A9XA 1XPUA 4U3JA 2ZTSA 2UZIR 3P94A 3RUPA 1WEOA 4TTPA 3NXKA 4ILIA 2C2ZA 1B8UA 3KQWA 5EPUA 1JU3A 3KSMA 3MGGA 4RCYA 3SIWA 4I6GA 3OT5A 3OPYB 1BNCA 1PKEA 4HX2A 3ZOZA 3DSSA 5TPZA 4YR7A 1KK1A 4J0IA 2QSUA 4YRRA 2J6BA 1Q50A 3BG0B 4QPJC 3EMDA 3EFHA 5AM3A 1OFVA 1XMSA 3LYUA 1N33B 3UWSA 1PFYA 1WHSA 4LWOA 4TZKA 4AZTA 5HTOA 4YP5A 4PAQA 3RUAA 1J7KA 1XTKA 6REQA 2JS7A 5ICSA 1QBKC 3D6TB 4FMBB 1N5DA 2C20A 2NU6A 3FZEA 1BCSB 1ISRA 3A9VA 4H6XA 1VHTA 1EFHA 5H7PA 2C5HA 2JVIA 2R97A 3FPEA 3GH3A 3HDVA 2LGVA 3PHJA 2PRSA 4OGEA 4J8PA 2WXHA 1J1ZA 1UIRA 1ZMRA 2FHSA 2J7PD 3ISVA 3CZ9A 1OY3D 2OXEA 2V7BA 2HWXA 1OTHA 2Y1CA 4L4UA 4FO9A 4ZYUA 1XP5A 3MZ0A 1FT2A 1QIDA 1WXIA 4XOUA 2FEWB 5BXQC 1IUPA 1XQVA 3HGMA 4HGPA 5JXWA 4JOSA 1HG5A 1G7TA 3PUJA 2XEDA 4O2BF 4UFOA 1CUSA 4A0HA 3LKUA 1A8UA 2WIDA 4Q48A 3R7DA 4JLJA 4L23A 2GH1A 1T4DA 2Q6KA 3IXMA 5EUMA 3EIUA 1CTQA 2XRYA 3M49A 3R0ZA 3RT1A 3Q78A 3VH4A 4ZIRB 1E9AA 1JIVA 3ORFA 1NVTA 1JPUA 2ZBPA 2ZG6A 4IXDA 4PLGA 4OHCA 5EWLA 5IYZA 3JQGA 2OP1A 1JIUA 2VPWA 5FL7A 4XXHA 5HKPA 2HT1A 4YTEA 4INOA 1C5KA 1NBHA 4G09A 3I2HA 4EG5A 1MABB 3RSEG 2ID7A 2H07A 2JI6A 4KXYA 1RYFA 2CUKA 4FGUA 4RKFA 5HQTA 4DMHA 1MO2A 1G5HA 3IBFA 2W7TA 4C7BA 2CFRA 4PN7A 1F5SA 3F5DA 5B2ZA 1DV2A 4GA0A 2IYQA 3ZDQA 4GS5A 2OXIA 1IK4A 3GDOA 1NIPA 2FH5B 2JBAA 1I1OA 4GMDA 4YDOA 3D0OA 4F8YA 1S3FA 3DBVO 2EU8A 2MR5A 4EKEA 4AX4A 2XXBA 1ENPA 1XRQA 1QHNA 2HPVA 3FHEA 2W6IA 4X94A 3VV2A 4ESOA 5ENSD 3JTMA 2K7FA 2XXAB 5KVVA 5LU9A 3CA8A 1N32B 1QGED 3CKCA 1WLYA 2CDCA 2FN4A 3EJWA 4IDDA 5HS4A 2P69A 2QFCA 3N9QA 1DBRA 2G3YA 3OJ0A 4NRDA 1P9OA 4TYPA 4EIWA 1TTHA 2R8OA 5CMLA 2WSMA 4ZVRA 1UM8A 5KSPA 2CG3A 1T4CA 2YTZA 3ABLE 2YZKA 3I5PA 4GTMA 3B5IA 4L0CA 4JJIA 5CH5A 4Z0TA 3UKOA 1R4AA 4V39A 3PPYA 4HDRB 5ED0A 5F2KA 4NE2A 2CJWB 3EIJA 3NBNB 1N11A 2B2XA 2CXUA 3EAGA 1TM2A 4M36A 4M1TA 3EUAA 1BEZA 4IHQA 5FORA 2ONYA 2G67A 4P7GA 3KWFA 4X1YA 2LCQA 5AHOA 4E3WA 5AVWA 1QMPA 1WVGA 3TBHA 5H3HA 1ONNA 2F6RA 2IC5A 2P9CA 2X9QA 3EVDA 4AF8A 1S0PA 2BEWB 2HMVA 4TPKA 5T6MA 3CIAA 4IIHA 3WMFA 5FQ8A 2R05A 3UUEA 3ZW9A 1BVUA 4XQGA 5CNIA 4Z7JA 3ESCA 1GPUA 3EU5A 2QUHA 4XW2A 4I1OB 5DLEA 5MGBA 2KWJA 5C8DA 1EA7A 1P4GA 4R2IA 2WMNA 4CF7A 5FWYB 5K0LA 1T4BA 3ZYZA 4LERA 2C4KA 5HCNA 4Q01A 4KBYA 4BKQA 2H6FA 4P58A 5KYYB 1CQXA 2FE1A 3BHNA 3DMRA 3NOQA 3QFTA 5D3QA 5I7AA