3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
1T3LA 3X1XA 4F91B 3VR4A 5DHFA 2IX3A 3THWB 1HE8B 3T1QA 2C98A 4UNSA 1HTWA 4Q18A 2EVWX 3PR1A 5FTJA 3VX4A 4CRWB 2GVZC 3Q3JB 4A36A 4B47A 3U5ZB 2HXYA 3EZ7A 3O47A 3QIAA 3GJ0A 4GZMA 5JHHB 2WMOB 1VG9B 2IS2A 1XD9A 2WJJA 4HLUC 3RS5A 1G6OA 5FBRB 3EAQA 3THYB 4OK5A 1Q20A 1H8ED 1P2UA 1YJ5A 3LFUA 4PO1A 1QHHB 4ZDKA 4TQUS 5KPJA 4NYMQ 4V03A 1G4UR 3DOFA 3ZVNA 2J0VA 3CX7A 3QKSA 4PQRA 1FX0B 3FPAA 4D80A 4XTRA 4DCUA 2ZRMA 3K0AB 4R9UC 1E9EA 1Z28A 3B85A 3LO5A 3CX6A 2H57A 4M1WA 3AUYA 3SBDA 4M21A 1CS4C 1F2TB 3OIVA 1KSGA 1XFAA 5B57C 2FGJA 3HU2A 1J90A 3P26A 1A5TA 2NIPA 1YR6A 2ZVPX 2DYKA 2NO1A 5CYPA 4EPRA 4M22A 1S3GA 3L82B 4IOLA 4DSUA 1XB2A 3KKNA 5TDHA 4D4KA 3OIYA 2G3YA 3CF0A 5A0FA 1NIPA 3B82A 3UPUA 4E03A 1KI7A 1XMVA 2IA5A 4HI0E 4QFMA 5SZHB 1AKYA 2GXUA 2HEIA 2Q0HA 3K8YA 3PXGA 4Q03A 1P9NA 2AL7A 2KSQA 1OKKD 2QEQA 4FWIB 1F3OA 4AYTA 621PA 3T34A 3L0OA 4H1UA 1VIYA 3TNFA 1U8YA 5EZ5A 5EE5B 1W49A 3UMRA 2DFTA 3B8HA 3L0PA 2O8DA 2PT7A 1MH1A 3A1UA 2CHGA 5EE3A 1IN5A 1W46A 5KNCA 5KSYA 5KPDA 3K09A 4XWOA 2O8EA 521PA 4D26A 5IK2A 3FMPB 3K9LA 4AIIA 4HDQB 1UADA 4ITRC 2P3SA 3RHFA 3TQCA 1VMAA 1T5LA 4Q9LA 2WJVA 1T4GA 2HUPA 1DAMA 3BH0A 4UXIA 5KHOC 2PZGA 3W6NA 4JLNA 4ZKEA 2QY9A 5SZIA 3IEUA 2J45A 3IHWA 2GXAA 4JIMA 5DIFA 1G3QA 1ZC4A 4B73A 1DVRA 2QMOA 3KQKA 1E99A 1EFHA 3X2SA 4L8GA 3QKRB 5GVRA 1SHKA 3ADCA 1BIFA 3ICEA 1SVSA 4US1R 1EFCA 3FKSD 1IY1A 1PZNA 3QKSB 1W4AA 3T35A 1P6XA 4P32A 3BB1A 1IHUA 3A4LA 4GSYA 1MKYA 4C2TA 4PR0A 1LS1A 2F9LA 1N2CE 1CR0A 4CDGA 1TAGA 3TIFA 2VHJA 3B1ZA 2QMHA 3B1YA 4LOAA 1GILA 2TMKA 1ZIOA 3NTUA 4IW3B 1E98A 4Q5IA 2IS1A 1L4YA 1EX6A 2X19A 1Z0JA 4MDFA 2DBYA 2WPDD 2KI5A 4B74A 3CF2A 2F1RA 1DE0A 4TYNA 1XWIA 3MWKA 4Q7KA 4KBFA 5C4GB 3RDPA 4XVQA 3FHOA 1ZCBA 1NBMD 1FZQA 1XCPA 4I4LA 5GJCA 4KCGA 4ON9A 2RGCA 3AQ4A 1N3BA 2D2FA 4MRRA 1JQLB 4QGAA 4R98A 4JLMA 3SOPA 2QROA 5EUMA 2EFDB 3CPEA 3X1YA 2J41A 2BWJA 2OXRA 4LWZA 2QNRA 4PC6A 2O8DB 4US0R 3KFXA 1NVVR 4EPVA 3GJ5A 5DI3A 3EA5A 2HYIC 2ZSAA 4W5JA 3SHFA 3SE0A 4IDQA 4M1TA 5BN4A 2O8EB 4XSHA 2GEVA 4M2LA 4HDCA 3U2QA 4V02A 2V4ZA 1VG0B 1VG1A 3NBYC 4PPFA 2NO0A 4BLSA 2AXPA 2GJKA 1E2FA 2IC5A 2IEZA 2IXGA 2ZI4A 4ZKDA 4M9SA 2RGXA 4JYCA 2I4IA 4XTCS 3GCGA 2ZRPA 3Q5DA 3WMFA 5M04A 2BJVA 3P20A 5JS8A 2LCFA 4JJZA 1T8UA 1WMSA 4PC7A 1W0JA 4DEYA 5FUYA 5L3QA 4AKGA 1DAIA 4ESVA 4DSTA 3CPHA 3QI2A 5J40A 4P33A 4D6PA 4MYUA 5IRCD 4BWYA 3AGQA 3MSXA 2ASEA 4TMKA 2HCJB 2VPPA 1IQPA 5BYKA 2VSFA 4NTZA 3BJIC 3GP8A 3IIMA 5KOYA 5CJPA 5F2EA 5KYKA 4IHQA 1G8GA 2GEUA 3SZRA 2ZE8A 4DZZA 3AF4A 4DLSA 4FN5A 2BHRA 1DO0A 3CW2A 4BE7B 1W5SA 1ZNWA 4TLBA 1ZIPA 5FL7A 3MLEA 1E9CA 2HCBA 4AURA 2F1JA 1E2PA 3NIBA 1QHGA 4BLOA 5JRZA 1P5ZB 3KQHA 1YZGA 3LDAA 4ASUD 1H8EA 4H1VA 3P32A 1EK0A 1L7VC 4R2HA 4Q00A 4A2PA 2O8BA 1TL7C 2ZRFA 1OPXA 4JLDA 2YWHA 3BE4A 1T3SA 2WMNB 1MO6A 4QHSA 5E7MA 3H84A 4WXPA 1UPTA 2KB0A 3FM8C 4D0LB 2G0TA 1XBTA 2FE4A 3RWOA 4UNRA 4P4TA 1AQUA 4OQLA 1X1SA 2OBMA 5DI3B 1PV4A 3GLHA 2REOA 3P27A 3QXCA 3AM1A 3FE2A 1NSTA 3IIJA 1XMIA 4PXAA 2OCYC 3PCRB 3TJZA 4AK9A 3OEHA 3SDZA 3ZLJA 2VHCA 1JR3E 1CR1A 1P4SA 4B6FA 3MD0A 4WW0A 3GLGA 1GKUB 2ZR7A 2QGNA 1NKTA 3Q7PA 4M8NE 4QOSA 1DAFA 3LNCA 3BK7A 3W3ZB 4A4DA 4M9ZA 3DMNA 2O0KA 1SKQA 1QF9A 1E79D 5L3QB 3CONA 2VHUA 2MSEB 1A2BA 4Z1MD 4RD6A 1FP6A 1K6MA 4L4UA 1VCMA 1KSHA 1U90A 4KYIB 1ETUA 2EYQA 4FCWA 2AX4A 4FW9A 3DZ8A 3SU8A 1OW3B 4MUBA 3NEYA 4TTPA 1DOAA 4HYYA 2FH5B 2FZ4A 4GI7A 3LVRE 1Z07A 3O8CA 2VP5A 2G1JA 3G5UA 3EPJA 3HU3A 1QHXA 1YR9A 3DO6A 1SQ5A 2ZRAA 2MMCA 3B13B 2A7QA 2JAQA 4DUGD 8OHMA 3ZVLA 1Q3TA 3CR8A 1FMLA 3FMIA 4XVRA 5AJWA 2C9CA 4XVUA 1GDDA 1NVUQ 2CLSA 1GP2A 1Z29A 1JXMA 2XB4A 2YWFA 5G40A 1KTVA 2C8VA 3SHWA 1XZPA 1KK3A 2IT1A 2OXCA 4YMTA 5J4YA 2GCPA 1ZAKA 4JT2A 3HR7A 1SVIA 4URVR 1E2EA 4XD7A 5TB5A 3I72A 3R9IA 1XD2A 2O8BB 4G01B 1AS0A 3QKUA 5LPNA 3CZQA 3IUYA 2PT5A 3DHWC 3RSOA 1S1MA 5H70A 4OHZA 1RYHA 4F7WA 5TXGA 2W2XA 4DHEA 1CJMA 1T6NA 3B9PA 1VECA 4OQXA 3SYKA 3AVXA 3GLHB 3LJUX 4WAUA 2Z4RA 4TTQA 4B33A 4GMXA 4JLVA 1I4LD 1X8LA 3W9YA 4B43A 1TU4A 1XTJA 3T06B 3WMGA 4NZYA 1KNQA 2XNSA 1CF4A 1ODFA 1FL9A 4ABYA 2XNDD 4TMXA 4P4UA 2V7QA 3QXXA 1XXHA 3GLGB 2DWQA 1KSJA 4TYQA 5FOUA 1US8A 1OYYA 5FPTA 5FOXA 1D2MA 4JKYA 3D6TB 4Q7MB 3OE7A 3TW8B 2J59A 2IYQA 5BWMA 1X1RA 1Q44A 4NU0A 1ZP6A 1E2NA 1ZM9A 4NE2A 1RRCA 2V9PA 3EASA 4IOMA 1R6BX 4CW7A 3FOZA 1J99A 4YC7A 4HZIA 2BMDA 3WYFA 3P1JA 2XSZA 3UXMA 3BH6A 5C46F 4PPQA 1W48A 2BM1A 2GAOA 3IPYA 5EXTA 5IHPA 2XGJA 3OZXA 5HZHA 2Z83A 2CK3A 1XP8A 1WF3A 4QBGB 1IY0A 3UG7A 1Z47A 2YOGA 3SYNA 3KXIA 1OFHA 2I3BA 2V3CC 2J0SA 1PLKA 4M1YA 2ZU0C 3MUFA 1G1MA 1DO2A 4YDHB 1X6VA 1XJ0A 3MFYA 2C5LA 1E9DA 1FQJA 1VCOA 4K46A 5L8VA 4PHGA 1F48A 1YE8A 2VIIA 4U7DA 1FW6A 4RFVA 3QEOA 1XD2B 3CRW1 1M7BA 3AF1A 2JLZA 2AFIE 3KL4A 1TTTA 2WV9A 1ELOA 1OXTA 2QTHA 4Q1DA 4HAXA 2W6JD 2CEAA 1BOFA 3AF0A 3N2IA 5JCPA 1NLZA 3H4MA 4OL0A 2OLKA 5TMPA 1E32A 2BDTA 1KO5A 2FPKA 3EPKA 2REXB 4LHZA 4OQMA 5IT5A 2O52A 3F3YA 1G21E 1G5RA 1E0JA 2ZRLA 4G5SA 1C9KA 2QRZA 1R5OA 5AK0A 1G7SA 4EFNA 1U0JA 3JVVA 1ZCAA 3QVUA 5J4VA 1XXHB 5JWOA 4OI4A 3TUZC 5F98A 2QM7A 1US8B 3NVAA 2V54A 1MT0A 4KJZA 4RKFA 1TQ6A 1KJZA 2OCAA 4C9BA 2A5JA 4QG7A 2FF7A 4DDVA 4IVRA 4FIDA 4RZ2A 4R71A 3ZGXA 2Q9BA 4CT5A 3RS0A 3WXMA 2EU8A 1TUIA 2G0NA 4JLBA 4OQFA 1YZUA 1OFIA 1XZQA 1R4AA 4A9AA 1H8HD 2IYWA 1II0A 4C0SA 5DNYB 2ZQ5A 2FFBA 3L43A 1EG7A 4IOJA 2W2TA 4PHHA 5HTKA 2H5EA 4JVNA 4EPXA 3JUEA 1XEFA 4LDJA 4DC9A 4LHYA 3RAPR 3TSOA 1ANKA 3O8RA 2FFAA 4QKQA 1G3IA 2O8FA 3GFTA 5HZKA 2A5YB 2W0SA 4DKXA 1W4RA 2WJGA 2NZ8A 4OHXA 1XPOA 3I32A 1XD8A 1E69A 1Z6YA 2IF0A 4DDUA 3SC3A 4KU4A 1JXOA 1QVRA 3A8TA 1PUJA 4UJ5A 4XWAA 5FBWB 5CK4A 3AVVA 1KZ7B 2C95A 2RGEA 1D9ZA 4B6EA 3NEJA 4RFSA 3RS2A 4KODA 3TKLA 1VYTA 1G41A 4EPYA 1ZC3A 3T5DA 4NYJQ 3LD9A 4C4PA 3GLFE 4LV8B 2JIZD 1ZD9A 4FD2A 4I1OA 1RRGA 4DLWA 4JSYA 5AUQA 4CGZA 3BERA 2RAPA 5DYGA 4JBXA 5KO2A 1S3SA 1ZNYA 5IK2D 1F60A 1C1YA 1JB1A 4BECA 3OAAA 2QL6A 1HURA 3ZVMA 3HYRA 3C4JA 3L2OB 5LD2C 4HLDA 5JLJA 2BBSA 3PUYA 1ZJ6A 5DISB 4Q1FA 3LQRA 4O3MA 1GITA 4ESHA 3EA0A 4YMUA 3KQLA 4EKDA 3PEYA 1KO1A 3VNVA 5AJVB 1XU4A 3RS7A 3DWDA 4F92B 2HYDA 3CH5A 4LCBA 1NP6A 4V0LA 2EFGA 1E9AA 4Q19A 4Q21A 2ZS7A 2QP9X 2WJHA 1QHNA 2Q9AA 2VP9A 5EQTA 1M74A 4C0JA 3AH8A 2JLSA 2Y8EA 4QHYA 4Q7LA 4E09A 5AUOB 3VU9A 2V1UA 1LFDB 4DLYA 1J8MF 4JLPA 2J7KA 1GIAA 1WDTA 3B5JA 2LKCA 4QJ3A 4K81B 2CCJA 2IS6A 2ZJBA 3DOEA 2QE7A 3QVVA 4DCSA 2QI9C 1V5WA 4PC1A 4BZXA 2OBLA 2GXQA 1LVGA 4HLUA 1E2QA 4JL8A 5DH9A 2ZM5A 2XNDA 3U44A 2JLRA 3VKGA 3U7FB 2NQ2C 1RPZA 2C9OA 3BFKA 2O8FB 1G8PA 2G83A 1G7TA 2YNMA 4M4SA 4AKEA 1W4CA 2IWHA 4DCNA 3G82C 2F3TA 2RHDA 2Q3MA 2R6DA 1NVVQ 1OXSC 2YVUA 1F2UA 3NXSA 4Q47A 3RC8A 2ZRDA 4BFZA 1N0WA 4G3XA 5CJ2A 1RZ3A 3CX8A 2WSSA 3F8TA 4LYHA 4RFSB 4A0GA 1OF1A 4TL8A 1QBKC 5CYOA 4BFUA 2GCOA 3U61B 2QAGA 1ZUIA 5DO9A 4JYBA 4NCKA 2QSYA 1XEWX 3FMOB 3ADKA 2ANCA 2JLYA 3X1ZA 3AP1A 3B7GA 3PQCA 2VL7A 5P21A 3A4MA 2JDIA 1T3HA 4UXHA 2KJQA 2UVQA 3I4LA 4PZYA 4QJ4A 5FUWA 4BZPA 2ZJYA 4KXFB 4D0GA 4F93B 4TL9A 4NDZA 1E1RA 4Q9IA 2GF9A 2QORA 1GZSA 1FNMA 3SNHA 3ONWA 1P9WA 3QPVA 2ERYA 4Z51A 4IXNA 1MRNA 3CLVA 1W0JD 3BORA 1R0XA 3RABA 2B92A 2WAXA 3W5IA 4B71A 1ZNZA 2V6JA 1JNYA 3JVUA 2F1IA 1DCQA 4AD8A 5B58C 4RJLA 3ZDQA 4OQNA 5KTYA 3C14C 4K8OA 2IYRA 4BRUA 3VMFA 4PPNA 4BFYA 3VU9B 4IEEA 3V9PA 4Q1EA 2GK6A 2XAUA 3W3AA 2QQEA 2X2EA 3GFOA 4YQFA 4C2UA 2ZTSA 2ZPTX 2RGDA 1Z0DA 2PLFA 3IO5A 3C16C 2OE2A 2NG1A 5JCZA 4C0LA 3U44B 2QT1A 2A9KA 1KK1A 3GJ3A 4O2LA 2FG5A 5FL7D 1B0UA 5JMTA 1G4AE 2ZJOA 4DDWA 5JFGA 3NH6A 2ZSBA 2CHQA 1NF3A 2K5UA 4IJMA 1NKSA 4DEXA 2P0EA 1JJVA 1QG2A 4FMDF 3CNNA 4D4JA 1P3JA 1KO8A 2ODEA 2ZAOA 1F2UB 1KYIA 2R6AA 1FPMA 1KHTA 3QKRA 3W6OA 2WJYA 3ASYA 1Z6TA 3KUDA 3LRPA 3E70C 5K8IA 1OFUX 4Q1AA 5E7JA 3I8SA 4YMSA 1CJKC 3UKDA 4LSGA 2GCOB 2P2LA 5LBIA 3TAUA 3PUWA 1H8HA 4MYHA 1UBGA 1VYUA 2A2ZA 2QAGB 3QEJA 4ZV4A 4JKIA 4PANA 1N6PA 3OF5A 1S0UA 3NBFA 4OHWA 3WP1B 4B2LA 3IILA 2ZXUA 3AKCA 4KFTA 3D3QA 4Y0AA 1WCV1 2VHTA 1GRRA 1OB5A 1YZQA 2QAGC 5C18A 4GP7A 4PHFA 1QRAA 4JJKA 4N0DA 3EPLA 3OEHD 3HPRA 5KSPA 4JBYA 4MH0R 1TEVA 1X8KA 2R8RA 4WZAE 4F38A 1UDWA 3GLIE 2ZJ2A 3PEUA 4FMDB 1KY2A 2QTFA 4KV9A 4TMWA 4LGMA 1SHZA 3QUSA 2HJVA 3BXZA 2EFCB 1U94A 2KBEA 4LJ4A 2W2VA 1Q21A 2AWOA 1P73A 3MG9A 4PTLA 2ZRKA 4AC9A 5JJKA 1AZTA 2JIZA 4I99A 1HQYE 3WNDA 1ZU5A 3AP2A 4EFLA 1JR3A 1JQJC 2H1LA 1Z63A 1UBEA 3IGFA 1J70A 4PSAA 4BFSA 1KI4A 1M8PA 5CIQA 2AWNA 2D2EA 2WWIA 4IDNA 1YQTA 1AA9A 2GEDA 3TUIC 3K0CC 4CVNA 2KBFA 1RRFA 2J7PA 1KMHA 2P67A 2WHXA 3VR2A 3UATA 4AYXA 1E9BA 1NY6A 4S2EA 3HPQA 2VA8A 3W90A 1L4UA 1JI0A 1Q1ZA 1KDPA 4HEJA 5FI1B 1TUEA 2DFNA 1CIPA 1DELA 3E5HA 2YWEA 3ZS9A 5K8TA 3NG1A 2OM2A 3OHMA 3SS8A 3ZIAA 4KO8A 4XD7D 3LWNA 4QRHA 5HE8A 4BLRA 2VP4A 1UKZA 4HB2A 4MA4A 4GDFA 1N5LA 5D3MA 2HT1A 4HB4A 1X8JA 3CWQA 1AS3A 2FSHA 3HR8A 2C96A 2ZE5A 4E5UA 4CIDA 4NL4H 1V43A 3I1FA 1RIFA 4D81A 3W6PA 4XOIA 3RRNA 3I61A 2GZHA 3DKPA 4URYR 5IDVA 3U7HB 1IN6A 3KJEA 1R10A 4KBGA 1UDXA 2XX3A 2WOOA 4JVLA 4B35A 1G8FA 2IYXA 2CNWA 1DAEA 2WWXA 1KIMA 3DDCA 3KX2A 3VTKA 4KI0A 5DLQC 1FOEB 2V7QD 5UKDA 1KZGB 3C41J 4Q4HA 2JLVA 2CE7A 2SHKA 1BYUA 2ZYTX 1W7AA 3NDBB 3WYAA 3OE7D 3ZYCA 1RYFA 1OYWA 1W44A 4PC3A 2X8AA 3CUEF 5L3SA 3AVYA 4LC1A 3C8UA 4W9MC 2Z43A 3ZS8A 1OIVA 1NIJA 1P72A 4LI0A 2ZRNA 3O8DA 5KNBA 4LUCA 1XCMA 4FCTA 3C5CA 2FX3A 2VTKA 3LW8A 1UM8A 2IYTA 4URZR 3ADBA 4CT4B 1U9IC 4WIAA 2XSZD 2OAP1 1GNQA 4RCYA 4ZCIA 1E2MA 2GTPA 2YINC 2CK3D 4NBSA 1UJ2A 3T1OA 2PL3A 1SULA 1KMHB 1DEKA 3T5GA 4KHZA 4A8JC 2ZSFA 3HJNA 4CZ2A 4JSTA 1KI8A 2YZ2A 3DEFA 3A1SA 2OG2A 4QXAA 4X8MA 2FEOA 2CLDX 2XOKA 5AWFC 4ZI2A 3A6PC 5JEDA 1E0AA 2AKYA 4B2PA 2C9YA 1OV4A 1U81A 4TLDA 3K70C 1WBBA 4HAUA 1D2EA 1S2MA 2AD5A 1X3SA 1B23P 1RKBA 2A30A 5JWRA 2IYSA 5D3MB 2GNOA 4ILEA 1Z8FA 1ESMA 4NYIQ 3GD7A 1N6HA 2NO7A 1XTQA 2HDNB 1EWRA 3N2EA 3B1VA 4Q9HA 2WKRA 4WA7A 1W4BA 2VRWA 3QE0A 2R6GA 3QNUA 4KLNA 4GL2A 1NMZA 1MR3F 4EPWA 4LJ7A 3KQUA 1PLJA 3MGCA 1U8AA 1E2DA 3W34A 5TV2A 2GESA 1LF5A 2JGNA 3REFA 1WBDA 2DR3A 4LJ5A 3LW7A 1ZM2A 1RE0A 2NO9A 3RS3A 3NBZC 4QM7A 5EP2A 2O0JA 4Q4HB 3ICQB 1YU9A 4D0NA 3TBKA 5B64A 4LHXA 2CDNA 4M9XA 2Q3HA 3QBTA 1OH8A 3LQQA 2IYYA 2QN6A 3AP3A 3GJ7A 2ZR0A 3QPWA 5GADl 2ZS9A 1N5KA 3X1WA 5L3SB 2EYUA 3IO3A 1SXJC 4HATA 3WP0A 1CBUA 2AK2A 2OSBA 1P7CA 4LC0A 2C78A 1KI9A 1DADA 3VNUA 4A82A 3Q7QA 1OJLA 4Q48A 2ZRIA 1DPFA 1G16A 2ZIAA 1TPZA 1Z5ZA 4GNKA 5C2JB 4C7OA 1NN3A 3Q72A 4ACBA 1T8TA 1G3RA 3CRVA 2WWYA 1Y3AA 3B1WA 4RY2A 4MDEA 4F1PA 4MYCA 3K9GA 1N5IA 3MCAA 5LB4A 4AYWA 2QZ4A 4JLOA 1VYVA 1M7GA 3NC0C 4NHOA 1A82A 3AKDA 5FI0B 1XEWY 3TLXA 1HT1E 2BC9A 1ZU4A 3KZ1E 2PEZA 1ZM3A 2IYUA 1XMSA 2QSZA 3FTQA 1GRNA 2PCLA 2VH5R 2OWAA 1Q1QA 5G3YA 4I81A 1S8FA 4KAXA 1RW4A 4WBSA 3M0EA 3L0SA 2W00A 1OT3A 3QKTA 2QPAA 4FI3C 1NI3A 1I2MA 2WWWA 2ZE6A 4C30A 3ADDA 4TTRA 4JVMA 4EFMA 4F4IA 4CEIA 3LBNA 2V1XA 5SZJA 3VKHA 1W2HA 4POAA 2NPFA 3VKWA 1G5TA 3WNBA 1E2GA 4GRAA 1EGAA 1NG1A 2RH5A 1WP9A 3OAAD 1Z08A 2N42A 2QU8A 4QJ5A 1M1YE 2C03A 2QM8A 3Q5EA 3ZZ0A 3PITA 3ZD7A 1Z0KA 4GT1A 2ZI9A 3UMSA 3GLFA 1VTKA 3TUJC 1YZNA 2GVDC 1NLYA 2PEYA 3QXSA 4AG5A 2P5TB 2RGBA 2CBZA 4AI6A 3CIOA 5DE3A 4WOPA 3T15A 3G0HA 2ZU6A 1F5NA 5BW8A 4YMVA 1SXJE 1CRPA 2ODBA 3ASZA 4YDSA 5DHAA 1YZTA 4J0QA 2WZQA 1P2VA 3WYGA 3OFNA 3THXA 1Z0FA 2ZJ5A 3M1IA 3KKQA 3PV0A 5JSZA 2A5FA 2J0QA 1IBRA 4C7OB 1Q57A 3C15C 3DKVA 2QUZA 3LBHA 2CL7X 2FA9A 4RD2A 4A0HA 1NG9A 2RKOA 3AV0B 2E1RA 2QE7D 4G5GA 4GOXA 4HLQB 4HZUA 4P31A 1WRBA 1IJFA 5DI9A 3SJZA 2OESA 4KSCA 3PUVA 4B3DA 5JS7A 1CLUA 1ZD8A 4FMBB 4KFSA 2VF8A 5KSZA 1YHNA 2DY1A 3KUCA 2J87A 3SFVA 3MDBC 1JAHA 2C04A 2DPXA 5CDFE 3QBVA 3KJHA 1OH7A 5KUTA 4GZLA 4QNMA 3Q8XB 1LY1A 4E22A 1O87A 1MO3A 4M1MA 3RRMA 1JPJA 1TQ2A 3S1AA 2WJIA 1U99A 2WOJA 2ZUCA 2FMXA 2Q3FA 1G20E 1N6NA 1ZRHA 2IBMA 2WSSD 3NWJA 4HB0A 5FOWA 3K9NA 2FJUA 1HH4A 1R5NA 3A58B 3VR5A 4PX9A 1DS6A 3L8YA 5AUPB 3GEEA 3K1JA 3PJRA 3MJHA 4Q4AA 3WHLA 1YRAA 5D3QA 3ZD6A 1AN0A 4G0NA 4WXRA 5KNDA 1P61B 4CEIB 2WWHA 5FBLB 1BMFA 3SQXA 1EFUA 2BM0A 2GA8A 4PZLA 5J4HA 4MQBA 4G1UC 3RRYA 1KK2A 2JDID 2Q21A 4NCNA 3U3MA 4EQ6A 2D4HA 3AB3A 3UK6A 1U8ZA 2IW3A 1GM5A 1N0VC 1KKMA 4R2IA 1E1RD 3CR7A 3WY9A 2J9RA 3GLFB 4OKSA 1QHSA 4QBIA 1G8HA 3TK1A 2IYVA 3ECCA 4JVSB 2IXFA 1G5PA 4AKHA 3U7GA 2ORVA 1GAJA 1H65A 1FUUA 2WICA 4BLTA 2WBLC 5CLLA 3I8XA 2D06A 1NL3A 4PPGA 2IEYA 5TARA 1ZW6A 2F3RA 2GAAA 2L0XA 1NVWQ 1XNJA 2RB4A 4EAQA 2XEXA 3Q85A 1GL6A 1HE1C 3SBEA 3THXB 1CXZA 2NMVA 3C5HA 5JSZB 2IYLD 1UBFA 4MKGA 2W0MA 4QNRA 4C0QC 1AKEA 3CM0A 3FEHA 2EWWA 4HZUB 4LX0A 2GF0A 3KFVA 3LV8A 5CB6A 4DCTA 1OXVA 1P62B 2DFKB 2R6CA 1M34E 2FPMA 1P60A 1JEDA 3PG5A 1ONBA 1OHHD 2YV5A 3OIUA 3RLFA 2WIAA 1FNNA 4A0RA 3KKOA 4LYFA 1PLLA 4YMWA 2FV8A 4V0OA 1TF5A 2CHVA 1MABA 2XTZA 3R8CA 3S1AB 1G6HA 1NY5A 2O8CA 3IBYA 1P75A 1D2NA 3WHKA 2FOLA 1GKYA 1PVOA 2IXEA 1JECA 3A37A 4OHVA 2QT0A 3B6EA 4URWR 4EJSC 3GJXC 2FN4A 3TVTA 1K5DA 1NN0A 2ERXA 2OT3B 2UKDA 4MGIR 3X1DA 4GOKA 4HAYA 2VYFA 2FZLA 2R6FA 4TN1A 4Q4AB 3CRQA 1E6CA 4PAMA 4BFTA 4Q01A 1YVDA 4IEIA 4O25A 3PFIA 2C2HA 3EPHA 4GFDA 3CRRA 2FSGA 3FWYA 2VP6A 2AN9A 5BN3A 5DGXA 2E87A 5E7IA 4EQ6B 3ND8A 1EWQA 5LB2A 2QRNA 3ZVRA 1Z3IX 4PFSA 1TF7A 5EE9A 1E1QA 1HV8A 5JWHA 3RS4A 3VR6A 3FFAA 4CYMA 2ZRCA 2XB2A 3GQBA 5JJIA 1D6JA 3DVLA 2ZVQX 1VCIA 2R65A 3SYLA 1UEJA 3SN6A 1R2QA 4DB2A 4UKDA 3QOFA 3FHCB 4Q9JA 1FTSA 5EUQB 1JR3D 5LD2B 2QBYA 2G88A 1NMXA 5CLQA 3W5JA 4B2IA 3DL0A 1IY2A 3E2IA 4LRWA 3GLIA 1FTNA 1HEIA 2DB3A 1S4QA 3V4RA 1NNEA 1RFLA 1GL7A 3LLUA 1KDTA 4ZDJA 1IN8A 3K0FA 5K8UA 3FKQA 2CCKA 3ND9A 5LDDC 2J7PD 2N1BA 3BFVA 3MAAC 4L15A 1I2DA 5FTLA 2BBWA 1ESNA 1R5BA 3WBKA 5B2ZA 4EPTA 3DM5A 4TT3A 3IQWA 1JALA 3LBIA 3MWJA 3LAWA 2HF9A 4JL5A 4QHTA 4O0MA 4C0HA 2ZRJA 5JBQA 1W36B 1KMQA 1CR2A 4LV5B 1MABB 4MKIA 1KSFX 2QP3A 3ZIAD 2EQBA 1HUQA 4CEHA 2W6IA 2O8CB 5HR5A 3GFPA 3W8NA 3FHTA 5JJLA 2OFOA 1OLOA 3EC2A 1AM4D 2G77B 2ODNA 2WWFA 4MUAA 5BYJA 1W36C 3LA6A 4NP6A 2OUKA 5FPSA 4OK3A 2R9VA 3RNLA 1OXUA 3BB4A 2FWRA 1BYIA 2IUSA 3DPUA 3EXAA 3H0KA 4N0EA 5EXSA 1KGDA 4IDPA 2FU5C 2OLJA 2ZRBA 4BEJA 2D7CA 2ZJAA 4LPSA 4N1AA 4TSFD 1NBME 1UKYA 4JBWA 3MWYW 1RVDA 2CNWD 2NPIA 5BQ5A 1SXJD 1TX4B 2I1QA 1F6BA 3GJ8A 4HLCA 4LBZA 2AFHE 4LJ8A 2FSIA 3B1XA 3EZ2A 2B21A 4TYPA 4C0AC 3KQNA 2RCNA 1TU3A 4DLTA 2GJAA 3OEEA 2H16A 4OJKA 3TMKA 1UKEA 2B8WA 4ZDWA 2YC4C 3AUXA 1G291 4OK6A 2IUUA 3TW4A 3TRFA 5FOVA 4ZCMA 2GBLC 1AQYA 2YKGA 1CP2A 2R2AA 4Y0VA 1EX7A 2ECKA 1E4YA 2QBYB 2IQJA 3TE6A 4BGDA 1WQ1R 3GLIB 2AR7A 1KKLA 1R8QA 2KWIA 1XPUA 4PO8A 1RC8A 5TY0A 1QZXA 1DG3A 1G17A 2ZSDA 3K0FB 3A1VA 2Q9CA 4LBVA 2HLDA 3NBXX 3RC3A 3CBQA 4B44A 4Q7JB 1D5CA 4DT1A 5JZVA 2NTYC 3PEWA 4TMTA 2DFLA 4UNPA 4LYAA 4LBWA 3N5CA 2ZAMA 1M7HA 1Z06A 4OJQA 1EFTA 4OI0A 2EFEB 5JECA 2XOKD 1GOTA 2CL6X 2CL0X 3QJYA 4TLAA 1XJQA 3LXXA 1PUIA 2X1VA 1SVOA 1GFIA 3IQXA 4CEHB 1D8TA 3U6KA 3TVDA 3R9WA 1KAGA 1YKSA 3MMPA 3K0CA 3AVTA 4I1SA 1G8YA 1GSIA 1ZYUA 3CRMA 4F4JA 3EW9A 1TNDA 3CNOA 4ZIRA 2D62A 2OHFA 4I1VA 3L0IB 2WM9B 4MKFA 5FPYA 4DBLC 3SR0A 5HCNA 1GRQA 1YZKA 2AXNA 4OHYA 4MKHA 3REGA 721PA 1TEXA 4DJTA 4EIWA 1SKYE 4FINA 1M6NA 2ZI7A 5A5GA 1G19A 3LVQE 5K8LA 4P0TA 4DIEA 2OAQ1 1KJWA 1NLFA 2A3RA 2ZI3A 3BWDD 3KB1A 2ZYVX 4M1SA 4Z8XA 1E0KA 1OHHA 3DM9B 2LKDA 2VP2A 1OXXK 3M4YA 2NGRA 2O5VA 2JA1A 3ETLA 3UWKA 2BOVA 1KO7A 4IVPA 3FVQA 4II7A 4LPKA 3GEHA 4ERNA 4HAZA 4P4SA 4DLZA 3IIKA 1COWA 1FP7A 1I4DD 3JZAA 1ZVQA 4ZPXA 3TQFA 1KK0A 3D31A 2XZLA 5EP4A 1IN7A 4ZCLA 4PSKA 2H18A 4HUTA 1OH6A 1L2TA 4B76A 4CEJA 4IDOA 1YR8A 1UEIA 1W0KA 2X77A 1A1VA 3K0SA 5GJWC 4BPBA 1E9FA 1J7KA 1QHIA 2VSOA 5L3VA 3GMTA 4B3CA 1HA3A 2ZJZA 1R0WA 4OI1A 4WZ6A 1K5GA 3H86A 3M6AA 4DT1B 4LV6A 1KI3A 1N6LA 1Q1EA 4TYWA 4TYYA 5CM9C 1E96A 2JEOA 1ZBDA 1MO5A 1ZM7A 2GETA 3IBGA 1U9IA 2BEJA 4AY2A 4GMDA 5FOSA 1VCNA 2PLRA 1TMKA 1N25A 3NHBA 4LJ6A 3KDSE 3P4XA 5JRJA 1T5IA 1UFQA 3B9QA 2V8OA 2EFHB 3BC1A 3LH5A 4KYUA 4O2RA 4PZZA 2OFXA 2P65A 5EP3A 4GOJA 121PA 3NC1C 1G3MA 1TQ4A 4A8JA 2ZITA 1KJYA 2CMKA 4MRSA 5HKKA 4ZIRB 4BLQA 2ZI6A 1W5TA 3EIQA 4JLKA 5HE9A 2HXSA 1CU1A 2ZJ8A 5EXXA 2DHRA 4UXJA 1A2KC 1LTQA 2CCGA 4DB4A 2PX3A 4M9QA 5FL3A 2ZR9A 4AG6A 2XTNA 3HP1A 2QQ0A 3AVOA 4NPHA 2B6HA 4YONB 1VKJA 4QL3A 3PUZA 2J5XA 4QBHA 3UMFA 3R7WA 5F9HA 3A1TA 3QPUA 2WKPA 5FR1A 4BFWA 3TAHA 3BS4A 2PJRA 2YHSA 4YXWD 1S9DA 2YYZA 3ZJYA 1IM2A 2WAYA 5EE0A 4NYJR 1K8RA 2RGNC 1JEEA 2QG6A 4MGKR 3CPJB 4QFVA 4P4SB 4BFVA 2QTVB 2F7SA 4QM6A 2JJ2A 3JZMA 3T61A 2JJ1A 5KSOA 3B60A 1AGRA 2IUTA 3WMEA 3OFND 1QDEA 4TQ9A 2ODWA 2WIBA 2GRJA 4CEJB 3VX3A 4DIDA 5H1YA 3HDTA 1OFTA 2MMGA 3PIRA 4TSFA 4LYJA 2GKSA 2PX0A 5SZKB 1S1CA 1A7JA 1NSFA 2BCJQ 4KFUA 3U7EB 1OH5A 2IS4A 3NDPA 1SXJA 5EXPA 2VBCA 4Q9KA 3BOSA 5GVSA 4LK2A 3TR5A 1HQCA 1W1WA 3BAFA 4RVCA 4BRWA 4DSNA 3H1TA 1J2JA 1I4TD 4JL6A 3SJCA 1II8A 4KLZA 3EWAA 5H68A 3VR3A 2ZE7A 1ZUNB 5JI3E 4ZI3A 3K9HA 2GK7A 4V0ME 1D9XA 1SVMA 5FUXA 1IONA 3SFZA 2OBNA 3BIFA 1JAIA 1QVAA 1Q1BA 2JASA 1AGPA 1U98A 4HAWA 2IL1A 2YC2C 4KITB 4DSOA 3EZ6A 4RCZA 1VG8A 3K53A 4A8JB 1Q3HA 1W2GA 1G3UA 3CB4A 3QF4A 4PSVA 5CDFA 1KDRA 5KDDA 1OB2A 2P6RA 3GEIA 4L16A 3DZDA 2F6RA 2LWIA 4QBFA 1MRSA 1W47A 2VEDA 2F43A 3QENA 4JMPA 4NH0A 3R9XA 3BB3A 4AKIA 1BMFD 3LX5A 4IKEA 2D7DA 3LXRA 3KXKA 3KKPA 2WVJA 2ONJA 2OO7A 3ZQJA 1FQKA 3K70B 1Z6AA 4A2WA 3R7WB 1KAOA 4UQOA 4XH9B 4B3XA 5FH9A 1X86B 2HJGA 2F55A 5DN6A 5EZ6B 3BD9A 3WNCA 2R44A 3RANA 4MITA 3AKEA 5GJBA 2BKUA 3IKJA 4C3ZA 4Q02A 2HV8A 1RRPA 3K09C 1TADA 2NZJA 3TSWA 2FNAA 2H17A 1R0ZA 3KTAA 3BH7A 1T0JB 2BIFA 5HPYB 1S9HA 3TH5A 3HYTA 4BEBA 1AJEA 5JHGB 3EARA 2QGZA 4RZUA 1UAAA 2ORIA 1N5JA 4XIGS 5FBQB 2ATVA 2H92A 3J81k 1NMYA 1SXJB 4XSGA 2W83A 4WVFA 5AJYA 1E0SA 5JI2E 1U2RA 2VSXA 1EESA 3I3SR 4KVAA 2HF8A 5KDOA 2PMKA 2VLIA 3NH9A 1II8B 1Q0UA 2BVNA 4GP6A 4DVGA 3U4QA 4LZZA 1O3YA 1AZSC 2A5GA 3EZFA 1M2OB 5E3HA 1W36D 3IHLA 1IJEA 3CWZA 1VHLA 2PH1A 3CF6R 1VIAA 1IAQA 1E4VA 2RGGA 3AKYA 5G3ZA 2VF7A 3E1SA 5HCIA 1ZMXA 2CVHA 2G1KA 4DDTA 4US2R 1LNZA 1SVKA 4OI2A 1FMJA 1WA5A 1CJUC 2C77A 3QF4B 2QENA 5TVKA 1LS6A 4W7SA 2J3EA 4QGHA 2HT6A 4BASA 5B30A 2GJSA 2F43B 4RZ3A 1UF9A 1S96A 3L8ZA 4M53A 3IEVA 4TL6A 2PBRA 5AUNB 4TQAA 5BXQC 2BCGY 2EW1A 2ORWA 1R0YA 4QGGA 2GXSA 2P6NA 3QQ5A 3RVBA 3I5XA 2B8TA 2ANBA 1CJVC 3EC1A 1E1QD 4NYMR 1E9RA 2CRRA 1LV7A 2GZAA 3H2YA 3HU1A 5KDLA 4DRZA 3U6BA 4A2QA 3DMDA 5F3WB 3T12A 1TF2A 5A4JA 5DYIA 2J1LA 4C0BA 4MGZR 2H8KA 1XCGB 4QGFA 3I92A 4KSBA 4D2IA 4IOKA 3I5YA 3CH4B 3MRSA 4A6PA 4DLXA 5CIWA 3PENA 3VR1A 2V6IA 2I1VB 1MV5A 1OKKA 3KTAB 1Z83A 2ZYUX 4RSGA 3KJGA 1Z2AA 2F1HA 2BJWA 2O0HA 2YOFA 3KXLA 3AEZA 1ZD1A 2JCSA 3U60B 1G9XA 5ANRB 6Q21A 1LB1B 1KNXA 2VP0A 4A1FA 2XTMA 4JLJA 2OV2A 5J4KA 2B7BA 1HY3A 5FTMA 4B32A 4IRUB 3PVSA 2GILA 3QXJA 2IF2A 2RMKA 4YXWA 5CM8B 1N0UA 4DLUA 5FTKA 2IHBA 4RD3A 5AJXA 1GNRA 1LW7A 3R8FA 4G5OA 4MRPA 4TT3D 1ZNXA 3U4QB 1BO6A 1ZUHA 1BS1A 4PQFA 5FBVB 4L5BA 1SGWA 3C7KA 4B48A 4DCVA 2W6ID 3D7MA 4ACAA 1A4RA 2IWRA 1Z6XA 1T9HA 3ZQ6A 2J46A 3AVWA 2XJ9A 1AS2A 4U5XA 3VQTA 4ARZA 2OILA 3U3KA 4Q1BA 2P6UA 4KVGA 4R7ZA 1EFRD 2OCPA 4RKEA 2AKAB 1N6RA 2H7VA 4CF7A 1N6IA 2ZUDA 3FFBA 3FKSA 1KY3A 3LX8A 3THOA 4W5HA 2JLQA 4LJYA 2ZUBA 3KB2A 4LY6A 5J4LA 1R8SA 4EJSA 5J5CA 3IDQA 2ZEJA 2Z5FA 2IK8A 4Z54A 5DSZA 3U3OA 3CZPA 3Q9LA 4U02A 1IXSB 1G7RA 3UANA 4HB3A 2GJ9A 3PEVA 5F9FA 5E4FA 1P2SA 1HYQA 3OEED 4HSEA 2WPDA 3FYHA 4TWZA 1JBKA 2E9SA 1NBMA 1DG1G 1KOFA 1DARA 2ZI5A 1SVLA 2D3WA 4PAOA 2NOAA 3SJBA 2FFHA 2DCUA 4P3YA 3NHAA 4IXMA 1C4OA 2BMJA 3QXHA 2ZRGA 5H8WA 1MOZA 2AD1A 1U0HC 1Z6GA 4BLPA 2JLXA 2FDCA 2BMEA 4EUNA 3V4FA 4L9SA 2HLDD 5GJVC 2GWHA 1GKIA 1NJFA 5EE1A 4DLVA 4LJ9A 3FB4A 2QMEA 4OYHA 1FFHA 2FFQA 4NMMA 5CB8A 2QA5A 3ZZUA 1GTVA 5FPHA 4EDHA 4L9WA 1U0LA 4PQYA 4RZXA 2XXAA 3UG6A 1E2LA 4HUQA 4X8LA 3CO5A 1E2JA 4XJXA 3QSYA 4PHTA 4M1OA 4M1KA 1CULC 3WRYC 1OIWA 5JEEA 3BRWD 3GPLA 4JLAA 1Z0AA 5FTNA 4ARZB 1GG2A 1QHYA 1KI2A 3IPXA 1XPRA 1XF9A 2PJZA 4U00A 4LHWA 1Y63A 2IHYA 4Q4JA 4TLCA 2RGAA 4BZQA 3A1WA 1N6KA 4PO9A 1DTSA 5FR2A 2JJ8A 1KO4A 1G18A 1R7RA 2CJWA 1AK2A 4JS0A 5CITA 4X8OA 2A5DA 2YWGA 4MRNA 3U3RA 3SJAA 4EJSB 1XMJA 4V0NA 4G5RA 4DWJA 1EXMA 1Q22A 2FSFA 2QAJA 4LJAA 3AVPA 3U3JA 2ZANA 421PA 1E2IA 3T1TA 1KI6A 2AK3A 1ZM4A 2PZFA 1AIPA 1IXZA 1JR6A 4NYIR 3FGNA 4NKRA 4URUR 2J0UA 4FMCF 4UNNA 3SQWA 2FGKA 3BBPA 1P9RA 1KI1A 3F5FA 4W5WA 3SUBA 1OIXA 4UNQA 5CK5A 1COWD 3GLHE 4IFEA 4ASUA 4B3GA 1IOZA 1CR4A 1E9SA 5FFMA 1HT2E 3AGPA 5E95A 3T9KA 2YOHA 2BV3A 3T1VA 1XX6A 3LLMA 4C0KA 4MRVA 1XTKA 4Z8YA 1E94E 1LF0A 3UIEA 1DBSA 4GPTA 1W0KD 1G64A 2X2FA 4ZO4A 1BKDR 2GHIA 3GLGE 4A15A 4JT4A 4RD0A 1XJCA 3KJIA 3SEAA 5C1BA 2G9NA 4HDOB 4IFBA 3KKMA 5KU1A 1GVNB 2EWVA 2B0OE 1VPLA 4JZKA 3HWSA 2GBLA 4LHVA 3VAAA 3I73A 1NVXQ 2BBOA 4TZ0A 1E2KA 3D8BA 3AF2A 2BBTA 4FMCB 2XXAB 1XRJA 1TQDA 2ZRHA 3NKVA 2FEMA 2AHOA 1II9A 1JJ7A 3BGWA 1J8YF 1CEEA 2ZETA 4HUQB 2MSCB 5G41A 3OIWA 2CLCX 4RD4A 2ZS8A 3LY5A 5FOTA 1G7CA 4D4MA 5C4MA 1E79A 1NRJB 1IXRC 2C99A 2CVFA 2QPOA 3A4NA 3R20A 2CE2X 4Z1MA 3UWOA 4DLRA 5HKKD 3AVQA 1OSNA 2GCNA 3WBJA 1XEXA 5FPKA 1YZLA 1SVWA 4Q4JB 4D25A 4UJ3A 2XJ4A 4B3FX 1CRQA 2OFWA 1JPNA 4MYTA 1CJTC 4WZBE 4TLEA 2CJWB 3CKLA 3K70D 4A6XA 2XITA 2Z4SA 2ATXA 1XTIA 1Q12A 1ZINA 4A92A 2Q6TA 2BEKA 2JLWA 4FXPA 4DUGA 4MGYR 1KI6B 3CNLA 4X8HA 2CXXA 4FWTA 3N70A 4PC2A 1UKVY 1GL9B 1XTSA 4N3NA 1SKYB 2F9MA 2J0UB 1DAKA 1YRBA 4B75A 2B7CA 2D74A 1IN4A 1WXQA 1NJGA 3VFDA 2JLUA 1BH2A 2R62A 2BMFA 4KFRA 2JJ2D 4LBYA 2YJTD 1EFRA 1P2TA 2JJ1D 3GJ6A 4GBMA 3RWMB 3O8BA 5AJZA 1GUAA 4IDHA 3TGPA 3BFXA 1PJRA 2REBA 4BFXA 2VHQA 3P4YA 1GWNA 1T0HB 4Q4LA 4D82A 3FDIA 1XXHE 1CTQA 1MO4A 2GJ8A 2DWOA 1GNPA 4H9GA 5AR1A 1RJ9A 4AWXA 5EJEA 1XTRA 1L8QA 5IF9A 2N46A 4G5QA 2KE5A 2WWGA 1QG4A 1KDOA 4HAVA 3VHLB 1CKEA 2MSDB 2ZROA 3THWA 2A78A 4TZ6A 3I62A 2QMUA 1E2HA 2ZYWX 2WTUA 3WRXC 3EZ9A 3QG5A 3B78A 1OE0A 2PMDA 3RSLA 4YLGA 1T91A 2GZDA 3B2EA 4BUJA 2UZIR 1NN5A 3F0TA 2XZOA 3EIEA 821PA 2QP4A 3EG5A 4NCHA 1FUKA 2WKQA 1WE2A 3THYA 2GDJA 1XDBA 3AVUA 2ZSEA 5L3RA 3QF7A 1XEXB 2CRWA 2RHMA 3A36A 1VHTA 1QHHA 2OEPA 4B34A 5J47A 4IVQA 4V0MA 1Z2CA 2VQSA 3K0EA 2PZEA 1FX0A 4NONA 2QPTA 2G6BA 1UBCA 3OESA 4S35A 4ZDIA 2NO6A 3K0AA 4DXAA 2OCBA 3VHXA 3QG1A 1Z0IA 1Z22A 3AF3A 2UZ3A 2ONKA 2PCJA 4D4LA 1F2TA 4PAQA 4TL7A 3EWSA 5G53C 3RYTC 4URXR 1E3MA 2P5SA 3SI7A 2Z6VA 3PUXA 1NN1A 3ZH9B 5DN6D 2VO1A 3EIHA 3EX7C 1DAHA 4I1UA 4B3BA 4M0LA 4RD1A 3W8RA 3RRZA 3GJ4A 4NCJA 4TMZA 5FUVA 3TR0A 5EP1A 2Z0MA 3ZZTA 4QC2A 1YR7A 5BN5A 3QY0A 3FMFA 4FCVA 1DAGA 5ELXA 2IYZA 2BKEA 4TMVA 4A0FA 4V0KA 4OBEA 2DWPA 4XWKA 2FPLA 2V55B 3V00A 3TSZA 2W6JA 2XZPA 1VDZA 3MWLA 2WSMA 2JATA 1SZPA 2ZREA 1WB9A 2RGNA 4Q1CA 4NCIA 221PA 2OZEA 4F4CA 4Q66C 1RJ9B 3MJRA 1N6OA 4E07A 2W58A 4BQSA 2P57A
chains in the Genus database with same CATH superfamily
4F91B 1NMSA 3ZI7A 3NR2A 3S44A 5B1AE 2PZ8A 2QJTA 1HZJA 3CEHA 3DBIA 3L8DA 5JHBA 5H3CA 4U04A 5AW5A 1Q20A 3NZEA 3UGKA 2ID7A 1FS4A 1V11B 4JD2G 1ZSNA 3PGJA 4F1SA 3KS9A 3QKSA 3PXBA 1ECFA 3D7KA 4LMPA 5E6SA 1E9EA 1Z28A 3SBDA 2EV9A 2Z98A 4EBBA 1UM9B 5B57C 4GC9A 3TLGA 3RTEA 4KXXA 4E7PA 4FC8A 5TDHA 3IHPA 1HI9A 3ZV4A 1BORA 4RK5A 3KLBA 2D13A 1Z82A 4BVBA 2Q29A 4K88A 1U8YA 4WXHA 3L0PA 1FX1A 5KPDA 3K09A 1DU4A 3OECA 5T41A 3K73O 4IKPA 2PX4A 4BJ6A 1GYRA 4BNDA 1SCUB 4FSDA 3WGUA 2PFKA 4AAYA 2JGEA 3RI3A 3SX4A 3IEUA 4ZT3A 2LE0A 4B4VA 2BKLA 2OGWA 4FJ2A 1IY1A 5LYJF 1MKYA 2RIPA 4I6JA 1YT5A 3LGAA 2VHJA 5ENRD 3OTQA 4P7BA 2TMKA 2IS1A 1T9GS 4CV1A 2WPDD 2FZCA 3I30X 2PVSA 4LWZA 2VOJA 2G45A 2EBUA 3EA5A 5EERA 3MTQA 1F4VA 2CGEA 4H1TA 1H2RS 2X7XA 2IXGA 4UOEA 4JYCA 3JAMA 3GCGA 3QBDA 4JJZA 5LL6P 2ZB2A 1I4OA 3HJCA 1VXOA 3H2BA 1UWCA 3QI2A 4CQMA 3OA0A 5JQGB 4FDVA 2VK1A 3FRIA 2JFWA 3NHPA 4PO3X 3TJMA 2GEUA 5HIJA 4C4YA 4ROTA 3O9MA 1UQTA 3MLEA 1E9CA 1OLUB 2HCBA 1KPSB 4KTVE 5EWMB 1YZGA 4LXTA 4UOQA 2EX4A 2ICAA 1YHYA 3KKKA 1UPTA 3FM8C 2Y4TA 2XODA 2Y1KA 3K4PA 5PNTA 2H1VA 5DI3B 2REOA 1LDJB 2YDYA 1D2AA 3G0DA 1X39A 1NP3A 2W6CX 2RHTA 4RA9A 4IIUA 3OQPA 1S63A 3BK7A 4A4DA 3DMNA 2O0KA 1TM7E 1UPAA 4UQLA 1GPJA 4AXHA 2VHUA 3PA6A 4RD6A 5HS0A 2AMJA 4OKNA 3F8WA 1U90A 3H2KA 2WXPA 5KBAA 2DUNA 3EGDA 2PBZA 3ZCTA 4YCJA 1L5KA 1DOAA 4FFSA 1O7JA 2G36A 1E8XA 1RI5A 1YO6A 5K3OA 2A7QA 2VTVA 3V34A 1CX9B 2GCPA 4Z2AA 1T5TA 5CA0B 1SVIA 1E2EA 1V2HE 3S5JA 1Y6JA 5CX4A 3IDOA 4COOA 1X1DA 1T2FA 4OHOA 5DYNA 3COYA 3U4DA 4HLLA 4IYRA 1M66A 4NZYA 3PH0C 1KNQA 4HOYA 1ODFA 3RSCA 4EYSA 4Z9XA 1WB4A 3D5EA 1RRCA 3EASA 3N0VA 5KJ1A 5JSUA 3SQOA 3FUTA 3LO8A 3I09A 4QFCA 1TLTA 3R41A 4X6LA 2Z83A 1ZHFA 2LIVA 3DEOA 4P3OA 1JLLB 4DC0A 1HF8A 3LUFA 3KXIA 4Q7EA 3VDMA 2J0SA 2JNWA 2BR4A 1PLKA 1GPMA 1TKCA 3MUFA 1DO2A 4YDHB 2RHBA 2GTIA 3MFYA 2C5LA 1BQEA 1ULBA 1U5CA 5HKOA 2JLZA 4RIHA 1ELRA 1GQSA 4UMVA 4DJDC 1DFGA 1JHZA 3WGLA 2VAPA 4QAJA 3TB6A 1X70A 2O52A 1U7WA 1YVPA 3ZI0A 1E0JA 1EWKA 3E3OA 3W79A 3VK6A 1PR3A 3IUPA 4JKOA 1I7LA 3ZJ5A 2AIRA 2CNOA 4PWYA 1PJQA 3BSYA 4FIDA 2MYTA 1CUIA 4J1TC 4BATA 5JZ9A 4DMMA 5H4HA 3RK0A 3PDIB 2D5CA 2HJRA 2H5EA 4JVNA 4KKVA 2GBFA 1N0HA 1OD6A 1KWGA 4BZZA 2GYYA 5D1LB 3SC3A 2AMYA 3AVVA 2L19A 4Y2YA 3IV6A 4DMUB 4E1VA 4BC1A 3LD9A 3GLFE 2WSLA 4FD2A 3CUUA 3C4JA 3I64A 4HLDA 5JLJA 1LF8A 4Q1FA 5ICSA 5K0ZA 3C4QA 3AI3A 5JPIA 2HYDA 2ZW9A 3KHKA 1DGQA 1VHWA 4HRMB 2JARA 5BVHB 1QGUA 3DE7X 4IV8A 4WNCA 4QJ3A 2DHDA 3CLUC 4BZXA 3VNBA 1E0DA 5DBIA 3U44A 1INZA 3PKZA 4XA8A 2GRPB 3VKGA 2C9OA 1G7TA 4M4SA 4M55A 3BKWA 1OXMA 3AI2A 5GY7A 3S7DA 4Y1GA 1XJ5A 4XX0B 2L5UA 4BVJA 1RTKA 3X2QE 1YR1A 4U7EB 4PZCA 5P21A 2VL7A 3A4MA 4F5DA 4QJ4A 4K6FA 4V0RA 3DSWA 4F93B 3G0BA 2ZB4A 3AY0A 2ECFA 2ZTLA 2ECGA 2Y1MA 2NVBA 2J9ZB 3BORA 1R0XA 2DZDA 3CZRA 5LWQA 4AD8A 2B5OA 1Z6PA 3VV2A 2JGMA 5AW1A 4WNEA 4CLOA 1M5TA 2TYSB 4P58A 4IHJB 3ITEA 3U0VA 1JDUA 4HYEA 2V74B 1WEPA 2HMAA 2ZDHA 1B0UA 2A86A 1A9ZA 3VZCA 4EL5A 1NI5A 1YB1A 1QTRA 1E18A 4B40A 4BMDA 3HN6A 2PTGA 1KYIA 1E1MA 1KHTA 5ALXA 1WOMA 2X3MA 4DR2B 2DSNA 3TAUA 4MQ6A 1MB9A 4I1PA 5ENVA 3IE1A 4MR8A 2O3JA 3ITKA 3AR7A 4FK8A 3RIXA 3ZXUB 5T5QA 1BEUB 2R7LA 3MHTA 4DR6B 5J3JA 1EQ2A 1RAFA 3RF6A 3LF1A 4PTLA 2ZDGA 2PWPA 1M2KA 3AP2A 2ON6A 4R1TA 1BE6A 1JOCA 5G02A 3RVMA 3K0CC 3QVGB 3FGZA 2KBFA 5I4IA 2J7PA 5I48A 4IXTA 1Z73A 1Y6RA 1IPEA 4TV9B 1NZDA 3SF0A 2ZFUA 2DHCA 4PGGA 2FLWA 3DQZA 2PZJA 1TUGA 2ZYIA 3DSXA 4URYR 1VJ1A 1XF1A 1IN6A 1OWLA 1UDXA 1MVNA 4OXNA 4Z9FA 3AG4E 1EGQA 5UKDA 4Q4HA 3D3NA 5A4AA 1ZXLA 4P0PB 3DVRX 3PGKA 4RQUA 2VATA 2WD9A 4J0GA 1U9IC 3FPGA 4LHSA 3G7SA 5LMCA 3H42B 3C6KA 2G8NA 1N11A 2I34A 2WTBA 1QWOA 3ONKA 4JCCA 4X1YB 2NX2A 4X8MA 1WPQA 1O94D 1OV4A 2RBGA 5SVYA 3SM9A 1TB4A 1B8NA 2GNOA 4DS3A 2PMWB 2QTTA 5IJXA 2YURA 1WW8A 4ER3A 2A0YA 2VRWA 5E38A 1VYXA 1Y48E 4PIMA 2EILE 4HOUA 4QICA 3NHFA 3W34A 3PFBA 3GZ4A 4IAOA 3V8EA 2WTAA 2OCGA 5EGNA 4MCAA 4PWZA 2B35A 3JQFC 1KI9A 1TIBA 4CGYA 1G16A 2HM8A 4O4JB 1ACJA 3IP9A 1L7OA 3RS9A 2EQXA 2PNNA 2QZ4A 1KAEA 3KQPA 1GW6A 3AKDA 1X1TA 4AUKA 1Z2QA 3EOZA 1PFGA 4DX2A 2KYUA 4HDSB 1XMSA 3Q7TA 3C3AA 3WL8A 2O1SA 1ISHA 4B80A 2HNKA 2RFLA 4E5KA 1OWOA 1NI4B 4CEIA 1JTEA 3D1VA 2MR6A 4N9QA 5SZJA 4RQAA 3Q7EA 3M6WA 2P41A 1AD2A 1CUGA 1D0SA 4Z3OA 3Q5EA 3OOHA 2X6FA 2NYUA 5I4BA 4W1SA 2EC5A 3WIEA 4YMVA 5CA1A 5DHAA 2WZQA 1ZOPA 3OFNA 4I8DA 4YRDA 2Y0BA 4N5LA 3AV0B 5CRVA 4YAJA 2VF8A 1YHNA 3M1YA 5JAQA 5ER6A 5ICMA 1K63A 3ULYA 1O87A 3FUHA 2Y67A 3S1AA 3TNJA 1U99A 2WOJA 4ILKA 3EDRA 5CHEE 4GI3A 4DLPA 2ZSJA 4PX9A 4O2BB 4YS6A 3LCMA 2WJWA 2P11A 4WXRA 1SUDA 1JFFA 4FEGA 4F2PA 1PKEA 3LXUX 3NVMB 1GM5A 1AU9A 2M6LA 3LC1O 4EZJA 2IIBA 3N9OA 4HBDA 4QDTA 4CF6A 2Q4TA 2L0XA 1FNSA 3SBEA 4JOCA 3JS5A 1UBFA 1CY6A 3DT6A 2IV7A 4PN7A 2Y1CA 3KFVA 3AAAC 2IY9A 4REMA 3SZ7A 3QKWA 2HA0A 2BCEA 4YMWA 2FV8A 4J75A 5HS4A 3SFYA 2AC2A 1EU1A 3QLUA 3A7EA 3CIFA 4HX9A 2FZLA 4J0DA 1LSUA 3PRYA 3OLZA 2RC5A 4E2ZA 2FSGA 2AN9A 1L9KA 1ZCFA 5JDCA 3IMKA 5AFSA 3D4IA 4EB6A 3S27A 2CONA 3RUPA 4KMMA 3GQBA 5KYUB 1W8IA 2CFIA 1PJZA 4U7TB 3SYLA 3SN6A 1PJTA 4PUCA 4RA6A 5JNVA 1DXOA 1FTNA 3IP8A 1L3BA 3LLUA 4G1TA 2DETA 3QVTA 3PNLA 1R5BA 4PX2A 4J2OA 3ERCA 4CEHA 5ALRA 3UC5A 4Z7QB 2R8PA 3OSZA 3F6CA 2HDPA 2R9VA 1BYIA 2NTJA 5ALWA 4B31A 4JT9A 1CFJA 3AUAA 1OAOC 3NHMA 2B21A 4G0XA 4DLTA 3UHJA 2GJAA 3PSAA 5FKJA 2HRQA 1NUHA 4GOMD 3Q3GE 3RV3A 4PG5A 4OFZA 3LQIA 2AR7A 2FUEA 3PWTA 1X0VA 1ZGCA 4MDHA 4UE2A 3A04A 3AU5A 2UXDB 2G5PA 4TVBA 4KQ9A 4F1WA 1GOTA 3KSBC 3D1LA 1IZYA 1XJQA 4K1XA 5KB3A 1RP7A 1ODSA 3FTZA 5LNK1 2HQRA 3B7WA 3ZRHA 4J90A 5CLIA 1EI9A 5A5GA 4WL0A 5K0JA 1HWYA 4ANVA 1OXXK 4MLCA 5JBIA 3E9RA 3FVQA 2HE0A 3SYTA 3KV6A 2A1TS 1A2OA 1ZVQA 4WNAA 4BO1A 4CEJA 5EINA 4Q6BA 6LDHA 5KMGB 4X45A 1E9FA 4JASB 3E7WA 1H4QA 4LNUB 4X85A 5GZ1A 3S2UA 2RKWA 3DFIA 4N8DA 5CX1B 1ZUNA 3H8SA 5FOSA 1TK9A 3TZEA 5DN9A 1GTMA 3ST7A 1FNBA 2HDOA 2DGDA 2UWJG 1ULSA 3A6FA 2IU6A 4YPFA 2IDMA 4AZVA 2AG6A 1F38A 2RGNC 1HF3A 1W9MA 4BFVA 2WA2A 4WLVA 2FX2A 4CM1A 4WD3A 1E3JA 1OFTA 3PIRA 3V3TA 5K0CA 2WXGA 4RESA 4DSNA 2O3SA 2I7CA 4LGYA 4KLZA 5JI3E 3USES 3PDNA 2QG9A 2W71A 1Q15A 1HFEL 1DTWB 4AJOA 2MA5A 1GADO 3VR5D 1W2GA 3CB4A 2CJFA 3K16A 1MOPA 3TQOA 2O2JA 2C4MA 3LX5A 1RS0A 1KJ9A 3LZDA 3PFWO 4D44A 5THXA 3H97A 2R84A 3JARA 4D9CA 3LBYA 5FH9A 1N5RA 1WDKA 5DN6A 3IOMA 4MTCA 3WNCA 2BFCB 1XE3A 2SKDA 1PT7A 4Q02A 3BE6A 4ZT4A 3CQGB 4ZANA 4JR2A 1UP6A 3U09A 4ZHSA 4OF4A 3NETA 4L6AA 1K7YA 3AHIA 5FWYB 1T36B 4WCFA 2HF8A 3NH9A 2VT6A 1JQEA 2F48A 1IJEA 1J0DA 3CJTA 2X6KA 1IZZA 4DTIA 4UI9K 2CVHA 5E4YA 1QKIA 1MYOA 4GOLD 4HX2A 1FQOA 4G8JA 4LF9B 1A5SB 2XXJA 2WMDA 2O9JA 3C8ZA 3T1HB 5I5EA 4TQAA 3QPCA 3G8DA 1NYLA 3MGKA 3GBVA 4G5FA 1DCTA 2CRRA 3VR6D 2NW6A 4JITA 4BVEA 3F6RA 4MGZR 1L7AA 2C5BA 4DLXA 3GG9A 2ETAA 1P2GA 3LPMA 3KXLA 3DQPA 4GZ3A 5ANRB 1LB1B 4A1FA 3N71A 4JLJA 4ZYZA 2AXUA 2HSJA 3ESAA 1RQ7A 4YXWA 1N0UA 4OHPA 4G5OA 2DCMA 4A1OA 4TKZA 2KCLA 1F6WA 1Q0PA 2P2DA 1L8AA 3JQ9C 4HUJA 1OZAA 3EGXA 2R1TB 2PKWA 3U3KA 1GLVA 4WNDA 4L0DA 1QIJA 4XYEA 2F3UA 2Z3ZA 1G6KA 3ZU4A 1NNLA 1CB0A 4JHLA 1P2SA 4OHKA 5D5PA 3FYHA 2FMIA 4I1IA 1GYPA 2VJQA 1MN6A 3B5EA 2FFHA 3CF4A 4RMNA 5A9SA 5H8WA 1JLMA 5D1MB 4DLVA 4OYHA 1F3LA 3RC1A 2BM9A 1AKQA 2AJDA 4EZBA 2NU8B 4M1KA 1OIWA 2NSZA 2ZVDA 4F3NA 4X41A 1VPWA 1XPRA 4U00A 1HX8A 4PO9A 4BNJA 5AHOA 3NANA 3IEKA 1ISIA 2Q6VA 3GLQA 3CNEA 2Q45A 1HZ4A 4F60A 2IO3C 4BZWA 4W5WA 5IYZB 3G5AA 3V2OA 4PPEA 3OT1A 4UPVA 1QCZA 4GPTA 2HJ9A 3GLGE 5B1BE 1DKRA 5AJUA 4W5OA 2G80A 4HDOB 2X40A 4LN1A 4PAWA 3EG9B 4F45A 4IRMA 6REQB 1C50A 1K75A 1IAVA 1MW9X 3MTBA 3CKBA 2AHOA 5ALMA 4I4TB 3QE3A 3R74A 2F4VB 5LIPA 3LY5A 4BVGA 1LC0A 5G1NA 4DLRA 3QTTA 1VRWA 3VLFA 3COZA 1XNRB 1ISPA 1XLTC 2SECE 3FWZA 3UWMA 5C7YA 3FOBA 4MYTA 4M6WA 3SKXA 3STUA 1QHFA 3EBPA 4NK4A 2YBEA 1P17A 5BWLA 1KI6B 4JQOA 2EIME 2B7CA 2OECA 4PEVA 2QDKA 4QYSA 1GA1A 3ELYA 4PBSA 4V2UA 1YZYA 4DANA 1GUAA 4B3JA 4GPKA 3T7IA 1L1QA 4EBAG 4H7DA 1ODTC 1RQGA 4AZSA 1YFKA 3HMKA 2H1FA 4HWOA 3TX2A 2H06A 5EJEA 4HWKA 5LDHA 4XRGA 4HAVA 4MV7A 1J5EB 2ZROA 2QMUA 5E1MA 2ZYWX 4EVRA 5LQRA 1OE0A 4OY3A 1S6YA 3LHFA 1FVOA 5AOAA 821PA 2RSDA 4U9HS 3VH3A 3GIDA 3FTYA 4MICA 4D9HA 4QE3A 1EUDB 1JT2A 1V11A 1T1RA 3Q3IA 1RMDA 2N3ZA 5K3QA 2GN0A 3PNMA 1UM9A 3Q9UA 5G53C 4QYMA 1ONOA 3EIHA 1TCAA 4OUDB 1YL5A 4LJSA 1R27A 1YR7A 2ZUTA 2YN0A 4A0FA 4B3MB 2I6FA 3H83A 2GPNA 221PA 1RJ9B 4B79A 4BEVA 3ZNNA 4ISCA 5JSHA 4MWOA 2GVZC 3BMCB 3IDAA 1SCUA 1Z37A 3L8EA 3VZDA 2HXYA 5H02A 1C0EA 5FBRB 3DE3X 4H2DA 3THYB 4I14A 2NTVA 3LFUA 3CCBA 3CX7A 3TF5A 2ZRMA 3HYNA 4MWDA 3DR5A 1Y7HA 1JDTA 2Z95A 2OPHA 3MBOA 3HZZA 4M22A 1ZL2A 2YUIA 5KVSA 4ZEOA 1YQUA 1NATA 1UJKA 4MBGA 5LLDA 3AXSA 3ZWQA 3Q7AA 4GNDA 3EIOA 2VYNA 3ODGA 4HD8A 5IDYA 3NAMA 4FYYA 4ANFA 1KRXA 3FVRA 3VUFA 4KG7A 1ISMA 5EDSA 1KR2A 5EJ5A 3TLCA 3SY8A 3RTRB 3FNBA 4AIIA 1TU0A 3SIWA 4ITRC 4R01A 3ZQKA 2LPMA 2QX9A 1GA6A 4B3IA 5TMEA 4ZJZA 4MJXA 4DAOA 2OO5A 3WK8A 2JCVA 2J45A 4JIMA 2C8JA 3BTUA 3NBNB 3WI7A 1EFCA 1XVIA 1RQLA 4QEZA 2FR1A 3FSEA 4LVUA 4QXRA 3KOZA 4H08A 3INYA 3B1ZA 1DFHA 3UHFA 1OLUA 3ES9A 5EWMA 3KIPA 3MWKA 2IYAA 4J8DA 4F6LA 3X1YA 2V0PA 2CFUA 4MWGA 1SVUA 1UCFA 3HBMA 3P9CA 5DI3A 2HYIC 1PQ4A 3C45A 3RHZA 5IXYA 2QRQA 1M8FA 4XTCS 3Q2IA 4GO1A 4MV5A 1IULA 1X87A 2LCFA 2QD5A 1ZQ1A 3I5PA 3G2OA 1BKSB 2W6QA 4DSTA 4Y2QA 1YQXA 4Z4CA 1Y1KE 4MVWA 1IK6A 1VLJA 3KXDA 1ULHA 3HSKA 1XFDA 2Q1XA 2A4KA 5LMZA 2OYSA 5ALPA 4W5NA 4TTJA 4WNYA 3ZUPA 5CA0A 3GJRA 1J07A 4R2HA 1LW6E 1TL7C 1KGSA 1T3SA 2HBYA 4UE3S 4GPD1 4EKYA 2FE4A 2CLLB 2ZUUA 4GCOA 4OQLA 4B6JA 1YFZA 4QSMA 2E18A 2H2FA 3ZLJA 1N8KA 4B6FA 1PAUA 4RMHA 2LN0A 3H19A 2YW9A 1IWBB 1VC2A 3WLHA 5FLEX 2R5SA 2C2KA 4HYYA 3I28A 1FP2A 3HJGA 4RH1A 3PK0A 3FN4A 1JLLA 8OHMA 1FMLA 4FEYA 1NVUQ 4J7WA 1UAGA 3I1IA 3OHSX 1P0MA 3QE9Y 2GERA 4YMTA 1TJ4A 1ZAKA 1XRNA 2WIKA 3HSSA 1J00A 1QP8A 3VM6A 2PT5A 3OJLA 1RYHA 3IMCA 4F7WA 5TXGA 2SKCA 4GF5A 1H2YA 1LU9A 3TGLA 3OJ0A 1VIDA 3UINC 4WAUA 3DZIA 1ECCA 4FTWA 1IATA 2VK4A 3KDAA 2XNSA 3O4RA 3L7BA 4IH4A 1QDUA 3H18A 1L4LA 2R3SA 3SDSA 1IBMB 5CT9A 1IU9A 3FUWA 5EZYF 3ZHQA 3O7MA 2Y93A 4YECA 4QZVA 1R6BX 4C6RA 4I43A 4K9QA 4W4TA 3P2OA 1L7RA 1LK7A 5CIYA 3PDIA 3MLAA 4MVJD 1T4BA 4OH7A 2N9UA 2YOGA 4RLSA 1Z7EA 5AQ7A 1UJCA 4CIAA 2WG2A 5KH9A 3E15A 1E9DA 3GXBA 2P4EA 1NVTA 4LI3X 2YXLA 2JD2A 1OXTA 2QRPA 3PNKA 1BAPA 2ZBQA 4KFCA 3CEQA 1SZ9A 1DDGA 4IJUA 3RSGA 2A5UA 1L4KA 1WTCA 4UVGA 5JROA 4QG7A 4J7AA 1H6DA 2Q9BA 3FUDA 1OFIA 3JZIA 5BVHA 4C4AA 2E4AA 3PP8A 2YL2A 2IYWA 4NBTA 5BSWA 4NPCA 3PD1A 2E0IA 3ONFA 1EDDA 4FMPA 1M6YA 5ECDA 3SXUB 2QTLA 1UBNA 2V4HC 2HWKA 4WUYA 3SD5A 2RGEA 2AVNA 5AKZA 4XX0A 3OE4A 5F1OA 5E3JA 4LG1A 2JFFA 2H2AA 3JQ8B 5DYGA 4JBXA 2DUJA 5IK2D 4BFRA 4S0ZA 4KXNA 3PUYA 1ZJ6A 1X0XA 4HWRA 5AJVB 1Z8NA 3KR9A 5L45A 2JA2A 4W5QA 1E9AA 3VH2A 1VSQA 4NFLA 1QQTA 5K6AC 4KO3S 4AX4A 2OFFA 4X00A 4DLYA 1N9AA 4FU0A 4IHJA 4HI8A 2FPXA 2IS6A 2E4ZA 2QE7A 3QVVA 2XZDA 4DA7A 1YB2A 1DJQA 1QYXA 4CLRB 3AEKB 3V2UA 1CYEA 3F4KA 3AT1A 3RC8A 2B78A 3A1EA 3T8MA 3ISVA 5IHXA 1VE9A 1EZ4A 5BR8B 4OCZA 5C34B 3AM4A 4WK4B 3X1ZA 4EHLA 2KJQA 2UVQA 5C7OO 1P3Y1 2DJIA 4NDZA 2KGIA 2J09A 3QUTA 1FFGA 2G9QA 3W5IA 4B71A 3VUEA 5IF3A 3T9CA 1MUUA 1IFXA 1ZI6A 4BMSA 4BFYA 3HO8A 4FB5A 4YQFA 2OE2A 5CURA 3QVGA 3GJ3A 2O2DA 1NF3A 4TV9A 4IJMA 3HBLA 3MT0A 1QG2A 4FA6A 1P7PA 2R6AA 2D3TA 5T6MA 4NOJA 2CNNA 4BKOA 1P7VA 3PHBE 1SRQA 1MMFB 4OHWA 2PUTA 4PGHA 1XA4A 3HG0D 2DJ5A 2BGUA 1WQ3A 1YZQA 2QAGC 3L05A 3N7TA 1MQ9A 3ON5A 3EPLA 3OXGA 1VKOA 2BF4A 3HNRA 1PYOA 4G41A 1MW8X 2HYED 2KBEA 1TFUA 2AWOA 2OWDA 3W2TA 1EK1A 3I9KA 4PQGA 2M9MA 1M8PA 1LVUA 3GRFA 3WA7A 4CVNA 4HH1A 3CC8A 1MTOA 1PEDA 2B4TO 4HEJA 4X1YA 4A0CD 1XZKA 5LOVF 2KR4A 1OBHA 3RKUA 1BVYF 2R7MA 3MWDB 1XVLA 2JJQA 3BTOA 2OKCA 4GDFA 3BMNB 1AS3A 1E5QA 4ZT2A 3TDMA 3KJNA 4O29A 2PA3A 1ELWA 2GZHA 2QYTA 2QUKA 5KYTA 2DSMA 5BV2P 1OFGA 1ID1A 3U66A 4RTSA 3NDBB 4YCBA 1W19A 3MQ2A 1YS4A 4I55F 5GZ3A 4O4JA 4WIAA 3LDYA 4C6SA 4ZQBA 4ZCIA 1EJ0A 5AOCA 2PL3A 3IXEA 2BR3A 3L4BA 4HDSA 4BVAA 2CLDX 1F7UA 2R2LA 2XOKA 3FF1A 3I01M 2ECWA 2C9YA 2B3TA 4H1HA 2X5XA 2AD5A 1M8JA 3FBTA 2V6BA 4ILEA 2JAHA 2BDUA 2QU7A 1NI4A 2IVZA 1XTQA 3N2EA 1HMPA 3TVYA 1I10A 4HNAD 1W4BA 3EQ8A 5DASA 4JGBA 4R7TA 4LJ7A 1E2DA 1ACMA 5EIAA 2AKEA 3IIEA 2ATIA 1ZM2A 3TBHA 1P7ZA 2XP0A 3NBZC 4GX2A 2YVRA 2OPBA 3UXEA 3TOSA 5FQOA 4FI3F 2CDAA 3VO9A 5HQ8A 2M1ZA 3IO3A 2XRMA 3QW4B 3Q7QA 4ZT5A 3PLWA 1A5ZA 4QUHA 4O2AB 2P2CA 3B1WA 1LEHA 3TZCA 1WUKS 4IO1A 3HXLA 4YP0A 5BSUA 1HT1E 1ZU4A 2EG9A 4KLAA 4NFHA 4E5DA 4N6OA 2OWAA 4JQSA 3BRSA 3DRAA 3SIRA 3BFPA 5AD1A 1Q7TA 3L0SA 4CIXA 4PZDA 4PYJA 2QPAA 4O2BA 3ADDA 3WIBA 5CCBA 3OIGA 1IXKA 1WXGA 4RPGA 4IJQA 1M1ZA 1EGAA 4ES6A 1LI4A 3COVA 3FHLA 2ZI9A 1PT6A 3TUJC 3HO1A 5JSKA 1OASA 3N2KB 1E8MA 3LE8A 4LXIA 3U3ZA 4Q3BA 4YAOA 1B8UA 3H05A 3BWEA 1X1QA 4BMZA 3PZDA 5FXMA 4Z4FA 1IJFA 5EI5A 2OESA 2O2IA 5KSZA 1T6BY 1JWAB 2DPXA 3QBVA 4CMEA 2XPZA 1LY1A 2AB0A 2MR5A 4ZK6A 3OZDA 4BQOA 1G20E 2HO4A 1VMDA 5FOWA 2J32A 4OU5A 1R5NA 5FWDA 4GZ6A 1V5IA 4OXIA 3SM3A 4PZLA 1GZHB 4S3MA 4G37A 4MW5A 2PD3A 3MLBA 3TK1A 5KYUA 4TROA 1SN7A 4ARVA 4QQFA 3GMIA 2O07A 1TZCA 1FXWA 2VQDA 2IEYA 4HXGA 4PPGA 4E2FA 1UFVA 1ZW6A 4DRYA 1QMGA 2C4HA 5C5IA 1C5KA 4MKGA 2W0MA 2LCIA 1EUYA 5K05A 1T5BA 3CM0A 4HGOA 1LK0A 5K8VA 2GF0A 2K6GA 4HN9A 1ONBA 4L08A 5A3JA 4LYFA 1AKWA 1L8XA 1SXQA 2BGNA 2EKQA 1SC4A 1DT5A 5EFOA 1MGOA 2PH3A 1UPXA 1UBRS 5FWNA 3ZBUA 3N9NA 2W4IA 4PRZA 3X44A 1N7JA 4NJEB 1F9AA 2HD4A 5E7IA 3FCOA 3CLRC 1AP7A 4K40A 1O95A 2PFGA 2P3LA 2MT5A 3RRJA 3DDSA 3GZ2A 2AEMA 2ZVQX 1VCIA 5FCDA 4ZHQF 2XD9A 2QTMA 4DB2A 3FHCB 2EJBA 3ENKA 3R3HA 2I9CA 1JQ5A 3EQ9A 2BZGA 3T7KA 4MB6A 3CEMA 3Q9SA 4JL5A 4YRSA 1WNFA 4NEHB 3HDYA 2O7VA 2GGFA 2X13A 3VR4H 1I13A 2IQ5A 5JJLA 3QWFA 3EC7A 1OLOA 3PTZA 4LF8B 4LCTA 1XPJA 1U0TA 3DMFA 4GPAA 2FWRA 3H0KA 3OPNA 5TQ0B 1W76A 4JBWA 4EFDA 1I1NA 3B51X 1G2QA 2FSIA 4UFNA 4X54A 1O9HA 2EA6A 7REQB 3TW4A 5CEJA 1UC9A 2D8AA 1QONA 5MHTA 5LLTA 3TL6A 1D6NA 4X6YA 4BC0A 3OZAA 5KMGA 3S1SA 3OJOA 4LBVA 3DKIA 1NQXA 2GK4A 4LNUA 2O5EA 2NNWB 1THZA 5CX1A 2DFPA 2FW6A 2W2LD 4ARSA 1RU3A 1NC1A 4HLEA 1HE3A 4YDWA 3CNOA 2WM9B 4JNCA 3IP1A 4OLFA 4MJLA 5EKTA 4HCJA 1TXGA 4RU1A 3MM4A 2A3RA 1JR2A 3DTVA 4KN8A 3W1WA 3WBFA 4POOA 1SQ6A 3ETLA 5L7TA 3H3XA 2XEUA 2QR3A 3WBBA 4LPKA 2GAFA 3PJDA 1INLA 1Q1NA 1B0AA 1XHEA 1RMTA 2B36A 4RH0A 4TV3A 1GPAA 4L6CA 4A0QA 3SEZA 4LFBB 1FDTA 1HA3A 1ZR4A 3M6AA 4BQRA 5F23A 1K66A 2D2IA 4AY2A 3LUDA 4GKVA 4ZJPA 1TMKA 2V6GA 3OJEA 1DTWA 5TR9A 1YTUA 4PZZA 4MAFA 4C5AA 1R0RE 2GA9A 2I80A 4OHRA 2CCGA 1IYZA 3BWVA 3KQWA 5E0KB 3EEOA 3DLBA 4BE9A 3IALA 4ZHBA 2PRKA 2PJRA 1UZAA 2HPAA 2ALJA 3L0BA 2BFCA 1K8RA 4F4UA 2FBNA 2QG6A 5ALDA 5CBOA 3DLIA 2X7HA 2LXMA 2KLHA 3O8QB 3IEMA 3THSA 2TSYB 1Y9AA 2WSYB 1L7PA 1A7JA 1E1DA 3E35A 3TWWA 3Q15A 2HQOA 1EE1A 1H1TA 5EX0A 5FWYA 3APFA 1T36A 1I4TD 1UIRA 3EWAA 1TD9A 1U2GC 1VHDA 2YSJA 5LUAA 2NAAA 1NV9A 4DGQA 5KAPA 3L46A 4R9RA 1KDRA 3AU9A 5K3DA 3DZDA 1ZD4A 5IEJA 1RI3A 2QVLA 5FA8A 4EZKA 1ILEA 1FSGA 1XNHA 5FV4A 3JTMA 3PYLA 3VC3A 5KX5F 5ELLA 4EJMA 1PFKA 2BP7B 1IEVA 4EVQA 2FRVA 4TWJA 1N95A 3O0TA 1T0JB 4NULA 1AF4A 1TW3A 5ANRA 2ORIA 4I2ZA 4A4BA 3FG9A 3ZWYA 2W83A 5AIJA 2W2OA 3KE8A 5JI2E 3HXQA 3CWZA 2QXYA 3SLRA 4LMBA 3ZTWA 4DDHA 3AY3A 1SVKA 2R1TA 1P8JA 1JBQA 2WYOA 3ICPA 3BL5A 4RWZA 4ZCPA 4IHKA 2C2VS 2BCGY 1IVYA 2ANBA 2IHKA 3WMWA 3NHKA 3P96A 1IM8A 3B6JA 5K0FA 3C1OA 5A4MS 1CDEA 4UFPA 2Y66A 3P9KA 3VR1A 2I1VB 3B3FA 2O14A 3BMOB 4O1HA 1KNXA 3LS2A 3N6XA 4D5GA 3O2SB 4IRUB 3QXJA 1MB3A 2RMKA 1D5WA 5JAUA 1Q83A 4XEUA 1X15A 3J7TA 2NU8A 3L02A 4S1PA 2I66A 4L5IA 4U5XA 2OILA 1SUCA 1Q7EA 1V2GA 1N6RA 1E1LA 1WMFA 2P79A 1N6IA 2ZUDA 3UMYA 2JLQA 4DV2B 1EBBA 3OM9A 4GTOA 5JY1A 4TZKA 4HB3A 1E5DA 5BMVB 5B6PA 5IYZA 2A67A 1WCIB 2MD7B 3SXJA 5A5DA 1BQ4A 1U7DA 3RKVA 2ZRGA 3CVXA 1IHBA 5EJIA 3O9VA 3EG9A 6REQA 2FDRA 5DINA 4KHPB 2QYJA 4WLUA 3W05A 3NRCA 2BAYA 3UG6A 4I4TA 3DEKA 5TPZA 2ZZKA 4KDEA 3UUFA 3AR6A 4LQ4A 3Q3EA 4KXUA 3A1WA 4FDUA 4G97A 3WKAA 3U81A 4QQNA 2WM3A 2FZKA 3DE6X 4AZ3B 2PY6A 2SKEA 1KI6A 1RLTA 2DU8A 2ZJ1A 3Q7SA 1YJBA 3SQWA 2FPSA 1UINA 2EHJA 1OIXA 1NPYA 4HRNA 2CVQA 1Y5MA 3EUAA 4KXYA 2AFHB 2CJPA 1K9VF 2GRRB 1HQDA 1W1UA 3OX1A 3M6VA 3X2EA 1J8YF 4OJTA 2C4VA 5JT1A 1AKNA 3AS5A 1GG5A 1EUDA 5A7DB 2HSEA 3H9QA 2X0RA 4NDNE 4B3FX 1Z33A 3PFHA 3VNQA 1P0QA 1UPUA 5KNCD 2BEKA 4H7YA 3RARA 3T4XA 5I51A 2JIRA 3CNLA 2HCTA 1UKVY 1GL9B 2QTWB 3GZ1A 2CLKB 2J0UB 3LU1A 2PXXA 4IZIA 4OUDA 5GINE 5C3MA 4APOA 1Q7CA 3RWMB 3RBZA 1TMGE 3PPVA 1QH8B 3F6YA 1VBFA 3LBAA 3P4YA 2IEGA 5YASA 1BXZA 1RJ9A 1IM5A 4DF3A 3NVDA 2JIBA 4ZOLB 1JCRA 1K5HA 2RHRA 3BHIA 3BMCA 4ENRA 1LRLA 2AUNA 3ACBA 4BUJA 2QP4A 4U63A 3RM3A 3THYA 4WLOA 4B34A 1UBSB 4IVQA 1LDKC 4BRSA 3RH0A 1ZN8A 4JA2A 1UBCA 1U80A 3SVZA 1MNAA 2D5IA 3D2LA 1K1BA 3URMA 2E6SA 4QG3A 4DKJA 3BZBA 5ADWA 1YDEA 3HUUA 1GLGA 5DTQA 2UUAB 5ELXA 3P9SA 3IAAA 3PGXA 2ZREA 3ID6C 3M62A 4O4HF 3A2NA 2RI1A 1DQPA 4PYOA 2EDCA 2M32A 1TYZA 1KDYA 3FPKA 1GUZA 1HE2A 4QPNA 3BILA 4GZMA 2WMOB 7ADHA 3EAQA 4HP8A 1P2UA 4DJFC 4NG4A 4ANUA 3AHFA 4HV4A 2HHJA 4B8ZA 4XTRA 4MGEA 2PYZA 2WM8A 3B85A 3VHXB 4RJ2A 3K1ZA 2E85A 2NO1A 4L5JA 3IE0A 3SHOA 2RJNA 2YR0A 2HPZA 3KO8A 1XMVA 4O3FA 2Q0HA 4WZZA 3DP9A 5CVEA 4L73A 1VIYA 4BLWA 4GMGA 5EE5B 2HU5A 3JQBC 2W8ZA 2YY6A 3TJPA 4BWRA 4W63A 1TR4A 2HH9A 1VLLA 2NSHA 4D26A 2EP5A 3RYCB 2YTZA 1T2NA 4PSUA 4HDQB 4WNGA 1Y4DE 3TQCA 1T4GA 3E5RA 3WHPA 2EFYA 3UW3A 5LQSA 3KQKA 3AIIA 2XEHA 4L1BA 4O6FA 4XEIG 4AZTA 4LOAA 3NTUA 4QOHA 1G55A 5H1UA 3UJ3X 3ZWPA 2BH9A 1YA0A 4Q7KA 4RTPA 1ZCBA 3O1HB 3UH0A 4JLMA 3CPEA 1XZCA 2BWJA 3QKIA 4ETNA 3PVZA 4EPVA 3TI7A 3SHFA 1G8AA 4AO8A 1QQBA 1JCQA 1Y1TA 2IEZA 3Q5DA 1AC5A 2NXCA 3PQFA 4FQ5A 3R3UA 4C7BA 2DBVO 4BWYA 4YMIA 1MEJA 3GP8A 2A9RA 1ZVVA 4LXQA 3HI6A 4QEDA 1MG5A 3LQ1A 3KWFA