3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
b'DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
2QTFA 3PENA 4K8OA 4TMKA 4W5JA 1KY3A 1VG8A 1F2TA 3LQRA 1S2MA 2VP9A 1TNDA 2P3SA 2DBYA 4WBSA 3GJ5A 1R8SA 1W0JA 2ZYTX 4DEYA 3EC1A 1EFUA 2O8EA 3U6KA 3C4JA 4G5RA 1AQYA 1XJQA 1Z06A 4Q4JA 3BH6A 1YKSA 2BVNA 2ZSBA 2J0UA 4BRWA 2PT5A 4KYIB 2F55A 5HCIA 1CRQA 1QHHA 1VCMA 1P2TA 1JALA 2ZROA 4M21A 3RRNA 5F9HA 3EWSA 4Q1EA 3ZH9B 4FXPA 2TMKA 3BRWD 5SZIA 4JS0A 721PA 1KSGA 3REGA 2ZJBA 3GLGE 1G20E 2CE2X 5G41A 1XTQA 2FPLA 2VL7A 4HUQB 1E2HA 5HTKA 5FOWA 4ESHA 4LUCA 1N0VC 3L43A 4LBZA 1ZD8A 2CVHA 2IHYA 2O8CA 2O8FA 4Z8YA 1EG7A 1KJZA 1ZIPA 2EYUA 4LYAA 3L0PA 1JQJC 2VHJA 3R7WA 1UEJA 3L2OB 2WWWA 2J0QA 4CEIA 3CX7A 4XIGS 2YHSA 2BCJQ 1HURA 3F3YA 4DJTA 4IOLA 4TSFD 2EVWX 4V0OA 3X1XA 4C2UA 1DAGA 4FMDB 1K5GA 2ZE6A 2JJ1A 2R6DA 5FR1A 4LSGA 2Q6TA 3TVDA 1W47A 3LVQE 3Q72A 2IT1A 2DFNA 2IYWA 1JPNA 4IFEA 2Z43A 2HLDA 4PPFA 3IEVA 2GK7A 3KDSE 3THXB 1E1RD 1XEWX 4IOMA 3WRXC 2J87A 2JLSA 1KO8A 1EGAA 3CRRA 5DO9A 4V03A 2AWNA 2QENA 4TMVA 3UMFA 2ODWA 3KJHA 4Q7JB 3D3QA 4V02A 3T12A 4BLPA 3ND9A 3U44A 3KJGA 3VNVA 3OHMA 3Q3JB 1QVAA 2A7QA 4IDHA 4B33A 3P20A 5FL7D 1E0SA 1E3MA 1E9FA 3IPXA 1YZLA 4URZR 4XTCS 1VCOA 3CUEF 1VG1A 4HB3A 3B1XA 2B92A 3AF1A 3K0FB 3B85A 4Q00A 3LLUA 3I3SR 5JMTA 3W6PA 2NZ8A 2DY1A 5J4HA 4JLMA 3C5CA 4DEXA 2CXXA 1M74A 3W6NA 2UZ3A 4WXPA 5C2JB 2CL6X 5EUQB 2FSFA 3LAWA 3QIAA 1XMSA 1AS0A 4XTRA 1KSHA 4B3BA 4M1TA 2H5EA 1WQ1R 4A0HA 2ZRNA 2BJVA 1SXJD 3QPWA 1Z3IX 4QM7A 3FMFA 1ZC4A 4P31A 1MRNA 1CP2A 2ORIA 4B6EA 1XEXB 2RGGA 2CK3D 3BFXA 1OH5A 3EW9A 4QJ3A 2R6GA 5B2ZA 4C7OB 3RYTC 1EXMA 2A5FA 2DYKA 1NJGA 3TUJC 1AS2A 1P9WA 4NYJQ 4W9MC 1T3HA 3NBXX 4AYXA 4DDTA 1GL6A 1WCV1 1P72A 2AXPA 1NVWQ 5TDHA 1E79A 1UBFA 1Z0AA 3A1WA 3AKDA 1TF2A 3A37A 1TMKA 3O8RA 3ZQ6A 2P65A 4E03A 1MOZA 4Q1CA 5TVKA 2OESA 2X2FA 3CF2A 3GJ8A 3QKTA 2IS1A 4RFSB 5JI3E 2BEKA 2G88A 1XFAA 5GVRA 2HYDA 3WNBA 2PEYA 4NCHA 5FUVA 2MSDB 1X8JA 4I1SA 3IDQA 1N6OA 3M1IA 3W6OA 3TAUA 5HR5A 3GLGA 2N46A 2YYZA 4Z1MD 4LHWA 4B43A 2JLWA 1RVDA 1BYIA 5JSZB 1JAIA 1NG1A 2CHQA 4X8HA 5FTMA 4MUAA 3TBKA 2XTNA 2RGEA 3NEJA 5EP3A 4PXAA 4KU4A 3I5XA 2ZRBA 4UQOA 2ZI5A 4ZIRA 1SKYE 3TUIC 1QG2A 2PLRA 4L9WA 2YKGA 1T5IA 5EZ5A 4HAYA 2WOJA 1E2DA 4LOAA 3SQXA 4HLUA 2QORA 3B9PA 2FU5C 1G1MA 3DL0A 1IY0A 3NTUA 5FTLA 4KFUA 1DCQA 3ZVLA 4JBXA 3H1TA 3K0FA 2FX3A 1NVXQ 4KXFB 1OYWA 5FL3A 4ACBA 2P6RA 4Q47A 2H1LA 2VHQA 2GF9A 5EXXA 1N25A 2LKCA 3VMFA 4YXWA 4BASA 2QU8A 2CNWA 4PZLA 5FI1B 2CEAA 4LBVA 5AJVB 3CW2A 3VR3A 3B13B 1IAQA 1N5IA 3ZD6A 1N6HA 2GF0A 3GQBA 4NYIR 3U3RA 2QBYA 3BB1A 3AVYA 2H17A 5CLLA 1DO0A 1GSIA 2OAQ1 1PUIA 1XJ0A 2ZYVX 1SKYB 3SU8A 4N0DA 2Q3FA 4ON9A 1SVIA 4EUNA 2A30A 4DCUA 5FTNA 3SEAA 4MYHA 3U4QA 4C0AC 3NDPA 1AZTA 4IDQA 3PV0A 3L8ZA 2RGBA 2WJIA 2ZRIA 1G6OA 2WJYA 3IIKA 1UJ2A 4B2IA 4Q4HA 5GVSA 1R7RA 4D6PA 3TVTA 4BFWA 5B64A 2ZRJA 4QBGB 4Q1BA 1N2CE 3KXLA 2RB4A 4B73A 1JAHA 4G1UC 4PANA 1T91A 1PJRA 1RRGA 1TEVA 2AWOA 2OCAA 2F1RA 2P6UA 2QPAA 1V43A 3DHWC 3OESA 3R9IA 1HH4A 1X86B 1ETUA 2J45A 1II8B 1ZAKA 3FMPB 4A8JC 1XNJA 4NCIA 2IXGA 2F3RA 4MGZR 1U8AA 221PA 3IBGA 2IYSA 1GL9B 2VA8A 1R4AA 2V7QA 2EFDB 1N6PA 3NHBA 5KO2A 1E1QD 2JLRA 2QT0A 1GZSA 4TLCA 4FMCB 1Z2AA 1ESNA 3UWOA 4NE2A 5G3YA 2JJ2A 5EZ6B 2C77A 3C16C 2W2XA 4ITRC 2YV5A 3U2QA 3PEYA 3T35A 3P32A 4QBIA 1SVOA 1VG0B 5FTJA 3ZZTA 3RNLA 4E07A 3IHLA 1S8FA 3HU3A 4A8JA 5AJWA 3RDPA 4S2EA 1Q1QA 2JASA 2O0KA 4I1OA 3K1JA 4Q9KA 3N2IA 4XVQA 1HYQA 3JVUA 1P9NA 4DDWA 1NVVR 3CZPA 2IYRA 1GRNA 3DM9B 2YZ2A 1XMJA 1E4YA 3T1TA 2QRZA 1KK1A 2OT3B 3AKYA 4K81B 1KNQA 1UBEA 4A2PA 2IEZA 2QAGC 2FDCA 3MDBC 1D5CA 4FCVA 1OH8A 4WXRA 1I2DA 4DDVA 2R44A 3DOEA 2ONKA 4JL5A 1D2EA 1QHIA 4B48A 1G8YA 4TL7A 3AH8A 4NMMA 2WPDA 4C9BA 4TZ0A 4DLZA 1GL7A 2OG2A 2QQEA 3PUXA 1XF9A 3RSOA 4H1UA 2YVUA 1X8LA 2OAP1 2ZI9A 2JJ1D 1KI6A 5FBVB 4V0NA 5JCPA 5GJCA 1OXSC 3GLFB 1G3UA 5KOYA 2HLDD 2QAGA 1II9A 1U8ZA 4DT1A 4NH0A 2XZPA 4U7DA 4QFVA 3GMTA 4UXJA 1M7HA 2DHRA 2WICA 3AF0A 3T06B 1T0HB 2BHRA 2R65A 3U7HB 3QKUA 5KSPA 1BH2A 1ZM2A 3MLEA 5JS8A 3QNUA 4E22A 1H65A 4U5XA 1NN3A 2JATA 3TAHA 1BMFD 2GCNA 2J46A 4IDOA 4WW0A 5H1YA 2PL3A 2E9SA 1Z08A 1KMQA 1RJ9B 4TTQA 3GJXC 4MYUA 3ZZ0A 1W5TA 2WJJA 2Q9BA 1D2MA 5J47A 2ZVQX 3QKSB 2MMGA 4Q18A 3R9WA 4TT3A 2WM9B 2IK8A 1R5OA 3EA5A 2BM0A 4MRRA 3THYB 3AM1A 5B57C 3BB3A 2A9KA 4HZUA 4D25A 4KHZA 1CRPA 1WDTA 3QI2A 4N1AA 3ZGXA 5BXQC 3LY5A 1MABA 2YINC 3B7GA 3REFA 4ABYA 5JECA 1GIAA 1HUQA 2BKUA 1YR7A 2ZSFA 4ZKDA 5BN4A 2B6HA 3LVRE 4JL8A 1Q3TA 2FEOA 4GPTA 3FVQA 3IEUA 1BYUA 3IO5A 4Q01A 3MJRA 5D3QA 2BM1A 1HQCA 5KDOA 2C9OA 1E9CA 3AP3A 2VPPA 3PJRA 3S1AA 2HCJB 2W2TA 3C8UA 3T15A 2F9LA 1S9DA 1VYUA 3CBQA 4JLAA 3VTKA 4DWJA 2ZS9A 1II0A 2D74A 3GD7A 4ZI2A 3ASZA 4JVLA 5KNDA 1X3SA 5DE3A 5DYGA 4DSNA 2GJ9A 3CF6R 2CL0X 1KDRA 1E99A 2WVJA 4A82A 1L4YA 1KO7A 421PA 1J8YF 3PR1A 2ZITA 3LRPA 1TU3A 1ZINA 4BQSA 2FMXA 2FNAA 3ADDA 1JEDA 1G8FA 1E2JA 4POAA 4BLTA 5TY0A 3AUYA 1TX4B 4AG5A 2VP0A 4DC9A 1FTSA 3KB1A 4PO1A 4AKIA 2W0SA 2IUSA 4DLWA 3JZAA 2IS4A 1XD8A 4BEBA 4TN1A 4QJ5A 3KFXA 2BMJA 4D0GA 2H7VA 2ERYA 2ATVA 1CLUA 1SVKA 2NZJA 3T9KA 1PLLA 2O8DA 5FOVA 1F6BA 2IEYA 5BW8A 2JAQA 5K8LA 1OPXA 2NO6A 2YWFA 2ZANA 3CONA 4OI2A 1GUAA 1L4UA 1ZJ6A 2VSXA 4CF7A 2W00A 4RZUA 3L0OA 8OHMA 5E7JA 2IYZA 4R98A 1KI7A 5HZKA 4MKGA 4RZ3A 4B3FX 4TTPA 3AP1A 1RJ9A 4PO9A 3ZQJA 4JJZA 1VDZA 1B0UA 1S1CA 1W48A 2ZAOA 4PHFA 4KFRA 1KTVA 1COWA 3KL4A 3NHAA 4F4CA 1GKUB 2GBLC 4LV8B 4YXWD 2XAUA 3EZ7A 1U98A 2CNWD 2WJHA 1LB1B 1N6NA 1KI8A 1TF7A 3BIFA 1FW6A 2JDIA 2OV2A 4EQ6B 3BORA 3U3OA 2W6IA 3HU2A 1VG9B 2QM7A 3HR8A 2I1VB 2AD5A 4EFNA 2V55B 2A5YB 3RSLA 2GILA 1H8EA 1TUIA 2FFAA 2XB4A 3DOFA 5KU1A 3MG9A 4URWR 1E0JA 1TU4A 4XH9B 4A9AA 2C9YA 1QF9A 3R20A 1OFIA 4A15A 4JLJA 2GXUA 3W5IA 1CJMA 2GK6A 3OAAA 1IJEA 3PEWA 1QDEA 5AJYA 3D8BA 4URXR 2QL6A 4A92A 4LV6A 5E7MA 1N6LA 3KKQA 2GA8A 2IBMA 4XD7D 4RD3A 2PBRA 1ONBA 3K8YA 3SBDA 4GI7A 4DB4A 2O0HA 1UADA 4LYJA 2YJTD 3TR5A 3O8CA 2NMVA 2ZR0A 3QXHA 2EFEB 2NTYC 2QT1A 4M4SA 3CNLA 1KHTA 2W6JA 3VU9B 1TADA 1ZUNB 2G1JA 2GCOB 2VP5A 3TK1A 4JVSB 4KVGA 1I4DD 1QHGA 2ZI6A 2CMKA 3EG5A 1OFUX 1ZC3A 4LJ9A 4ZKEA 1CJVC 2LKDA 3CKLA 5G40A 1XPRA 2R9VA 1N5KA 2V7QD 1GRQA 2FZ4A 2D06A 1OSNA 1E9EA 4GP6A 1KO1A 1IY1A 5EUMA 5EE9A 4EJSC 5LD2B 3TSZA 2V1UA 2C2HA 4GZLA 1UAAA 1IQPA 5J40A 3TE6A 1TEXA 3Q9LA 4RSGA 1P2VA 3OF5A 1F2TB 4NYJR 1EWRA 3OIVA 5EQTA 4I4LA 2IXFA 3A4MA 4HLDA 4LK2A 1HE8B 3IPYA 4I81A 1ODFA 4TQUS 1W2GA 2ORVA 3E2IA 2O8EB 3KKNA 4HDCA 2BDTA 1LF0A 1E94E 1KI1A 1Z63A 5FPTA 2BIFA 2FN4A 4EJSA 4L15A 4UXIA 1KJYA 2WWHA 1EWQA 1ZM3A 4Q7MB 4KVAA 2J0UB 4UNNA 3T34A 1PLJA 1YR8A 3MGCA 2XSZD 1Z22A 3SOPA 1JQLB 4US1R 1X6VA 2FOLA 3NIBA 2A78A 3CRQA 4EQ6A 2XOKD 2DPXA 1P4SA 2ASEA 1G5PA 4P4TA 1UBGA 2I1QA 3CF0A 2D2EA 2WPDD 1JB1A 3QXXA 4LZZA 3Q7QA 1AM4D 3QXSA 2C03A 2MMCA 4C2TA 2VEDA 5GJVC 2ZRFA 2JLZA 1KI2A 2IA5A 4IDPA 2O8CB 3NG1A 3LQQA 2FFBA 1LVGA 1PLKA 4QL3A 4GOXA 1P73A 3MAAC 3AB3A 4RD4A 2IF2A 2QRNA 5DNYB 3R7WB 4MRPA 3L82B 4RCZA 2VIIA 3E70C 2NPIA 2P2LA 3FGNA 2IYQA 1YZQA 3HDTA 2Y8EA 4OQMA 5HKKA 4IFBA 4CEIB 2VP2A 2IWRA 2IXEA 2Q0HA 1W2HA 3AVWA 2IUTA 4A1FA 2JLYA 2BMEA 1K5DA 1QHNA 1OH6A 5JRZA 4LRWA 4JSYA 2GCOA 3TLXA 3RS4A 1OIWA 1MT0A 1LTQA 3BJIC 4R7ZA 3EXAA 2R6AA 3K9NA 4KV9A 2P5TB 4TMZA 4DSOA 5JRJA 2NO7A 4HAZA 1XTRA 4QHSA 2RKOA 3U44B 1ZW6A 4K46A 4OHZA 2ZM5A 4QGGA 4PSKA 2GNOA 1R0ZA 1OFHA 5TB5A 3WHKA 3KKOA 2VTKA 3AKEA 4B35A 3K09A 4MRVA 1W7AA 3P26A 1NY5A 1JR3E 5HE9A 4KSCA 5KPJA 4FIDA 4FINA 4D4JA 2VP6A 4BFYA 4GL2A 3SZRA 4P3YA 4P0TA 1E2FA 4NPHA 4JVNA 3TKLA 3KJIA 2BEJA 3ZJYA 2DWOA 1EFCA 4PPNA 4M9QA 4EDHA 2FE4A 4PAMA 3OIYA 3V4FA 3DKPA 3UXMA 3JVVA 4L8GA 4OI0A 1IBRA 2ZI4A 2FG5A 3BH7A 4LGMA 4LHVA 5FR2A 3X2SA 4ZI3A 5CLQA 4CRWB 1XTKA 5EE1A 3KQUA 1XX6A 1YU9A 3SFZA 2YWHA 3LX8A 3P27A 4LJ6A 1TQDA 4CYMA 1ZCAA 1Q3HA 4JLNA 3P4YA 5BN3A 1NVUQ 2EQBA 5EP2A 4ZDJA 4F38A 1N6KA 2J59A 1CJKC 2AN9A 3K9GA 3TNFA 4M9SA 5FBWB 1G64A 1ELOA 3QUSA 1FPMA 1MKYA 3MMPA 5CYPA 4F4JA 1MR3F 1N6IA 1K6MA 1O3YA 5E3HA 5CB6A 1C4OA 3RS3A 2KSQA 1ZMXA 2YOGA 3M0EA 4GSYA 4Q9LA 1R0XA 4FCTA 4UNRA 5CM9C 4IJMA 3QJYA 5AWFC 4DLXA 2SHKA 1GFIA 4JLPA 4QFMA 2YC2C 1OV4A 1VECA 2WWGA 2F6RA 2OXRA 4Z8XA 5KSOA 4P4UA 1P3JA 5J4LA 2DR3A 3EIHA 4KBFA 2Q3MA 2H16A 4IW3B 4QHYA 3KTAA 1G3RA 1OYYA 2J7PA 3M4YA 1E69A 5E4FA 2C98A 2ZE7A 3GLGB 4PHHA 3OFNA 3LDAA 3QG5A 4MQBA 4DVGA 2VF7A 2XTMA 2UZIR 4PPQA 1QRAA 5KSZA 1A4RA 1S9HA 4ZIRB 3I73A 3AF3A 5A5GA 1AKEA 2GHIA 2JDID 1NMYA 2ZI7A 1XTIA 1G7RA 1R5NA 2W6ID 3WHLA 4PSAA 1ZNWA 1Z0IA 4PC1A 4Q7KA 621PA 3I72A 2KI5A 4Q4LA 1US8B 1M8PA 3UK6A 4BFUA 2H8KA 3HYTA 1NF3A 5L3SA 1XCPA 4WVFA 1W46A 4ACAA 4BPBA 3ZIAA 4A0RA 4AYWA 1KNXA 1FQJA 1KZGB 3QF4A 2NO1A 1GILA 1W36C 3V4RA 2OO7A 1E6CA 3KKPA 5SZKB 2G83A 1CBUA 1R0YA 1KAOA 4JL6A 1P75A 2JEOA 5L3QA 4TMXA 4QM6A 2HV8A 3PQCA 5DYIA 1EFTA 1UM8A 3MD0A 2C8VA 2GAAA 1OT3A 3L0IB 4V0KA 5FOXA 2QBYB 1KKMA 4Q1DA 2JIZD 1IN5A 2V1XA 4CGZA 4TQ9A 1NLZA 3IUYA 5H70A 1XBTA 1PV4A 4DIDA 2FF7A 1KGDA 2V54A 4OJKA 1DE0A 1AK2A 5DN6A 4AKEA 3OEHA 3SR0A 1ZM9A 2W6JD 2OM2A 3U4QB 5F9FA 1EFHA 2EFGA 2FA9A 2CRRA 2ZREA 3W3AA 3LBHA 5LB2A 1JR3A 2QMHA 1CR0A 2R6FA 3U7FB 1P62B 5JCZA 4LDJA 4Q19A 4Q4HB 4HLCA 1SQ5A 1NI3A 4JVMA 2OLJA 2PX3A 2OBNA 2PZFA 2VHUA 1G7TA 2N42A 3VKHA 4QRHA 2CLCX 3RLFA 1VHTA 5DI3A 4AG6A 1T8UA 2IYTA 3FKSD 4FCWA 2HCBA 3DDCA 4YQFA 3I92A 3QBTA 4CDGA 1G3QA 2ZS8A 3VAAA 3EZ9A 2JLVA 2G0TA 4ASUA 3RS0A 4JSTA 3PEUA 4IRUB 2F43A 2AX4A 1UBCA 4D2IA 4EKDA 1KYIA 2WWFA 3WNDA 2QE7A 1I4LD 1A2KC 1I2MA 1OKKD 3HR7A 3U3MA 4ERNA 3OIUA 2RH5A 2XXAB 4PO8A 3DEFA 1XD2A 4A8JB 5KTYA 5AK0A 1OHHA 5FTKA 2H18A 5IF9A 3NEYA 4NKRA 2NGRA 4LJAA 2OEPA 4JLVA 2QAJA 5A0FA 2R62A 1XXHE 2PMKA 2Z4RA 5L3RA 1XMIA 2ZI3A 3SJZA 3AF4A 3CX8A 2AKAB 3CR8A 1US8A 1JBKA 3FM8C 3ZD7A 1YJ5A 4DLUA 3BC1A 1G3MA 3OE7A 1E96A 4OQXA 1N0UA 2QGNA 4KI0A 2BKEA 4JBWA 5KNCA 2AL7A 3GEHA 1G21E 3NKVA 2I3BA 2V3CC 3NH9A 2FFQA 4Q03A 1XPUA 4LY6A 2GJSA 2W83A 1FTNA 3MSXA 121PA 1KJWA 3DPUA 2A5GA 1UKZA 3GPLA 4RVCA 3A1UA 3OZXA 3QXCA 4YDSA 2VHCA 3N5CA 1U94A 4PC3A 4JLKA 2J41A 2FSGA 3CRW1 2ZRKA 2ZEJA 1CTQA 4MH0R 1IJFA 3WYAA 1G8GA 1KI6B 1U2RA 4M53A 5EP4A 4HDOB 3T1VA 2XEXA 3BFKA 3UPUA 2ANBA 4NP6A 3Q8XB 2QAGB 1SVSA 3SI7A 4DT1B 2ZRDA 1BO6A 1D2NA 5JEEA 3EC2A 1ZCBA 4XWAA 2HT6A 1Y3AA 1GVNB 5K8IA 4BFZA 3JZMA 3KJEA 2CCJA 4H9GA 4OHVA 2GZHA 4BEJA 1U99A 3LD9A 3QY0A 4BE7B 1NLYA 4TMWA 2X77A 1SHZA 2O52A 4C30A 2OWAA 3IIJA 3WBKA 2D7CA 2VP4A 4HYYA 1Z0KA 2JCSA 1E9RA 2LWIA 3HWSA 1NY6A 1GTVA 1Y63A 1OF1A 2X1VA 4ZDIA 1W0JD 4AKHA 1PUJA 4RD0A 3DM5A 2UKDA 4KLZA 5C4GB 2R6CA 4HZUB 4ZPXA 1P7CA 3B6EA 3BS4A 4JLBA 3MWJA 1G9XA 1MABB 4BUJA 3KB2A 3EPLA 2XXAA 2OE2A 5JI2E 3WBJA 3L0SA 1GITA 4Q1FA 1NIJA 4BECA 2IX3A 2QY9A 3X1WA 1Z6TA 2ODBA 3Q7PA 2L0XA 1FUUA 4DLYA 3LNCA 3QPUA 4Q7LA 3UG7A 3IO3A 4HB0A 3A4LA 4C0KA 5L3VA 2C78A 1W0KA 4YONB 1MO4A 1IM2A 3S1AB 5FPSA 2QI9C 1UDXA 4JLOA 5JS7A 1DELA 1MV5A 2OHFA 4AI6A 4MYTA 3W5JA 5J4KA 1SZPA 1KSFX 1HTWA 2VRWA 2XITA 1FX0B 5CIWA 1U8YA 3A36A 1EX6A 1C1YA 2GVZC 3GCGA 4YLGA 3KQKA 1VHLA 2CHVA 1CF4A 2EFCB 2VLIA 3LBIA 4IDNA 2GKSA 4PC7A 4PQYA 1E2LA 2Z4SA 3MCAA 2LCFA 1ANKA 3BBPA 4X8LA 5DI9A 4QC2A 4MRSA 2GJ8A 4A2QA 3WNCA 2AR7A 1AIPA 3LA6A 4IHQA 1AN0A 1XTSA 2ZSEA 4OI4A 3GEIA 3RRYA 5F98A 4HAXA 2BJWA 4IOJA 4F93B 1MRSA 4KFTA 1OIVA 1GOTA 3FYHA 3QE0A 3OFND 1Z6GA 1U81A 4LYHA 4LPSA 3OEEA 2BWJA 3DWDA 4FMDF 4ZV4A 2O8DB 2PCJA 4W7SA 1X8KA 4BLRA 4M0LA 5LDDC 4BFVA 1XZPA 2B8WA 4QBFA 2ZXUA 4WAUA 3PUYA 1OXVA 1DAKA 1IN4A 4RCYA 5C46F 3U61B 1DTSA 4KO8A 1EK0A 2V6IA 2NPFA 2QSZA 4D4KA 1M1YE 2DWQA 1ZNZA 4G5SA 5FPHA 1BS1A 5D3MB 4Q21A 3C15C 3AVUA 1GKIA 3CPHA 1J8MF 4JLDA 2VF8A 3W8RA 4BGDA 2ZRLA 3B9QA 1RRPA 2A2ZA 1N0WA 4B34A 2GAOA 1W4RA 2EU8A 3W8NA 3THWA 2IS2A 2BMFA 4RZ2A 5AUOB 1KK3A 3RWMB 1GP2A 1YHNA 2P67A 1E2KA 3NC0C 4M22A 2XJ4A 2F7SA 1AA9A 3E5HA 4O3MA 2AD1A 4IOKA 3EZ2A 5DN6D 3OEHD 1VPLA 5JJLA 2DB3A 4GMXA 2JGNA 3GFOA 4LYFA 3WYFA 2XNDA 4Z54A 1SVWA 3EWAA 3K70C 2IW3A 4NYMQ 3I32A 3CB4A 1CIPA 3A1TA 5CYOA 4AC9A 4CW7A 3OIWA 3FB4A 2QP9X 3SYLA 2GJAA 1TTTA 4TWZA 2Z6VA 4LHXA 5KUTA 4UNSA 3CWQA 3RANA 4L5BA 2MSCB 3CRMA 1DAFA 2IYYA 1E79D 1JPJA 1HEIA 1XJCA 4HAUA 3TH5A 1XDBA 2HF9A 3QG1A 3W34A 1OIXA 1FX0A 1Q44A 5FUXA 1G291 4Q9JA 4GP7A 2UVQA 3AV0B 1P60A 2AK2A 4EPRA 1YZKA 3T1QA 1GRRA 2CVFA 1ZP6A 2ODNA 4DCTA 4HUTA 4DRZA 1RW4A 3VNUA 1CJUC 1G3IA 1NIPA 2VHTA 3SHFA 3VR1A 5EE5B 4BLOA 4TLDA 1VTKA 5IK2A 4E5UA 1HY3A 2F1HA 1GNQA 3GLHE 3RS5A 5CM8B 3G5UA 1PVOA 3EX7C 3IKJA 5K8TA 1YR9A 3H2YA 3N70A 3KQNA 4FWIB 3RABA 1DG3A 2Z0MA 3K53A 3VHLB 2EWVA 4PFSA 2G1KA 1N5LA 4OI1A 5AUPB 2ZRAA 3U6BA 1R6BX 4ZO4A 2ORWA 2CRWA 1JXMA 1P2UA 1ZYUA 2PCLA 3DMDA 3KFVA 4HDQB 5CK5A 3UANA 1OHHD 1UPTA 1KI3A 2WJGA 5G53C 2JA1A 2W58A 1OXUA 3PITA 1RZ3A 3C7KA 3RC3A 1XRJA 4C4PA 4HB2A 3SE0A 1KZ7B 4CT4B 1FNNA 3G0HA 1XD9A 3AGPA 1J7KA 3HJNA 2MSEB 3OE7D 5D3MA 2J1LA 3P4XA 2E87A 4NL4H 2EYQA 3RS7A 4EJSB 2CCKA 1DEKA 3K0EA 4WIAA 2VQSA 4D26A 4D80A 1E2EA 1NN1A 3UG6A 1HQYE 5A4JA 5EXSA 1OXTA 2YWEA 3BK7A 3GFPA 4EFMA 3F5FA 5FOSA 4JIMA 3AVQA 4OYHA 4V0LA 3M6AA 4L9SA 4EAQA 2GRJA 4KSBA 3SJCA 1KDTA 4BLQA 4G5GA 5DIFA 1VYTA 4G01B 1KMHA 1L2TA 2ODEA 4NYIQ 4KYUA 2IWHA 4MYCA 1M2OB 3VHXA 3B1YA 4GT1A 4G5QA 4CVNA 2HYIC 1E1RA 3GLIE 1CKEA 3LXXA 4TTRA 1HV8A 4JMPA 2GEVA 4KITB 4IEEA 2GBLA 4M1OA 4XWKA 5GJWC 2GESA 2QSYA 3LO5A 4IVPA 4LBWA 1D8TA 4NTZA 1D6JA 2IYXA 4ESVA 4LC0A 2WOOA 4DB2A 2HUPA 4NU0A 2EFHB 3IIMA 2GETA 5K8UA 1S0UA 2O0JA 2JLXA 1SXJC 4URVR 3GJ3A 5IRCD 1T9HA 3FTQA 2Q21A 2Z5FA 4UKDA 4AK9A 5JWHA 4AD8A 1RPZA 1SHKA 5IHPA 4EFLA 4CEHB 4DDUA 1BKDR 3ICEA 2BBOA 2C04A 2C5LA 3FFBA 4Q02A 4LJ4A 4DXAA 5AJXA 2ZUCA 5DGXA 2GXAA 3X1YA 4HLQB 2OBMA 1GNRA 4M1WA 3RVBA 2RGAA 4A0GA 4F91B 2JJ2D 4JKYA 4AY2A 2BC9A 1FZQA 2WWYA 2VBCA 4PHTA 2FGKA 3I62A 4EPTA 5FBQB 4G0NA 2GXSA 3CNNA 5HE8A 2O8BB 1U0LA 1SULA 2CK3A 2WHXA 2ZR7A 3D6TB 1T3LA 4PZZA 1IY2A 3GJ6A 4FMCF 1NJFA 4LJ7A 3T61A 5C4MA 2PJZA 2CJWB 3O8BA 4DBLC 2D7DA 1G8HA 4DUGA 1Z07A 2RGCA 2WKQA 3U7EB 1NLFA 4RD6A 3UKDA 1W0KD 5DSZA 3GJ0A 4Q1AA 5FBLB 2H92A 4D0LB 2XNSA 2CLSA 3VX4A 3AKCA 3GLHA 4GOJA 4LI0A 2B21A 4X8MA 3EPKA 1CEEA 1FMLA 3Q5EA 4A2WA 1YZUA 3G82C 4MGKR 1EESA 4A4DA 3TUZC 1TQ2A 4A6XA 4PAOA 3VR6A 4Q9IA 1W4AA 2BOVA 2NG1A 3WMFA 4D4LA 3PIRA 3ZLJA 3I5YA 2AFHE 1YVDA 3NBYC 1YZNA 1NP6A 1Q12A 2WWIA 5EE3A 4UNQA 4C0QC 1XP8A 5JJKA 2Q9CA 4W5HA 3NBZC 3QXJA 1L7VC 3I8SA 3PEVA 4JZKA 3MWLA 3CH4B 5EE0A 4TL6A 4LC1A 3VFDA 1JXOA 2ZJAA 2G9NA 1Q1ZA 1FQKA 2CDNA 2DFKB 2XJ9A 3TMKA 4C0BA 3OEED 1RYHA 4A36A 3CNOA 1T4GA 5DISB 2JLQA 2FGJA 2IYUA 3P1JA 2CL7X 1M7GA 3CRVA 4YMSA 4QOSA 3EAQA 2KBEA 1AGRA 2ZR9A 3K0SA 5FOUA 4HSEA 4F4IA 3KTAB 1E0KA 3V9PA 1T5LA 1J99A 3CPJB 1CJTC 4UJ5A 4BFXA 3FEHA 3WMGA 3RHFA 1U9IC 4OQNA 2QEQA 2OFOA 4CEHA 5KDDA 3AEZA 3K0CC 1NBME 1KDPA 1UFQA 3LX5A 4OK6A 4TT3D 3ND8A 1DAIA 1E32A 4QXAA 4RFVA 3UIEA 4ARZA 3GLIA 3NH6A 3JUEA 2P6NA 2WBLC 3TQCA 2AHOA 3SUBA 2F1IA 2PZEA 1MO3A 821PA 3CPEA 1LNZA 3AVXA 3QEJA 3AVVA 4PC2A 5L3SB 1OXXK 5ELXA 4DIEA 2O8BA 1U9IA 1DVRA 1Z0DA 3K0AB 3QF4B 3DZDA 4M2LA 2JJ8A 5LBIA 1ZD1A 3KQHA 3K0CA 1G17A 1XZQA 4PPGA 1YZTA 2CJWA 2XTZA 2ZETA 5B30A 3BFVA 1V5WA 2XNDD 3EIEA 3TW4A 4Q9HA 2J5XA 4XVRA 3AUXA 5C18A 5L3QB 2WMOB 1IONA 2A5DA 4RY2A 1T8TA 2BBSA 3AGQA 2ZJYA 3LH5A 3VKWA 1XB2A 1ZUHA 4DKXA 3B78A 2NQ2C 4QGFA 2XX3A 1UEIA 1KSJA 1HE1C 3I4LA 1IN8A 1YQTA 2WKRA 2OCPA 1JEEA 5F2EA 4C3ZA 4N0EA 4TQAA 2G0NA 4TMTA 4LCBA 4GDFA 1W36B 1VIYA 3ADKA 2IC5A 3C41J 4M9XA 3L8YA 4MKIA 4AKGA 2QZ4A 1E1QA 3KKMA 1DAMA 3MFYA 3QKRA 4JT4A 4AIIA 3K70D 5IK2D 4ILEA 4Z51A 1Q21A 2B7BA 3T1OA 2IL1A 2PJRA 2O5VA 1NSTA 1FMJA 3SJAA 1RRCA 1WB9A 3KXKA 3WMEA 1EFRA 1OB5A 5DI3B 2Q9AA 4IVQA 5FI0B 3FMOB 1IXRC 2P57A 2WTUA 1Z0FA 4AWXA 1BOFA 1C9KA 3BERA 3SYKA 4RD2A 1CULC 1ESMA 4MRNA 3H86A 3TRFA 5IDVA 1WA5A 1E98A 4UJ3A 3MUFA 2G3YA 1N3BA 2NO0A 4GOKA 1VKJA 2RHDA 1E2QA 1HA3A 1ZD9A 2OSBA 4FI3C 5E95A 3SN6A 3ZVMA 2CHGA 2F43B 4QG7A 4UNPA 3EASA 1JJVA 1NKSA 5JHHB 1M34E 2WZQA 2QPTA 1IN6A 5IT5A 2D4HA 3TJZA 1F5NA 1G5RA 3ECCA 3B82A 4QNMA 1X1SA 2OFWA 3LJUX 4J0QA 3WXMA 1COWD 2WIBA 3VR2A 3AVTA 1IN7A 1G16A 3THOA 1E2IA 1XD2B 3TSWA 3ICQB 1Q20A 2ZJOA 1KAGA 2RGDA 1WE2A 1ZVQA 1GAJA 3GEEA 1W49A 3NC1C 2ZSDA 4L4UA 1DPFA 1GDDA 4PSVA 3TR0A 2J0VA 2VYFA 3BGWA 1P5ZB 1NN0A 1P2SA 1H8ED 2Z83A 5FFMA 2DFTA 1UKEA 1N5JA 2PLFA 3BWDD 3GFTA 3FFAA 2FSHA 5KNBA 2OILA 3EIQA 3QVUA 1R5BA 1KK0A 3K0AA 3NXSA 2EW1A 3A4NA 2BBTA 4FD2A 1H8HA 1S96A 4OJQA 5C1BA 1AJEA 4PTLA 4JYCA 1ZBDA 5FUWA 5KDLA 4B44A 1D9ZA 2WMNB 2PEZA 1L8QA 2ZAMA 3K9LA 3OAAD 4KLNA 4DZZA 3I1FA 1R8QA 4CEJA 4IXNA 2C99A 5CK4A 1YRBA 3IBYA 1QHSA 1NBMA 2R8RA 1BMFA 2ERXA 4Q4AA 4QBHA 5FPKA 2GCPA 1Z0JA 2RAPA 1MO5A 1WP9A 1WRBA 2G77B 4PQRA 4TYPA 1B23P 2ZU6A 3K9HA 3U5ZB 1LV7A 3I8XA 2YC4C 4C0JA 3CIOA 5EXTA 3C5HA 4H1VA 4P4SB 2C9CA 4AYTA 4S35A 5SZJA 1FFHA 2VO1A 4TL9A 4DCNA 3LV8A 1CR2A 4AURA 4RKEA 3RRMA 1E2GA 3LWNA 4IXMA 4DSUA 2OZEA 2NIPA 1HT1E 1YRAA 3U60B 3LW8A 3B8HA 2ONJA 3QOFA 4M8NE 1Q1BA 1E9SA 1NL3A 1AGPA 3SJBA 4NYMR 4FWTA 1NNEA 4O0MA 1XTJA 3NBFA 1G4AE 3A8TA 3CO5A 2ZYWX 4HUQA 1TUEA 4YDHB 5ANRB 4DUGD 2OCYC 4MGYR 2QM8A 2KB0A 1XCMA 2F9MA 3RAPR 3UMSA 4B6FA 4KAXA 4LBYA 3BD9A 4B2LA 4TLAA 4NHOA 1OH7A 5B58C 3FDIA 4FW9A 4MUBA 5CJPA 2KE5A 1S1MA 3X1DA 1QVRA 3FOZA 1YZGA 4X8OA 2DWPA 4FMBB 2GVDC 1G19A 4TYWA 1Q22A 4YMWA 1T0JB 3GP8A 3B1WA 2FH5B 4Q48A 4R2HA 1LF5A 1AS3A 2A3RA 1KY2A 4TYNA 2QQ0A 4HLUC 2V9PA 2HXYA 3U3JA 3KZ1E 1KKLA 3A1VA 1U0HC 2KJQA 2P5SA 2QTHA 4G5OA 5DLQC 2BV3A 2RGXA 1P61B 2IYLD 4HEJA 2ZUDA 3PVSA 3THXA 1OFTA 1A2BA 1LS6A 1RFLA 5BQ5A 2KWIA 4XVUA 2CCGA 2FEMA 1SVMA 1WXQA 1ZUIA 2QTVB 2ZU0C 3T5GA 1WBBA 1OJLA 3IQWA 4GZMA 4M1SA 2QN6A 4NCKA 3WP1B 4B71A 4EPVA 3HPQA 5BYKA 5HKKD 5J4VA 4WOPA 5CJ2A 5L8VA 2HDNB 4WZBE 1VCNA 5JWRA 4OQLA 1P9RA 2HXSA 3PCRB 5KSYA 4B2PA 1XXHB 2WSSA 2ZIAA 4TL8A 3PXGA 3ASYA 4HI0E 5J5CA 1S3GA 4P4SA 2GZDA 4HAVA 1XEFA 4MGIR 1NRJB 4ZDWA 5TV2A 3SFVA 1WBDA 1Z6AA 3A1SA 3A6PC 1LS1A 1XPOA 1RKBA 5LPNA 1YR6A 2QP3A 4Y0VA 2QGZA 1NN5A 3W3ZB 3J81k 1TQ6A 2ZRCA 4L16A 5JEDA 4QGAA 4JJKA 4RJLA 4DSTA 5KYKA 4II7A 1A7JA 1Z8FA 3Q85A 3EA0A 4D82A 1Q1EA 2V8OA 4Y0AA 5TXGA 5TMPA 1NMXA 4KFSA 5H68A 4LPKA 1RC8A 3ZS9A 1XEXA 2VH5R 3CZQA 3EZFA 1E9DA 2JLUA 1SKQA 4WZ6A 5AUQA 1Q57A 3GJ7A 1DAHA 2AFIE 4C7OA 4MA4A 5FH9A 3MRSA 1M6NA 1SGWA 4XD7A 2DCUA 2HEIA 3VKGA 1ZM7A 2OFXA 4DLSA 3THWB 1RYFA 5JBQA 3KXIA 4TLEA 4O25A 2PT7A 4W5WA 3TSOA 2IF0A 3LLMA 2XZOA 2GEUA 3VR4A 4NZYA 5JHGB 1CS4C 3CX6A 3H84A 4HATA 1IXSB 1GG2A 1ZIOA 3PUZA 4D81A 4NBSA 1PZNA 1Z47A 4NONA 4RFSA 2ZJ5A 3FMIA 2J0SA 1JNYA 4HZIA 5CIQA 3EZ6A 2ZTSA 1J90A 4KODA 3IILA 3WRYC 3B60A 2WKPA 1G6HA 3PUVA 2YWGA 3FE2A 4PC6A 2V6JA 5JSZA 3F0TA 1QHXA 4NCJA 5EXPA 2GZAA 3KQLA 1BIFA 1EFRD 4URUR 4LV5B 4YMUA 2RCNA 2ANCA 4ZCMA 5CB8A 3D7MA 1WMSA 4BRUA 3PUWA 4R2IA 2HJGA 2QP4A 3T5DA 4KCGA 1LY1A 1SVLA 1E9BA 4OHWA 3GLFE 3X1ZA 3K70B 1XEWY 4F92B 3CWZA 1NMZA 3WY9A 3QSYA 1W1WA 1XXHA 5BN5A 2J7PD 4IEIA 3QVVA 4N3NA 4C0LA 1TL7C 4LJ5A 1DAEA 4TZ6A 5KHOC 1KI9A 1FOEB 2XSZA 1XCGB 4OQFA 5JJIA 2XOKA 1UKYA 1IHUA 3DVLA 2FWRA 3ZZUA 4GNKA 3VR5A 4MKFA 2WIAA 3ZYCA 5LB4A 3W90A 4A6PA 1D9XA 2WWXA 1E4VA 5DHFA 1KK2A 3PFIA 4G3XA 4BFTA 3Q5DA 4BFSA 4JT2A 3FWYA 2WAYA 2FV8A 1DARA 2BBWA 3QF7A 6Q21A 2ZSAA 3V00A 2ATXA 3ZIAD 4QJ4A 4HAWA 4HB4A 4GMDA 1TF5A 3FHCB 1H8HD 2GDJA 3VQTA 1A82A 4OHYA 3FKQA 2F1JA 2DFLA 5UKDA 1CXZA 4URYR 2IQJA 2B7CA 2HF8A 1LW7A 3LBNA 2FJUA 1NBMD 1DO2A 2ZRPA 3EPHA 1Z6XA 4RD1A 1MH1A 1X1RA 3HU1A 1I4TD 3MJHA 1G41A 1II8A 1CU1A 4MDEA 1KMHB 4OK5A 1TQ4A 4I99A 5EP1A 2X2EA 1WF3A 4OK3A 1W36D 1AQUA 1JR3D 4OL0A 5CDFE 1SXJE 1DOAA 4I1VA 3NWJA 2QMEA 1W4CA 1YE8A 4PZYA 3RC8A 3ZVRA 4PHGA 5JLJA 2OXCA 5GADl 5FOTA 4B3DA 3N2EA 4R9UC 3ZVNA 2J9RA 1CR1A 4M1MA 1E2PA 4GRAA 2ZRGA 2NO9A 4YMTA 3BOSA 2P0EA 4MKHA 3WYGA 2C96A 1F48A 3O47A 4TLBA 3TGPA 1VYVA 3DMNA 4OBEA 4D4MA 4M1KA 3AF2A 1DADA 3ZDQA 2FZLA 1E2MA 2PMDA 3BE4A 2CBZA 4CIDA 4PR0A 4XWOA 2IHBA 521PA 3SYNA 2WAXA 3DO6A 1MO6A 2CLDX 5FPYA 2XB2A 1QHYA 2REXB 4ASUD 1M7BA 2ZQ5A 3UATA 4F7WA 1T6NA 1SXJB 4I1UA 2QE7D 3AP2A 4BLSA 4PX9A 4BWYA 2I4IA 2G6BA 2J3EA 2PH1A 3RRZA 1Z83A 3SBEA 2QG6A 2NOAA 2X19A 3F8TA 2ECKA 4JYBA 1FUKA 1JECA 1FNMA 3EPJA 4B47A 3U7GA 1R10A 2E1RA 5CITA 4NDZA 1UF9A 5HPYB 2W2VA 1XMVA 5AJZA 1NG9A 5GJBA 2D3WA 1ZU4A 4V0ME 3ADBA 2RGNC 4ZDKA 2AXNA 4XOIA 1UDWA 1F3OA 3GLFA 2BCGY 1T3SA 3PG5A 3UWKA 4XSHA 5E7IA 3DZ8A 2OCBA 4IKEA 2OBLA 3ETLA 4P33A 4WA7A 4U02A 4B74A 3GLHB 3LXRA 4TYYA 1F60A 2PX0A 3I61A 4B75A 2C95A 4M1YA 1OB2A 3QBVA 3SDZA 1QBKC 4NCNA 1KI4A 4EPXA 4TSFA 2R2AA 1FP7A 2RGNA 4UXHA 2XZLA 3FPAA 3AQ4A 2GEDA 2WJVA 3WP0A 2ZE8A 3H4MA 3U3KA 1G5TA 3AVOA 2WSSD 3QKSA 1R2QA 4EPWA 1JR6A 3FHOA 3THYA 3CM0A 1JJ7A 3CR7A 4IVRA 4LJ8A 2ZPTX 4WZAE 1W4BA 1RRFA 5FBRB 4YC7A 1ZNXA 1KO5A 3A58B 4Q66C 1FL9A 5J4YA 3UMRA 1Q0UA 3SHWA 1IOZA 5FL7A 1U0JA 4E09A 3TQFA 5G3ZA 3BH0A 3KX2A 2K5UA 1OE0A 2B8TA 1RIFA 4XJXA 5AUNB 2CE7A 4MDFA 1O87A 1EX7A 1NKTA 2ZJ8A 1NSFA 2QUZA 4JBYA 2ZRMA 3BXZA 4MITA 1IXZA 4ARZB 1JI0A 2PZGA 2QMOA 4P32A 3GLIB 1Z28A 2JIZA 2QROA 3EARA 5KPDA 2H57A 5CDFA 3BAFA 5JWOA 1SXJA 2GXQA 2ZS7A 3NVAA 4DCSA 3SQWA 3QEOA 2A5JA 3MWKA 3SC3A 4B3XA 1G18A 4JKIA 4ZCLA 2BMDA 2RHMA 2HT1A 3CH5A 5JFGA 4C0HA 1GKYA 1Z6YA 2YOFA 4ZCIA 1UKVY 3W9YA 4B3GA 1J70A 4BZXA 4US2R 1A5TA 4O2LA 1G7CA 3B2EA 4PAQA 2GJKA 1DS6A 2FSIA 2VSFA 1ZRHA 4F1PA 2X8AA 1QZXA 2KBFA 3KUCA 1AZSC 3B1VA 5DH9A 1QG4A 2GWHA 2V4ZA 2IUUA 3TIFA 4B32A 4DLRA 3R8FA 2ZUBA 2J7KA 1R0WA 1NVVQ 4BZQA 4D0NA 1F2UB 2ZVPX 4LWZA 1S3SA 4OHXA 3O8DA 4QGHA 3FKSA 2IS6A 1OLOA 1W5SA 2Q3HA 1ZU5A 2D62A 3HPRA 2REBA 2HJVA 2VSOA 4TYQA 5H8WA 2ZYUX 2EWWA 2GTPA 4QNRA 4EIWA 1U90A 4B76A 1DBSA 1ZM4A 2OLKA 1S4QA 3QKRB 4DCVA 1GWNA 4Z1MA 1OKKA 4KBGA 5FUYA 5HCNA 3VX3A 4Q4JB 1KOFA 2ZJ2A 3NDBB 2F3TA 4V0MA 1AKYA 3QQ5A 1J2JA 1HT2E 1QHHB 2YNMA 3E1SA 2B0OE 1W44A 1GNPA 2OUKA 3HYRA 4Q5IA 1OW3B 3MWYW 3QPVA 2FFHA 3ZS8A 1CR4A 2AK3A 2AKYA 1Z5ZA 2QNRA 3B1ZA 4O2RA 1E0AA 3H0KA 2YOHA 3BB4A 4LJYA 4RKFA 3IQXA 4PQFA 3ONWA 4GBMA 3HP1A 2IYVA 1A1VA 4BZPA 5EJEA 1G4UR 1GM5A 2REOA 4FN5A 4LX0A 1E2NA 2ZRHA 1VMAA 2N1BA 2O8FB 1N6RA 4M9ZA 3LFUA 5M04A 1XU4A 2ZE5A 3RWOA 5BYJA 5DHAA 4LHYA 1TAGA 2QPOA 1K8RA 3IGFA 4LHZA 2ZJZA 4U00A 4CT5A 4R71A 1DG1G 2WV9A 5AR1A 3D31A 3QENA 1XWIA 4RZXA 2FPKA 3SS8A 1G8PA 3TW8B 1TPZA 5F3WB 5HZHA 5LD2C 1VIAA 4OKSA 3K09C 2FPMA 3R8CA 1KIMA 4KJZA 4DLVA 4US0R 1P6XA 2W0MA 1E9AA 3VU9A 4QKQA 3GJ4A 4C0SA 4GFDA 4DHEA 1FP6A 1RE0A 5TARA 1VCIA 4B3CA 1ZNYA 3SNHA 5SZHB 4A0FA 2RMKA 4QHTA 4YMVA 3C14C 3IHWA 4DLTA 4EPYA 1KO4A 1G7SA 3AVPA 1KDOA 3B5JA 4XSGA 5BWMA 3FHTA 3DKVA 3R9XA 4CEJB 3ADCA 3KUDA 1Z2CA 2QMUA 5JZVA 4CZ2A 3CLVA 2QA5A 3LW7A 1LFDB 1Z29A 5P21A 2D2FA 1F2UA 4Q4AB 2XGJA 3RS2A 2WSMA
chains in the Genus database with same CATH superfamily
4Y2JA 4DY4A 3EVEA 3QGMA 3ZHVA 1RYNA 3QP9A 5JZ9A 4J8YA 5CMYA 1NR7A 3BRWD 5C3UA 3A6GA 5BRJA 5EMKA 1EUYA 2RSLA 4QPJC 4LUCA 1DRUA 2RI7A 5L6MB 2EYUA 2WP8J 3MNFA 3MXOA 4J3NA 2LAHA 1ABFA 4ID3A 1W1IA 4K88A 1EM8A 4YCAA 3RYFB 5FR1A 3TVDA 2DFNA 5LMUB 3SYMA 4QREA 5BO5A 3NQPA 4JD2G 4RTLA 4AZVA 2JLSA 4TXJA 3UMFA 1QHFA 4KE8A 4J0DA 4XEHA 4R9VA 3IPXA 5BQ3A 1BDBA 1P0IA 4FADA 1CNMA 3U31A 5HJEA 2UUAB 2CXXA 1R8XA 4RIGA 1EH5A 1VSVA 3MQ2A 2H5EA 2ID7A 4OQZA 2GD6A 2FZWA 3K6SA 2YYRA 3KSQA 4QM7A 3HO6A 3KZNA 3CHMA 4TT8A 1T0UA 3NHYA 2KW5A 4C6SA 3QK7A 1VB5A 4C7OB 5B2ZA 5LQCA 3A2NA 3MEKA 2Z98A 4BAGA 3R3HA 1AN9A 1U1CA 3ZQ6A 2G0AA 5EDSA 5ALEA 3M6WA 4R1MA 2PEYA 4I1SA 1TUBA 5JSZB 2OGUA 3RNOA 2RGEA 4M9RA 2I4OA 2FEAA 4J0GA 3LP6A 5EZ5A 3LPZA 1C8LA 1XL0A 5C7OO 3B9PA 5FZQA 1J0DA 1AGYA 3O6VA 3AQIA 1X14A 1DTWB 1RZUA 3ZPJA 4U2DA 3JU3A 4ZQCB 3WBFA 3B6ZA 5B78A 3WSTA 4XZ4A 5C4IA 2QBYA 3TEJA 3O9MA 5CLLA 2XZDA 4KK3A 4TYMA 2MD8C 5FTNA 1MT3A 4YRFA 1RQ7A 2WJIA 2NO5A 3WLAA 2WJYA 5COBA 1R7RA 3E82A 4Q1BA 1O5OA 4FBLA 4DCPA 3W5AA 1ARZA 2XCQA 1XNJA 3ZYMA 3DQVR 3I76A 3UYLA 3CLTC 4GPZA 5KO2A 2FZCA 4FMCB 3KUKA 3KV5A 5EZ6B 3U2QA 5AARA 2WPNA 3T35A 1UFVA 3RNLA 3K2EA 3HU3A 2JASA 1BQEA 1Q0QA 4AMBA 1HYQA 4QATA 4HS9A 4GYOA 3DF9A 1CUIA 2YZ2A 3O34A 3UWDA 2OT3B 3AKYA 3N3AC 1LDNA 2IKSA 2NP6A 2VYIA 5KQPA 4Y6PA 3F3KA 5LLTA 4R7LA 5AI4A 2NZ2A 1N5RA 2WPDA 5ILQA 2ZUVA 2XQ0A 3EXEA 4K2HA 1AUXA 4Q3CA 1YB5A 4LFAB 1JHAA 3F7TA 4U7DA 4QFVA 1PEYA 3NOXA 2FP4A 1YS1X 3OZBA 2ZRQA 1W19A 2Z8YA 1QZZA 1LZKA 2J46A 4NMLA 5E1DA 1RJ9B 2HSZA 1RWVA 1EDZA 3DE5X 4PZ9A 2ID8A 3KVNA 3R9WA 1N1MA 4CF4A 2M1XA 3RIXA 5BYBA 4L9RA 3QI2A 3IR5A 4OQQA 3ZGNA 1Z4JA 1JIKA 2KR4A 1M1ZA 3SF0A 3LVRE 3LBAA 1QGUA 4KREA 3RSZA 3H04A 1M3SA 5AP9A 1BYUA 3RU0A 5ENQD 3MJRA 2BM1A 2XE7A 5DFAA 4WZ3B 5JJ6A 4H6PA 5J2TF 2W93A 3I4CA 3BICA 4NBTA 2RGRA 2E85A 5JVDB 2P0AA 3ZCSA 4LWPA 2QDKA 5BW8C 4TV9A 4WESB 1TD9A 1G0OA 3NWEA 2G25A 5JYCA 2BD0A 3FAOA 5DOVA 5IN4A 2IKQA 1LLUA 4C1BA 4ALKA 2OCXA 2I2FA 3T9KA 3L1KA 4ZJUA 3IX7A 1MH9A 5H81A 2KS6A 1JXQA 4YT2A 4B31A 5BOVA 4OOEA 4O4IA 1YT5A 1R88A 1VYXA 1XQ9A 1U98A 1FW6A 4Y1RA 4RYLA 2I1VB 4NDAA 3BSFA 2YWCA 2XB4A 2B1RA 3SS7X 4YUXA 4XH9B 5IT4A 3BZWA 3WAKA 1U3TA 4IHJF 1CJMA 2WAMA 4JI3B 2OORC 1QZ2A 3LL7A 4TM7A 1RJWA 2MNZA 1Z8HA 2RBEA 4Z2AA 2M6KA 4L22A 3CK9A 4PF1A 4KVGA 3C3EA 4UI9J 2ZBDA 2AG8A 1R9MA 4JBNA 1UAAA 2GCIA 1IQPA 3IQGX 4PGHA 4H1TA 4ZHSA 3TW6A 3PD7A 2UZ1A 1PQWA 3D0KA 3S28A 3V42A 2O8EB 1Z63A 2P9KG 2G5PA 2ZZKA 1YCHA 4RTRA 3ULYA 4QICA 1O2DA 3CRQA 1DHTA 2C31A 4DABA 5CPFA 4O6VA 3A2KA 3CF0A 1MN6A 3ZI4A 2VJMB 3R76A 1AM4D 1KYVA 1M2OA 2VK4A 3P9ZA 3NG1A 3G2MA 3FYDA 3MAAC 3TPZA 3MJCA 4RCZA 3FGNA 5FO1A 5DASA 3HIZA 4PG8A 2VP2A 5LMZA 4DRXE 2I4LA 2Q0HA 1W2HA 5CA1A 1EUQA 3E8XA 1Y1PA 3MLBA 1L0BA 1H6OA 4RSYA 3CXUA 2DSNA 2FMUA 4TMZA 2HNBA 1JVSA 2COEA 2RKOA 3U44B 4CCYB 1AX9A 2JLCA 3KKOA 4PZ0A 2VZLA 2XMCA 1X2EA 4DRXB 3D3JA 1ID8A 4RLFA 2JVIA 5KHAA 4EDHA 3OIYA 4URKA 4OV6B 2F2TA 4F53A 3ULEG 3APFA 3LT1A 1TYZA 3ELDA 1U1IA 2ZBGA 4JI5B 4CYMA 1YB4A 1V0JA 4LJ6A 1LDEA 4LEUA 4XLTA 5BN3A 2BFEA 5DNUA 3Q3IA 3PGXA 1O1RA 2DZNA 4CM9A 3N39C 3OZWA 1K6MA 3GEBA 1NQWA 2KSQA 1ZMXA 1KBOA 2Q4OA 5IC4A 4WK4B 2EQAA 4E15A 3FNQA 1JEYB 3HB1A 1FDWA 3K5HA 5CRIA 2HUNA 3EXHA 1SBNE 2J7PA 3KSDO 2J48A 5ALTA 2P2GA 3QNWA 4OGGA 3H97A 1ZKDA 4ND5A 2XD9A 2FPSA 4E7PA 2ZI7A 3OBIA 3IQHX 4Q4LA 4R2YA 1QR6A 5GGXA 3DVRX 2GD2A 2CV0A 4WVFA 2I99A 4X00A 1KAOA 3D9MA 2NYRA 4TV8A 1KKMA 9LDTA 2EG9A 1OWOA 2ZUWA 3CNHA 3EZNA 2ZUUA 1Y9DA 2RHCA 2ZREA 3W3AA 2L0IA 5LB2A 1WEMA 3DZGA 1SQ5A 3PJDA 2PX3A 2C83A 2VHUA 1MJHA 2N42A 3UWSA 4IUBS 4EHMA 4GWKA 1IZZA 1WDYA 2OOEA 2GTIA 2I2DA 2IYTA 4FCWA 3G2QA 1WQ4A 4BVJA 5JMND 3UWMA 4F3CA 1JWFA 2OY0A 1RJFA 4WN9A 1UBCA 2BGJA 1BXKA 4YRKA 2H4ZA 4HXFB 1OKKD 3OF2A 3HR7A 1A4IA 4JB2A 1ST2A 3DEFA 1DC8A 4L75A 3LCUA 2ZI3A 1JBKA 5E38A 1RYEA 2MINB 4PZPA 5ALZA 4E3ZA 4AF6A 3JR7A 1U28C 5IBCA 1QIFA 4KMSA 4JLKA 2ZRKA 1CTQA 1IJFA 1RAIA 4C0WA 3W1WA 3DZHA 3DXKG 1XWWA 3SI7A 5D87A 1Z88A 4TOIA 3PUHA 4Z4IA 4FONA 2CG3A 3UGJA 3JQGB 4YUAA 3P9IA 4ZGGA 2ZZMA 2JCSA 2PSSA 4UMVA 1TO2E 1PUJA 3DM5A 4KLZA 2R6CA 4L2LA 3RVPA 1U2ZA 3BM5A 3VPDA 2OE2A 3FDFA 1UXOA 1GGJA 2WHQA 3KVYA 3WGJA 3HL0A 1EA7A 4JHRA 4RKRA 1CD5A 3ONKA 3TL3A 3DO5A 3IO3A 1J33A 1ZI6A 2X0FA 1UBTS 4TVKA 4XA8A 1AMUA 1UFRA 2XITA 3OEWA 5GM2A 1X1CA 3MCAA 3GDOA 3ZGOA 1FY2A 4BVGA 4UQPA 3W5VA 2YH2A 5T41A 3QW4B 4IOJA 2X5KO 2GN8A 4DMLA 3IAEA 1RWBA 3AUFA 2WRZA 2CNDA 4HNTA 2Q0XA 2W37A 4BLRA 3GFBA 1GR0A 1H2HA 1WOMA 5C46F 3CKKA 1Q83A 2HKIA 1SOAA 2MJLA 2OA0A 3MCUA 5I8WA 3R5JA 3HK2A 3HABA 1B8PA 3OJXA 1NBEA 3LUGA 4LYFA 1V41E 2IU4A 3R09A 3DEAA 3I32A 1GPAA 5CYOA 2H4WA 3L6EA 1IWOA 1EX1A 3CWQA 2IEIA 3ENEA 3ODGA 2HF9A 4GYWA 2YASA 4AT1A 2ZXFA 4R1PA 4KGZA 5K3CA 2L43A 4HUTA 3VNUA 4GOLD 2I91A 1VTKA 2FUG6 1H6DA 2ZUEA 3H2YA 5CT5A 1LLFA 1SBIA 4LE2A 3O1LA 2BCEA 3K8ZA 2YHBA 1C30B 2CD7A 1C7RA 1PU2A 4W8OA 4HB2A 3G0HA 2HV9A 1C1DB 5ITZA 4NL4H 3P9YA 3NAGA 2Q5JA 1E2EA 5KNBH 1BE6A 4U96D 1FFDA 3BK7A 3C7TA 1FS5A 4X3OA 3E7DA 3NAWA 5FEMA 2JMIA 4E2XA 3OUTA 3IE1A 3EB5A 3IUJA 3NPMA 2GFQA 4IJ5A 4KYUA 1V7QA 4MYCA 2R8ZA 3KZCA 2J3HA 5LNK6 4BVLA 1M54A 2E89A 4DB2A 4RPIA 2FMTA 3USES 4M0UA 5B77A 3PQ3A 4GE3A 4KE7A 2XGGA 3BG1B 4DG5A 4A0QA 2IE8A 1OFGA 5B76A 5AKXA 5EEHA 1NLUA 2ZUCA 3IMFA 2OVFA 3PDCA 3PLNA 1VL0A 2E4UA 4F91B 1W34A 4GB9A 4PZZA 1IY2A 2FEWB 1W29A 3ONEA 1AD2A 5C0OE 3DMRA 3G2KA 4F3RA 4BTVA 1TYCA 2FPPB 2HMUA 3QX3A 3TE7A 4I9UA 2KWOA 3OCJA 3THSA 4U0KA 3BN3A 4NNJA 2Z56A 1J8QA 1SK8A 1FYEA 1FC0A 1IHOA 4PYRA 3VFDA 4XR9A 2G9NA 5BXOA 1B0PA 3RVJA 2XLCA 3HWRA 2ZR9A 4ROSA 3CVJA 4C05A 1UK9A 5FOUA 3UM0A 4M49A 1Q7CA 2VTBB 2PU5A 1Q7EA 3RGGA 3ND8A 4CTOA 5H83A 1W6RA 1K88A 1ZOPA 5JG6A 4QASA 3PZBA 4RY9A 1CZNA 2C20A 5E2IA 4UI9C 1MO3A 3CPEA 4J8DA 5F7XA 1PSZA 5AK3A 4HGRA 1OX4B 3TPFA 1T5TA 1ZD1A 5ENSD 3CISA 3WZMA 1IONA 1QYWA 1VLLA 3W9GA 2WKRA 5HF5A 4C3ZA 3KPVA 1IB0A 3ADKA 3AFMA 4CQNA 3L8YA 5LX8A 3MFYA 4ILEA 3LT5A 3DB2A 4RLHA 2FLWA 2PJRA 4XLZA 2WE7A 5E6UA 3FLBA 1YR2A 2P11A 2C5SA 5SYNA 3VV3A 1BE8A 2F43B 5JCOA 5K51A 5B3LA 1JJVA 4OQDA 2BHLA 5L3ZA 2H1RA 5ERXA 3GOHA 1YNSA 2XQIA 3G02A 5TQ2A 1ZVQA 4DIBA 5K4AA 4HDRA 2Z83A 2HNKA 3V48A 4CTMA 3I53A 1XRMA 5KNBA 2F8MA 3EIQA 5LZ2A 4HGPA 3HUDA 2WU3A 4IXNA 5CK4A 2R8RA 4RCVA 4RYDA 1Z0JA 3DWIA 3VO1A 1ZUWA 4QVIA 3CIOA 3KB6A 3LPAA 5I7VA 1HDOA 4PWZA 3DLHA 3FANA 1Z38A 1HT1E 3ZHSA 4CBVA 5KTNA 1Y89A 4WBNF 4RHEA 2E4WA 1PR3A 3ZXXA 4BPRA 1GNTA 5ALLA 4RVDA 3T7EA 4KAXA 4DQVA 1BDIA 3PHCA 1U0OC 4YMWA 4L5JA 1EUCB 4JB0A 5DJ5A 2C8LA 3IDOA 4TYNA 1KKLA 4FTWA 3MD9A 1W4ZA 3FDJA 1VMDA 2GH1A 2HDNB 1G8SA 3AF6A 1N2OA 4CT0A 3ZHEB 4TL8A 3ASYA 3NHLA 1Z6AA 4C0EA 3T1NA 1E3WB 1OD6A 4II7A 5ITVA 3WGQA 4DS3A 1LD7A 1KZPA 4J7AA 2YV3A 1NF2A 3VVMA 3VKGA 3TQQA 1D8EA 4X6LA 1G66A 3RSGA 1Z4KA 4CYMD 1YJAA 4Q3AA 4F56A 3JASA 1WZUA 3OCZA 3GXBA 2P0YA 2PNFA 3UAOA 4AUNA 2HI0A 3B60A 3HDJA 4CM9D 2V6JA 3OCVA 2C5AA 1KJ9A 3JVIA 3GNSA 1F14A 3TJMA 5DP2A 1QHXA 4ZCSA 4ZCMA 1S89A 1FFYA 4G2VA 3X1ZA 1W30A 2OCLA 1XEWY 3VYVA 3PSAA 2Q8NA 5BN5A 2J7PD 3P0JA 3QVVA 2AG6A 4WGGA 2GHRA 4C5AA 3FUNA 3OKPA 2XSZA 2CJYA 4S3OC 4OQFA 3NNNA 2FWRA 1T8PA 2PXHA 2IOSA 3CHQA 4W5NA 2ZBPA 4U0UA 4RTMA 3G2OA 1LLCA 4BNWA 5HRCA 3F5QA 5JARA 1LPAB 2WG0A 3D6UA 3FKQA 3H17A 2F42A 3O3CA 1S70B 5DK6A 3HXMA 4Y2VA 3B6KA 3ZNIA 4L58A 5AH0A 3FDXA 1CU1A 3EZYA 2B1IA 4FDTA 2REQA 4K6CA 5IUNC 3C7CB 3H11B 1H2VC 3W3AD 1Q0HA 5K3FB 3NWJA 3RC8A 4PHGA 5JLJA 4PVCA 4B3DA 1EB9A 5B1DA 3EDYA 1Z0SA 4NBKA 3G2VA 2UYCA 1P0MA 2J67A 2OZPA 1FF9A 1VYVA 4Y67A 1F8GA 4L9AA 2Q7XA 4QWMA 3TWTA 1ODIA 2XB2A 3DTVA 1HEYA 1JNXX 3FA2A 1AHHA 2UXBB 2X19A 1FNMA 4X71A 2Y3AA 5I9IA 2QTRA 4JYMA 5AM2A 2DOKA 4JXJA 1YJCA 4N39A 4IXTA 4F1JA 5CEJA 2HA7A 2YIMA 3COSA 5DNVA 2B83A 2CVQA 4QDXA 2VATA 5H9VA 1LJUA 3TNDA 1AZLA 1XO1A 3KAQA 3H4MA 2HD4A 4XDZA 3U4IA 4J6FA 5A23A 3AXSA 4G4GA 4BNLA 2DBZA 3G2IA 2J3DA 1AQJA 4XYMA 3SHWA 2VDWA 1ILEA 1BX1A 1CNEA 3BG0B 3GAAA 1OE0A 3AXTA 4UHCA 4B4VA 4HDMA 1O87A 1XN1A 2RK3A 5F1PA 1RYZA 1KU6A 1Z28A 3OQBA 1SA0B 3ZV7A 2WD7A 1QAOA 1FFBA 4B3XA 1JCQA 3ABME 4CR6A 1G18A 4FOSA 4RY8A 2I2BA 4C0HA 2YOFA 4X1IA 3ZBPA 4BZXA 1A5TA 3MOGA 1PY1A 4KXUA 3R8FA 1C7ZA 1MJNA 4QGHA 1YRQA 5JYDA 2REBA 5E8JA 3TLGA 1DBSA 2B8JA 1S4QA 2B8EA 1FFAA 4RLSA 5FAXA 5FUYA 5KJ1A 4XDHA 1BXRB 2AQ8A 4V0MA 1T8WA 2X7XA 2AK3A 1Z5ZA 1USKA 1VI5A 4X7BA 2ODPA 4FN5A 5CURA 3L8CA 2ZE5A 1FRZA 4OXRA 3C43A 1DG1G 3ZJ4A 1EGHA 4I66A 5F3WB 1NKVA 1ZDMA 2W0MA 1MF7A 1T1SA 1ZNYA 3SNHA 5BR4A 3LHFA 5ENTD 4NPCA 1OROA 1QP7A 2E1PA 1AF4A 4W5JA 4MS3A 2AOUB 2PUFA 2M3HA 2DBYA 3CZ9A 4HTFA 1HE8A 4DQUA 3U1BA 1PJCA 4F45A 3U6KA 1R9JA 2WYVA 3Q78A 1CVIA 1E6LA 2BKAA 4I43A 1VCMA 2FG7C 4MDHA 2Q2VA 1GT91 3OCWA 2ZJBA 3WK9A 3HJGA 3NYRA 4UREA 1GAQA 2IIQA 4LBZA 1DDGA 1H93A 3CLUC 4FQ5A 2ZFUA 4ZJZA 5LZ4A 4IZOA 5D7BA 2D3TA 3QMWA 3GP3A 1X77A 2YHSA 1K5GA 2YW9A 1QGAA 2RHTA 2VG8A 3GDHA 2OZKA 1XEWX 4P3XA 4AIRA 3ND9A 2XT6A 3I09A 3QE2A 1E3MA 2PTHA 2Q9UA 3KR9A 5KWEA 4Q00A 1JU4A 3I3SR 2ZISA 1X7XB 3D6NB 1M74A 3JX9A 1JIQA 4J0HA 4C4XA 1KSHA 4DM4A 5A3JA 1M75A 3D5EA 1NZJA 1H22A 1Z3IX 2IPXA 1ZUD1 2O6LA 1W76A 2DFPA 4MB0A 2B98A 1CQZA 5J3JA 1ECFA 2A5FA 5KQMA 1NJGA 1ZO8A 4IDFA 1T3HA 4J8FA 1E79A 4NFYA 3HA5A 2PL9A 1SC4A 5C8VA 3VDNB 3IDQA 3WWDA 4K7JA 5J9FA 2HRZA 2X3YA 3QZUA 5IPFA 2ZRBA 4RQAA 4HAYA 4B9EA 1NA3A 1FBNA 3BD6A 5AW1A 1IBKB 5KVSA 1DCQA 2WLTA 4LBVA 1IAQA 1S02A 3U3RA 4YRDA 3BB1A 2KWNA 2CNNA 3C3MA 5LWHA 4ND8B 3SU8A 2AXVA 4KIJA 4P54A 1H0SA 2YZGA 2M32A 1T0BA 1G6OA 4YDWA 2PL1A 1R6UA 2IXDA 1T36B 3LZCA 2GASA 4ADSG 3EEBA 3W2IA 2H1IA 3HG0D 3SFXA 3R7RA 2CXUA 2J45A 1Z82A 221PA 2VA8A 4DA6A 2O1EA 1ESZA 1C9MA 4YJHB 4WQMA 5IAOA 3ML1A 2NYAA 1L7PA 1Q1QA 2JRCA 3CY6A 1IVNA 2PK3A 2ZBEA 5FORA 3KLPX 2IVZA 5EC8A 5KOHB 3EBOA 3ORRA 1DFIA 4C4TA 5JISA 4NICA 1AKQA 3N6RA 4NEQA 5KYVA 1SVNA 3CEAA 3U48A 1X8LA 4CF5A 2OAP1 1K1AA 3EVAA 2H1WA 5GGYA 5JCPA 1OXSC 3V5NA 1FLAA 3G0IA 3RV3A 5KNBD 2FMFA 1Z3CA 2ZYIA 4MLCA 4RJIA 4AUQB 4TRMA 4EY7A 3SQMA 2D1SA 3Q3VA 3SSMA 4UBIA 1BORA 3HM9A 4Q18A 2HM8A 3UFBA 5IASA 2BM0A 4O1HA 5B57C 4HZUA 4F7AA 1F3LA 1WDTA 2EBUA 3KO8A 5BN4A 3IDSA 2C2VS 4PDXA 2EJWA 2FEOA 1QORA 4UQYA 4QFBA 1MA0A 2KFTA 2WD9A 1Z39A 2XUHA 1ZJ5A 1P18A 4QDUA 1X9IA 4MQ5A 2FB9A 3WOHA 4IMPA 4G9BA 4U2FA 3RO2A 3ZDCA 2OPBA 3UW3A 2PXXA 2CZCA 1G8FA 1BU9A 2ZJFA 4BLTA 4Q82A 4GXRA 4EO9A 4PO1A 4EF6A 1JSXA 2ATVA 2DBVO 3NB2A 2JAQA 1RHJA 2VSXA 4HQNA 3L0OA 3W2TA 3EVZA 1M1NA 2VI5A 4IF4A 5HZKA 4X60A 1SKUA 3UAGA 3D6JA 2H11A 4PO9A 3KWLA 1NBOA 2AJLI 3RVOA 5KQLA 4M3NA 1SY7A 5HEKA 4BIMA 2M9MA 3OTHA 2JDIA 2W6IA 5IJ0B 3RSLA 1DKQA 5JCJA 2WA2A 1O4VA 4D4IA 4WY2A 1DFHA 1IJEA 4ND6A 3PEWA 2OWDA 4A92A 1QIIA 5E7MA 1N6LA 3L0DA 2IBMA 1HDIA 4YCNA 3O94A 2NTYC 4QUGA 2WEKA 3ZH2A 1MG5A 4RA6B 4KZ0A 3NIDB 4TTAA 4C29A 1O97C 1ECLA 4UBNA 1CJVC 3ZWPA 1YHZA 5FIUA 4UPEA 1WUJS 1WKVA 2AUNA 4EJSC 1K7XB 3NONA 2C29D 3EGXA 3OIVA 3CVOA 1HYGA 1B93A 4P82A 2ORVA 2B4QA 3RYHA 3UJBA 1Q2ZA 4D8UA 4AN4A 1EWQA 3UB4A 3RRNB 2XSZD 3VNAA 2BSXA 5AJUA 3H6GA 4Y2HA 4ZQFA 1CZHA 2PX4A 1V4NA 2W48A 1QYIA 1NNLA 2JLZA 2O8CB 4GOXA 5DNYB 2UYGA 4NAVA 3AL3A 4OQMA 1EVLA 2OXEA 5MN5A 3RB8A 1FS6A 2WNHA 5JSFA 1UCFA 1P80A 4E94A 1OIWA 4DR3B 4KV9A 4F71A 5JRJA 2FPRA 2Y99A 3D7KA 1O6ZA 4PRLA 3ZCUA 3V1MA 4FIDA 5IVKA 1YQUA 3ASGA 2V6FA 1QQ5A 4PYNA 1RLMA 5A2QA 5G2NA 1P7WA 5AXCA 1VLQA 5CLQA 3UHAA 3KQUA 5MN4A 1Z4OA 5A03A 3A9SA 4BGUA 1QFJA 3NFRA 2VPQA 3DXMG 4X3PA 3T7LA 1NDUA 1CRZA 1N6IA 4MP3A 4TVSA 4CKYA 3FCCA 5CEFA 2GGFA 1NV9A 4DQXA 3ZYQA 3QX7A 3RKUA 1SUPA 2IZ7A 4N7BA 1SVXA 5KKCA 4ZZ3A 4YO8A 1IYGA 3N75A 2LDRA 4C6RA 4LSZE 3TI9A 2RR4A 2UZIR 4DDMA 4BJ3A 1LQUA 1YB1A 1DKLA 4PLZA 2KI5A 3PD0A 3OOJA 3H5IA 3QV1A 2WFLB 4DTIA 3GYZA 2R7NA 4U0ZA 3CCCA 3HBFA 1CBUA 4PO3X 3WICA 2ARKA 2Z8ZA 5H9MA 2XBLA 4BV8A 4YFYA 3L06A 1QPGA 3SZUA 3C3AA 4OJKA 4PM4A 3GHHA 5B8DA 2LXHC 1EA5A 1FYDA 5JCZA 4FFBB 2ETVA 2JFBA 1GZ5A 5F2OA 3MN1A 4RNDB 2EW8A 3KSAC 1YMPA 3O38A 2R86A 4HH3C 4ZC1A 3VAAA 4UMDA 3EZ9A 2BSAA 1ZRNA 4ZOLA 4CLXA 1EK1A 4QULA 4HOTA 4OAVB 3N7AA 2FUUA 3HKEA 4O8CA 2YCBA 4L08A 5KTYA 3NVMB 3UT4A 1SXQA 4MMXB 3NBNB 2PZJA 3EF0A 2WXOA 1KP9A 4RTNA 5KNCA 3SC2A 4L1BA 1YU6A 4JNCA 4GX1A 1Z7BA 4YJFB 2VHCA 2WTMA 2GF2A 1TT7A 3FVRA 3Q8XB 4F11A 2QLJA 2OXFA 5G55A 3TGLA 1ZCBA 3K8OE 4RSRA 2ACVA 1T1RA 1VLZA 2EJBA 5K8IA 1B0AA 3D02A 3A7DA 5TMEA 2OK8A 1SHZA 8ATCA 4XEUA 4EVRA 1BMDA 3V1TC 1U6GB 3FB1A 4CR8A 4AJEA 2O2YA 1LH0A 3RK1A 5DHSA 4QT4A 3IAUA 3M9LA 5IMBA 2IX3A 2JAOA 3DWGA 3JD2A 2VC2B 1WESA 2YQ4A 3LNCA 3GW8A 4F9EA 2HRRA 3ZKWB 3S1AB 2XCLA 1T5HX 2EL7A 4MAMA 2H0QA 1RYBA 1JE1A 1TNOA 1XNFA 4HNHA 2LCFA 2I9CA 2DLDA 4PG6A 3HCDA 4QUIA 2R84A 1GOTA 3T5XA 4HDAA 3MUNA 2PYIA 1OAAA 1F8FA 5I01A 4O2BF 4QBFA 2ZXUA 3U61B 1EK0A 4S1PA 1ZNZA 4G5SA 4U6QA 5IJ9A 3AK4A 3ZWNA 1GR1A 3W8NA 3LY8A 2XQGA 4MRUA 3QNKA 3OE5A 4O3MA 2PIDA 3VK6A 5E6RA 4FSDA 2XNDA 4MUIA 4XX0A 1YVUA 3L7JA 5FP0A 4TWZA 2Z6VA 1T1JA 3CRMA 1E79D 2NXNA 3TH5A 3OJ0A 3W34A 1PJ2A 3B7UX 2AK2A 2NWQA 3WK4A 1RM5A 3RU7A 4LEIA 4E5UA 3ZC3A 3KQNA 1NXTA 1GGFA 1TT5B 4G8BA 1PO7A 4FGKA 4PX5A 5AUPB 1B3RA 3SOUA 2ORWA 1JXMA 2PCLA 4HDQB 3W4KA 2I03A 5IWAB 4Z4FA 1RZ3A 3FSGA 4GOND 2A58A 3ZEIA 3GT7A 3ZWYA 1VKOA 2VQSA 3P52A 4AIFA 3WVNA 1G60A 3WJ7A 2YIJA 5FOSA 1JDUA 3M6AA 3OM8A 3CLHA 3DNFA 3DAYA 3WG7E 2QYSA 4CVNA 2LBPA 2DT5A 3VKFA 2FHPA 4NFSA 1XWFA 2XZDG 2EL9A 2HU5A 4G26A 5K8UA 1S0UA 3S2YA 2YW2A 5F12A 3WJ2A 1DKUA 2VDVE 1I30A 5M7EA 5EJ2A 3NQ41 1JMYA 3MTJA 3CHPA 2NUPB 3P0EA 4EARA 1MQAA 4FO9A 5CD1A 2VBCA 1TN7A 2FGKA 3I62A 4GD3Q 5LBUA 1H69A 1CC1S 1NJFA 4CL8A 3GJZA 3D4PA 1R4MA 3QUBA 4GOJA 4BGVA 5GZ1A 1DLJA 5I7HA 1A9QA 4NRDA 2FR8A 3FEXA 3TQTA 2AFHE 3HQ4O 3QVTA 4NC9A 2ZB4A 1LPBB 1L7VC 3PEVA 1PD0A 4TL6A 2FUKA 2EDCA 4WKPA 3RW9A 2IQ5A 5DISB 2FGJA 3K0SA 2ZUFA 3KTAB 3URZA 2A9RA 4M54A 3IOYA 3GZJA 1U9IC 5JD6A 3Q40A 4L3WA 1RAFA 1V47A 5LBTA 3PK0A 2LXPC 3GL9A 4EW1A 4TWRA 2D2XA 2JGDA 1X8XA 1KZ4A 2DWCA 4PBTA 3LPLA 4WLFA 5DBOA 2IXTA 2A5DA 1V5GA 2ZJYA 3LH5A 4L23A 2ZQZA 3GGSA 3BGIA 4OMFG 3T0FA 5JXWA 4MKIA 4LKAA 3W77A 4BNHA 4XAQA 2QZ4A 3RPEA 4LVCA 4R3NA 4CL2A 3AG1E 4PS7A 4JA0A 5IDVA 1E98A 3MCTA 4J90A 2G3YA 1BD4A 5IH3A 1ZD9A 3MTGA 1XWHA 4D8VA 2QPTA 3Q7TA 3SDBA 4U7EB 5D5PA 3BWVA 3AVTA 4C07A 1MP0A 1SCJA 2I66A 1SK9A 4N49A 1CX9B 4PSVA 3UUWA 4RAOA 3IEIA 5JCJD 4OAUC 1OZHA 4LADB 4FGLA 2Q6IA 2YZNA 4B7ZA 2ZIZA 2EW1A 3A4NA 4Z53A 1AJEA 4GOOD 1GGHA 2NN3C 4JYCA 5KDLA 5C1PA 3GA0A 4OEHA 1XDUA 2IPOA 5A62A 4MB6A 2YV1A 4C0JA 4NN2A 4AYTA 2B3TA 4D1YA 1DC7A 1CR2A 3EMKA 1LPOA 3LWNA 4OL9A 1RPNA 4Y9DA 1SXPA 4TUYA 1XN4A 3HADA 3GW4A 5DGDA 3O2JA 2R17C 4AP9A 1TKCA 1FDRA 2EG5A 4CMEC 3PPIA 4HUQA 2OCYC 4M83A 1RXCA 3D1JA 5EN4A 2JHFA 3ZU2A 4B46A 3UUEA 2QVZX 1CUJA 3EZLA 4RO0A 2EKBA 3GP8A 2PYZA 2BFFA 2J3MA 5AIBA 1LF5A 3MKQB 3QWPA 2QE6A 3DLIA 2RGXA 5CCBA 4E4TA 3IALA 3I37X 4O2AF 4D3ZA 1LS6A 1MZPA 3RPGB 4IC3A 1OJLA 4Q94A 3KQOA 1MC8A 3ETGA 3K4QA 4H7IA 4JEHA 3UJPA 4ZZIA 2RGWA 2ZIRA 1LS1A 1USVA 1VMKA 1CF9A 4OJMX 5LPNA 2QP3A 2R7AA 2PDAA 2IH5A 3J81k 2Y66A 5E2AA 4L16A 4IULA 3A3OA 4FLFA 1Q1EA 1WZNA 1XEXA 3DEPA 4RF3A 2IF0A 2CXNA 3E1GA 1Z2PX 5CP8A 4RFSA 3HZZA 4L8FA 2DF8A 3WQSB 5TRBA 3D6HA 1GZHB 1QTIA 4IHAA 1U31A 4NCJA 3LQ2A 4R5MA 3IUMA 2ONDA 3WL8A 3UV3A 1MCZA 1DBQA 4AJ9A 2XMSA 3APDA 2R751 3M2PA 4FOOA 2P4QA 3HLTA 2IF4A 3WRYA 1IHGA 2WYOA 5AOAA 4DV6B 4AMVA 4Y6SA 1HK7A 1TM5E 3O9ZA 3OD1A 1D9XA 3GK3A 3L8MA 4UDOA 5AI9A 5FA6A 3FWYA 2BBWA 4ZPJA 1JVNA 1UG3A 4GMDA 3P2MA 3T4UA 1Y4ZA 1JVBA 2HJWA 1DO2A 3KLOA 2D2IA 1TQ4A 4R4JA 1W36D 3DZIA 4JELA 2VBIA 3I52A 2IXAA 3K9CA 4C08A 1UR5A 3N2EA 3AESB 2J9RA 3JQ6A 1FTGA 1GNSA 4BP1A 3IP8A 2BZ0A 4YAFA 4UFOA 3AF2A 3F74A 4E14A 3JYSA 1XR3A 4CU2A 1TAQA 1YBHA 4KV7A 3PGMA 3SYNA 1MO6A 2RFLA 3OA0A 1T6NA 4YI3A 3G2SA 4BLSA 1PZXA 3RRZA 4CLRB 2CKLA 3F8TA 5CFPA 4OP1A 4X54A 3UMYA 2CL5A 5H1TA 1AP7A 4B6PA 4NDZA 3QVGB 4ND4A 5FINA 1Q0PA 3ADBA 1WE9A 3I12A 1ZGJA 2CLOB 5DM0A 3C5VA 2WU1A 5FNZA 1VMEA 5KNCD 3LXRA 4M1YA 4I7DA 2C5HA 1Z68A 4QTTB 4MB2A 5LZ5A 3NB0A 4E7OA 1E1MA 3QI7A 1ORWA 3U3KA 1OZ0A 1PR4A 4LJ8A 3PGLA 1ZNXA 1CJCA 3E3AA 2CSZA 4RL4A 4ABTA 3KX2A 3CJTA 3MJTA 3SGLA 4XJXA 4MDFA 4IDDA 4MS1A 3WNQA 3BXZA 2ZBFA 4FJCA 1KRWA 4ARZB 4P32A 2Z2JA 2HQ1A 3VSCA 4QU8A 5CDFA 3GH1A 3SC3A 5EJFA 2F17A 1T15A 4RKQA 3CH5A 4ETIA 4I1YA 1RP1A 3GP5A 1LNSA 4NAUA 2NVBA 9MHTA 4BJ1A 5BUQA 4DLRA 2J7KA 2L69A 4AVYA 4FFLA 4OHXA 4B84A 4UU1A 5D6OA 4TKMA 2X6HA 3PIIA 4OU4A 4TYQA 4YUZA 1G6KA 5H8WA 2EWWA 2GTPA 1ZM4A 2D8AA 2OWEA 4F21A 5F7JA 4CTKA 1UJKA 1CP3A 2IPAB 1VFNA 5BSRA 1SQGA 3TR6A 1LLDA 4JA2A 1V9LA 1OAOA 2H06A 1G4UR 3ZWKA 2N1BA 5BY2A 2VRBA 1XU7A 3O4IA 4GTTA 1TAGA 4GDMA 4I50F 1SCUB 3R4CA 2OFPA 5ADUS 1T2DA 2K87A 5HZHA 4UWHA 4GTRA 4OUDB 4MPRA 3C14C 4XSGA 3BXHA 3QUAA 3NKFA 2GK4A 4OFWA 4CZ2A 4G1MB 4MLDA 1Z29A 5C53B 1F2UA 2IZ5A 4HRLA 4I3GA 1W52X 5KYUB 4UTXA 4FZVA 1KAEA 1LRKA 4N0MA 2PZBA 1Z06A 4MTCA 2F1OA 3ST7A 2E4XA 4FXPA 3H5AA 1ND5A 1K4YA 1CV2A 4Z68A 2XUOA 1E2HA 3FSGD 1FSPA 1SZDA 1EG7A 4LYAA 4ZI7A 4LJRA 1GTJ1 4ZYLA 3L82A 2HF7A 4Z3KA 1PW5A 2IDAA 4H35A 4CEIA 2MSNA 3INTA 5LKZA 1DAGA 1RPAA 2FPGB 3E18A 3HYCA 4QXOA 4FQ8A 2LRIC 2HLDA 1RQPA 5JJ5A 3MELA 5DO9A 3AUUA 1OGIA 1E0SA 5JUWA 4JDUA 3LC1O 2FK8A 1N54A 2Q1SA 3Q11A 3BMNA 1T8SA 4CXMA 5IEBA 4C5BA 4HMQA 5EUQB 4M1TA 2M98A 1A17A 1WVGA 3ETCA 3TZKA 1XALA 3V1LA 5A4MS 1JWBB 4W9MC 3Q7SA 3HYMB 1UPBA 3LWBA 1P72A 1Q0RA 1NVWQ 3BGSA 1MB3A 1Z0AA 2P9PG 4H4CA 3B7PA 3A27A 1P9OA 2XE4A 4OGEA 1UPFA 3W5DA 5ARBA 4LDQA 1UJ4A 4PCAA 5D01A 5FUVA 3GRVA 2PSEA 3M1IA 1NTRA 4XUEA 4BT8A 1G20A 2JLWA 4JENA 1KEEA 4PXAA 1A3CA 4P86A 3D2AA 3OKCA 3A7EA 3I28A 1EUDB 5A1JA 1E3DA 4QQFA 4CUKA 1NE2A 2QORA 1SG6A 2HC9A 4KFUA 5FPQA 3PDNA 3O84A 2OVBA 5DYTA 2H1LA 3U16A 5EXXA 2XNKA 1KZ9A 3EMBA 3HCUA 3AVYA 1HNNA