3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
2BKEA 1JR3A 1E96A 3CZQA 4L16A 3G0HA 5CIQA 4W5JA 2O8EA 4M1KA 2NZ8A 3WNCA 2V1XA 3B5JA 4CZ2A 4AKIA 2PH1A 2HCBA 3UG6A 2IYZA 4LRWA 4LV5B 4QGHA 2FF7A 4BFWA 4LBZA 4F4CA 3MLEA 1P2VA 3RANA 4FMDB 3WYAA 5KDDA 1WA5A 3TLXA 1OH7A 1UADA 2CLDX 3DVLA 1ZNWA 2IA5A 5J47A 1VCMA 3M4YA 4GP7A 4F91B 4DIDA 5BN4A 1DAHA 4KAXA 2GZHA 4DSNA 1S1CA 1US8B 1RE0A 1NI3A 3B2EA 4M22A 3QXXA 1TPZA 3KJEA 1KIMA 3MJHA 2H8KA 1OW3B 2FV8A 2R6DA 2WWFA 4IJMA 4C0BA 4OHZA 3VU9A 2QG6A 1NRJB 3B1XA 3IO5A 2YC4C 5KNCA 2ZPTX 4RKEA 4PAMA 1G3MA 2WJVA 2ONKA 1U0LA 5FOSA 3KL4A 3KJGA 3I4LA 2PJRA 4DT1A 4N3NA 2GEDA 2JIZA 2FPKA 2FSHA 4Z8XA 1G7RA 3T06B 2KB0A 3PUVA 1E99A 2GJAA 3PFIA 3V9PA 4D0LB 4OL0A 1XEXB 5JEEA 4QM7A 1QBKC 2BWJA 2ZR7A 3CPJB 3H4MA 2YOGA 4DLTA 3MGCA 3K9LA 3UIEA 4QBIA 2QN6A 4IVRA 2J0UB 4JLKA 4P32A 2CE7A 2OSBA 1E2LA 3BJIC 521PA 4HB4A 1R5NA 1P7CA 3CX6A 2JIZD 3QF4B 3Q85A 3SS8A 2XSZA 3GP8A 4A15A 1E9CA 2A2ZA 3I3SR 2GJSA 1KI8A 2GCOB 1D6JA 1J70A 4KBFA 3SI7A 2B0OE 2QTFA 4DLVA 4CEIB 1I4TD 4ZCIA 4X8LA 3EIQA 4Q7JB 4BEJA 4ZI2A 821PA 4UXHA 4QG7A 1FUKA 2YJTD 1YQTA 2FZ4A 3OAAD 1BMFA 1P3JA 4YLGA 1GM5A 2WSMA 5K8IA 3D6TB 3DMDA 3B60A 4JT4A 4Z1MA 3QKRA 1SVLA 1T3HA 2Z4SA 1G1MA 1GITA 1SGWA 1TAGA 1KI6B 2W2VA 1Z0AA 4LBWA 3TBKA 5CLQA 1W2HA 2YKGA 1JB1A 4PSVA 2QT0A 1TUEA 1KJZA 2VP0A 1ZC4A 2CLCX 2I1VB 4HAWA 3C14C 3OHMA 2CNWA 4TTQA 3ASYA 4KFTA 5DIFA 1F48A 1R0ZA 5FUVA 1S9DA 3ZZ0A 2NGRA 4JLDA 3K0EA 4ITRC 3IUYA 4AK9A 1HUQA 4G5OA 4Z1MD 4ZKDA 2DB3A 3R9XA 1S0UA 4QBFA 2VH5R 2ZYVX 5JRZA 5CB6A 1W49A 3CR7A 4NE2A 2F9LA 3IEUA 2WJJA 3KUDA 1OFUX 3UWOA 4EPRA 3O8RA 3QSYA 1NSTA 4HAVA 2LKDA 1ZD9A 3IGFA 5FH9A 1CKEA 1KDOA 3PV0A 2A5FA 3OE7D 2ATVA 1OE0A 2DFKB 5P21A 1SVMA 2FFQA 2ZRBA 5KSYA 2AFHE 3VQTA 1S4QA 2ZETA 1MT0A 3LDAA 3MWYW 1N0WA 3F3YA 4HAUA 2QQEA 1KNQA 1D9XA 2QSYA 2RHMA 1JR6A 3AVYA 2X1VA 1EFUA 3GMTA 5FOXA 4YMVA 1KMQA 3AUYA 3FMPB 5HKKD 3G82C 3PCRB 2OCAA 2QP9X 2JLYA 1UPTA 3PQCA 2GAOA 1Q1QA 2HXSA 2EFGA 2XXAB 2Q21A 3REGA 2ZI7A 4CGZA 1IQPA 3TIFA 4ZCMA 3AF2A 1XEXA 2RKOA 2GXQA 4DKXA 3WRYC 4NONA 1OH6A 2F1JA 2QTHA 3BH7A 3HYRA 3KUCA 5EP2A 3TR5A 2AFIE 3W6OA 4IOKA 1GZSA 4XSHA 1T91A 1W4CA 2BV3A 2VHUA 3K09C 1ZMXA 2Q9CA 3EA0A 3LVRE 4XVQA 2D06A 2YVUA 3SYKA 1AZSC 3QVUA 1W7AA 2V1UA 2R6GA 2GK7A 4MKHA 3VU9B 4PAQA 4LHYA 4LYJA 3W6PA 4PHFA 4URZR 3TAUA 5JS7A 3THYB 1P2SA 3K70C 2BMJA 1B23P 2R2AA 3R20A 2IUUA 5JI3E 1D2MA 2J3EA 4RSGA 3GFPA 1ZM3A 3KJHA 4C7OB 2CRRA 3NDPA 3EA5A 1U81A 1KI3A 1U0JA 1PLKA 1E69A 1SVOA 2IL1A 2CE2X 2QPAA 1T8TA 4TYYA 2DWOA 1L2TA 1UKYA 2W0MA 4QJ4A 4CT5A 3JVUA 1MRNA 2IUTA 3AF4A 4GOJA 1Z6GA 1FZQA 3GQBA 3QKSB 5F9HA 5C1BA 4HUQB 3RWOA 3AKYA 2A78A 1DAFA 1ZU5A 2YYZA 1HA3A 3IDQA 1VTKA 1GTVA 4A2QA 2ZI4A 1XPUA 4DUGD 3QQ5A 2QBYA 4FCVA 1G9XA 2DFLA 1UF9A 1VHLA 3CRVA 3B7GA 3S1AA 3K9NA 4CF7A 3U6KA 1TEXA 4PZYA 1H8HA 3D3QA 4R7ZA 2D62A 3GJ3A 1Q12A 2ZAOA 1UDWA 1FX0A 1OFHA 3DZDA 1JXMA 3EIHA 4HLCA 2VYFA 5BWMA 2JLRA 2W2XA 4P33A 5FBWB 1G3RA 2JAQA 3AVPA 3PG5A 2G6BA 5KNDA 1CR2A 4A9AA 4DUGA 3V4FA 1XBTA 4EIWA 3KZ1E 4H1VA 3LBIA 4HYYA 2N46A 4E22A 1NN3A 4IOLA 4CVNA 3RS3A 2ODNA 2WICA 4HZUA 4OQXA 2EW1A 2RHDA 3CH5A 5TVKA 3Q7QA 1RRGA 4Q02A 4DDVA 1RZ3A 5G40A 3GLIE 4N0DA 4F7WA 3L0SA 2ECKA 3FFAA 3R8CA 2RCNA 2WAYA 1II8A 2H17A 1DO2A 5DLQC 2GF9A 5FFMA 2F9MA 2JLUA 4WAUA 2E9SA 3ZZUA 5SZHB 1OHHA 2PMKA 5LD2B 1P73A 1E2KA 4M9XA 1J8YF 1WQ1R 4OHVA 4TLBA 1E94E 2FA9A 1UDXA 2Z83A 1P9RA 4L5BA 3VKHA 3QXCA 2RGXA 1T6NA 2ZEJA 3NH6A 4KBGA 3AF3A 3VNVA 2OFXA 1SXJA 2PEZA 2OHFA 4TQUS 1TTTA 1Z0FA 2XGJA 2Q9BA 3U7FB 1T5IA 3ZVLA 2W0SA 1E32A 2RGBA 1WE2A 3U60B 4UXJA 1Z22A 3M0EA 4A2WA 1TNDA 2DYKA 2BBSA 4LJ7A 1CF4A 4KV9A 3HDTA 4LJYA 3P27A 4RFVA 4URWR 1U2RA 5JWHA 4M21A 2KSQA 4LJ6A 5J5CA 1NMXA 2J9RA 4CEHA 1KI6A 4LGMA 1NBME 4V0ME 1GVNB 1KAOA 3EPLA 1Z08A 1XZPA 4NYIQ 1LS1A 5HCIA 5BQ5A 4MRRA 2CEAA 1G7CA 4DLXA 2ZXUA 3PIRA 1SKYE 3GLHB 1HV8A 4EQ6B 2EYUA 4WXRA 2VBCA 4UJ3A 4YMUA 4HLDA 5G3YA 2ZS9A 1OIVA 5FTJA 5H68A 4B34A 1JJVA 1XTKA 3ADDA 3AVOA 3TSZA 5D3MB 2BDTA 1HEIA 3LQRA 2JJ1A 1D9ZA 4RKFA 2GJKA 4UKDA 1YR8A 4BASA 1MRSA 2ZTSA 1SKYB 4HAZA 1A7JA 1R8SA 1VYUA 3UPUA 5GJWC 5KPDA 1F2TB 1G5TA 4PC3A 4U7DA 2XJ4A 4LPKA 4LYHA 2RGAA 4FWTA 1Z0DA 4FI3C 2Y8EA 4KXFB 3B6EA 2IEZA 4ZCLA 5FOWA 4AYXA 2Z43A 3NEYA 1S8FA 4BFZA 1GP2A 1ZNXA 4DZZA 3I32A 4N1AA 4QL3A 3UXMA 4OI2A 5EE3A 1QZXA 2HF8A 1EFTA 1RJ9B 4XWAA 5H70A 4AYTA 1U8AA 1E1QD 1QVRA 4TSFA 3A6PC 4G5GA 2HEIA 2QMOA 2V6IA 1G16A 4JVNA 3PJRA 2IYVA 5EE1A 2Z0MA 2CVFA 1P62B 2NPIA 1US8A 2CL6X 2IYRA 3AVQA 1WRBA 1HH4A 2JJ8A 3W9YA 1T0HB 2IYQA 5L3RA 2O8FB 2IXFA 4DLYA 3NXSA 1A1VA 5B57C 1YR9A 2ZJOA 2X2EA 2OZEA 1CBUA 4R98A 2ZAMA 2F6RA 2YZ2A 3EZ7A 1EFRD 4JSYA 3SBDA 1N6HA 2IYXA 5G53C 4DEYA 1SQ5A 1GKUB 2AHOA 4MRPA 4JYBA 4A2PA 2G88A 4NHOA 1AN0A 2O8EB 1XNJA 2ANBA 3GLFB 1XCPA 4B3CA 5E3HA 1UKZA 2BMEA 2FE4A 3BB1A 3FEHA 2ZREA 2ZROA 3I1FA 4KLZA 4Q18A 5TV2A 4I1OA 3THOA 5L3SB 4Q5IA 1P9WA 4Q4LA 2F43B 4IOMA 4TYPA 5KTYA 4ZDKA 4M8NE 1NVXQ 4NYMQ 1RPZA 1GL9B 3SFZA 4TQ9A 2XTMA 3GD7A 2AN9A 1S2MA 2RGDA 4I1VA 1TU3A 1ESMA 1T8UA 3DOFA 3RSOA 3ZDQA 5JEDA 5FBQB 2EYQA 2XZLA 3LW8A 2GXUA 2HXYA 4M1TA 3N2IA 1M8PA 2EFCB 3KQKA 2ZRNA 5DYGA 4Q7MB 4XJXA 4MKFA 3CONA 3HPQA 1G8FA 1XXHB 2J7KA 2Q3HA 1E9FA 4JJZA 3BC1A 4ASUA 4B47A 3OIUA 2P67A 5AR1A 1CRPA 1TX4B 3T34A 2H1LA 1HURA 4I4LA 4A8JA 4NZYA 1GWNA 3EARA 3L2OB 1G21E 4HZIA 4AG6A 2CLSA 2ORWA 1NVVR 1FNNA 4EJSC 2GBLC 2BEKA 1MO4A 2V4ZA 421PA 2O8BA 3RRZA 4C0QC 3HU2A 3LRPA 2V3CC 3FMFA 1QHXA 1W4RA 1SXJE 3RNLA 4DEXA 4LHXA 621PA 5JSZB 1Y63A 5FPYA 5KU1A 4HDQB 2ZR0A 4EJSB 5A4JA 4XSGA 4DXAA 1E0KA 5AWFC 1VYVA 5L3QA 4BZXA 4YONB 4PXAA 3FGNA 1E6CA 1AKYA 3RHFA 5E95A 3C5HA 4EUNA 1EESA 5FOUA 3LX8A 2FMXA 3ND9A 1R0XA 4ERNA 3BH0A 3BH6A 5CDFE 4EJSA 1AQYA 1ZC3A 4QKQA 1AA9A 2OESA 2GZAA 4M9ZA 1QG4A 1U8YA 4G3XA 1OXTA 4DCUA 1A82A 2WKRA 1E0JA 5BN5A 4D26A 1OIXA 1OXXK 1RIFA 3UMSA 4A0FA 2O8BB 1NKTA 2HF9A 3CRW1 1CEEA 2FNAA 2IS1A 1BIFA 3K53A 4L9WA 4GMXA 1R8QA 1DVRA 2G1JA 2ZU6A 5FL7A 1NG9A 3CX7A 1YJ5A 2QGZA 2G0TA 2J0VA 3U5ZB 1FW6A 2IEYA 3Q5EA 2C9OA 5TY0A 4US0R 4Q1FA 1LV7A 2F3TA 4Q66C 2IK8A 4QXAA 1M34E 2QMEA 4FIDA 3VHLB 3BFKA 3TW8B 1XMSA 3QXJA 4C0LA 3HU3A 1ZINA 3ZVMA 1ONBA 2IF2A 1XB2A 1E1RD 2YV5A 2XSZD 4EFNA 5JZVA 3VTKA 2XAUA 1B0UA 3CNNA 3M1IA 1VG1A 2FJUA 2ZSAA 5FL7D 4F38A 5IF9A 2VIIA 2X77A 4ZI3A 2ONJA 2ODEA 3CO5A 4C0SA 4G1UC 3UMFA 4D2IA 1NMYA 5EXSA 4WXPA 1SULA 4Q4HB 1ZIPA 2C9YA 1N6PA 1BMFD 4B3BA 3X2SA 1P5ZB 3QXHA 1D5CA 4LC1A 4QFMA 1G17A 5C4GB 5LD2C 4IVPA 1E1RA 3GLFA 5EE9A 4AKEA 4MITA 3F5FA 1SZPA 5EP4A 3I5YA 2PLFA 2VP5A 2Z6VA 5DHAA 1Z06A 3FDIA 4LYFA 4DC9A 2YINC 4C2TA 4HLUA 2AL7A 2ANCA 1Z63A 5HCNA 1IOZA 3P1JA 4IXMA 4Q19A 3LJUX 2JLZA 1MO3A 4V0LA 4PANA 2IYLD 4KODA 5KDLA 3IKJA 4MH0R 3ZIAD 4LHVA 3TUZC 4QBGB 2ZJZA 3GEEA 5GJCA 3VFDA 1VG8A 3RABA 4MDFA 3GFTA 4L15A 4BFSA 1G3UA 3CM0A 1ZNYA 1T3LA 4IDHA 3SHFA 1EX7A 4HAXA 4A0RA 5KYKA 3FMIA 3OE7A 4D81A 4GT1A 1IN4A 1W5SA 3BERA 5BW8A 2DPXA 4Q4JA 2ZYUX 1RJ9A 3NH9A 3ZIAA 2IHBA 4G0NA 1VIAA 4B48A 4QHSA 5H1YA 3TRFA 1PJRA 1Z3IX 1YRBA 5CDFA 5EXXA 4D4JA 5K8TA 5EZ6B 4B3FX 1XXHE 1N6NA 2XZOA 1W4BA 2REOA 1XCMA 4NTZA 3IQXA 2H18A 4B3GA 1F2TA 5HKKA 2OAP1 3TJZA 3C16C 4X8OA 1KDPA 4BPBA 2OT3B 5DI9A 3RC3A 5JJKA 4NH0A 4PPGA 2OO7A 4KYUA 1LNZA 1U9IC 4M2LA 4RFSB 5FBRB 4M0LA 5F3WB 1HY3A 3WHKA 5G3ZA 3K0AB 1KSFX 4DDWA 3TSOA 5E7JA 3BIFA 2C5LA 4QHTA 4M1YA 5CK5A 1XEFA 4IEIA 2CCJA 1GKYA 2WIBA 3NG1A 4AKGA 3QE0A 2E87A 3LV8A 4ZPXA 2HUPA 2JEOA 3WBJA 2IXEA 2VQSA 2KE5A 2YWGA 3OIYA 1WBBA 4EFMA 2FFHA 1VDZA 1FNMA 1OB2A 2CHGA 2QAGA 2WBLC 3LX5A 4B76A 1U94A 3NBFA 4Q1BA 2WV9A 5AUPB 4PPFA 4HAYA 3TQFA 1N3BA 3MMPA 1E2QA 2BJWA 3BD9A 2PX3A 2VF8A 3IIJA 1QHNA 2TMKA 4CEHB 2QMHA 4LX0A 1ZUHA 4J0QA 1IXZA 1CRQA 2OCBA 5FPTA 3RS5A 3FWYA 3P4YA 4KITB 3MDBC 4IDQA 3QENA 1DAEA 2R8RA 2CJWB 3DM5A 3PUZA 4ILEA 4JLJA 3I92A 4OI1A 4E03A 3IQWA 3ZYCA 4RCZA 2XB2A 3ND8A 2ZJ5A 1F6BA 1ZD8A 3THXB 2QM7A 2ZSBA 3TGPA 3DWDA 4W5HA 4US1R 2ZUCA 3QG5A 3KQUA 1ZYUA 3MJRA 2KI5A 2O0HA 4A82A 2BMDA 3IBGA 2DFTA 1XMVA 2O5VA 4KYIB 5CYOA 3I62A 1C1YA 2QT1A 3LXXA 1CXZA 1G3IA 4JLNA 4AURA 1KK3A 4LYAA 2HYIC 3B85A 4JLVA 3SOPA 4N0EA 1DE0A 2VHJA 1W4AA 4RZ3A 4TZ0A 1II8B 1ZCBA 2C03A 3FMOB 1N2CE 3HWSA 1NLYA 1LB1B 4GRAA 2AX4A 1VHTA 3WYGA 4ZIRB 2WPDA 4LJ4A 3AVVA 4KO8A 2W00A 4HZUB 1OPXA 1XEWY 5FTMA 1GG2A 4XH9B 1JI0A 1QRAA 2FZLA 2NO0A 1SVKA 2G77B 3DL0A 1I2MA 2OV2A 1J99A 2REBA 3B1VA 3BK7A 1GDDA 2ZE6A 3CB4A 4NL4H 2QP4A 3IPYA 2ZANA 3CF6R 3NBYC 2ZJ2A 1G6OA 1P61B 2PCJA 2QPOA 3CH4B 4WZBE 3R7WB 3SNHA 1X8JA 1ZM2A 3CRRA 4M1OA 2C8VA 3D8BA 1KI7A 2JJ2A 3FVQA 2IS2A 5HR5A 4HB0A 3QVVA 2ZVQX 1QVAA 5CB8A 2NIPA 4U5XA 1GIAA 3OZXA 1G3QA 4II7A 3RS4A 4A4DA 1N5IA 3WYFA 1OT3A 4HI0E 1G64A 5CK4A 3JUEA 5DISB 2WOJA 3MD0A 3TAHA 3QKSA 2P6UA 4DCSA 3K0CA 3AKCA 3ZD7A 5FOTA 5TB5A 2QAJA 2JJ2D 1JALA 2A5JA 2GILA 4MGKR 4OQLA 4URXR 2WWYA 4QGGA 5ELXA 3RLFA 1JPJA 1KKLA 2B6HA 3AGQA 4B32A 5EP3A 2FGKA 1W36C 2IS6A 3CX8A 1CULC 2FSGA 1G5RA 5FUWA 2B92A 4POAA 2WJGA 1FOEB 5TDHA 1G8HA 2YHSA 3Q9LA 1XTJA 1MV5A 1QHIA 2J0QA 2DFNA 1WP9A 3THWA 3A8TA 1PLJA 4GMDA 2ZQ5A 1TQ2A 1TQ4A 1LFDB 1MOZA 2ZRPA 1AKEA 2EU8A 1E98A 5FL3A 2OLKA 2BOVA 3A1VA 2LWIA 5KHOC 1W47A 2GEUA 3EZ2A 1VG9B 3IO3A 1KNXA 4MRVA 5D3QA 4TL9A 3H86A 3ICEA 4MQBA 2ZRAA 1EFHA 1E2PA 3UANA 2P5SA 1XRJA 4A0GA 4JSTA 5AJWA 3TH5A 2FWRA 3RRYA 3WRXC 1M6NA 4Q9JA 2OBMA 1AGRA 4JLBA 1P9NA 3H0KA 4JKYA 1XD8A 4QFVA 3CNLA 3WNBA 1WMSA 3GLFE 3O47A 2HDNB 3LWNA 3U2QA 1H8ED 1C9KA 2ZRCA 3PUWA 4FXPA 1Z28A 4O2LA 2P65A 4C0HA 4ACAA 3O8CA 4B44A 4BRUA 1A4RA 3M6AA 3U7HB 1UAAA 3ONWA 4FMCB 2N42A 3AVWA 1M1YE 3Q72A 1XEWX 4JVMA 4WBSA 1A5TA 2X8AA 2ZUBA 1X8LA 3VNUA 3L82B 1R0YA 4GI7A 4GOXA 3AUXA 4BE7B 3FHCB 1E1QA 2D74A 1ZM4A 3RSLA 3SBEA 1XD2B 3WMGA 3A1UA 3LNCA 2C96A 1LF0A 4IXNA 5E7IA 3ZLJA 3FKSA 3VMFA 2A5DA 1IN8A 3CRQA 3OIWA 4B71A 5GADl 1Z2CA 2JCSA 4YXWD 2IX3A 1KK0A 1G20E 5SZIA 2J0SA 3OF5A 2HYDA 1EK0A 1FTNA 2BCJQ 4Q1CA 3T12A 2G3YA 3PITA 4B43A 4DLWA 2E1RA 4F4JA 1N5JA 3RS0A 4PQRA 4PC6A 1XPRA 4MKIA 2GJ9A 1ZU4A 5GJBA 3P26A 4UNRA 1SHZA 3W3AA 2PX0A 1HQCA 1EFRA 2HJGA 4LZZA 2H92A 3K0CC 2XNSA 4YXWA 1N25A 4GSYA 4B74A 1JPNA 5KDOA 1KI9A 1NJFA 4WZAE 2O8CB 2IT1A 2ZRMA 4X8MA 4QM6A 2ZI5A 4OKSA 4DLRA 5C46F 1II9A 2CCGA 3NDBB 3PEYA 3GLGA 1FFHA 4L9SA 2RMKA 4OK5A 2PT5A 2BKUA 4JBWA 3WXMA 1HYQA 2XNDA 2C78A 3GJXC 5K8LA 3CUEF 2ZIAA 1DG1G 1VCOA 3GJ7A 3OESA 2GCOA 1W44A 3MUFA 4YC7A 2GCNA 4ZIRA 1G6HA 1XPOA 1NL3A 1U99A 1ZAKA 3T1VA 1QHYA 1OLOA 2GETA 2WWWA 3NIBA 3KQHA 4E09A 1DPFA 4M9SA 1ZIOA 3DMNA 1RKBA 3GJ0A 4TMVA 3K0FB 4YMTA 3PXGA 2ASEA 2EVWX 4V0MA 5EE5B 1BYUA 2ZRIA 2F1HA 3C8UA 1N6LA 4ASUD 3VX4A 3N2EA 4NMMA 4DLZA 4Q7KA 1X1RA 2ZITA 1IONA 3UKDA 4CEJA 3QG1A 3HU1A 3JZAA 1JNYA 2WTUA 1ANKA 1KY3A 2GESA 4DT1B 3WHLA 1F5NA 1QHSA 2NG1A 3HR8A 2I3BA 4Q21A 4D0GA 2ORIA 3IEVA 2O8DA 3L0IB 2O0JA 2VHCA 3T5GA 1K8RA 1YZQA 4D4LA 4KSBA 5DO9A 2LCFA 4DIEA 1I4DD 1VG0B 1F2UB 2WAXA 2ZSEA 1FL9A 1WBDA 1RRFA 1E0AA 3GJ5A 4BLQA 4ON9A 4B6FA 2P6RA 3SC3A 2ZJ8A 4JL8A 3RRNA 3WMFA 3TW4A 4AD8A 2YOFA 5KO2A 4GZLA 4FMCF 4NPHA 2X2FA 2VRWA 2ZRDA 2CCKA 3B78A 2ZYTX 4LSGA 3FYHA 3L8YA 5B30A 5E4FA 3VR2A 1MO5A 1UEJA 1KJYA 1P75A 2ZRGA 1X1SA 1IHUA 2FSFA 3DPUA 1XMJA 2FG5A 1JR3E 3AB3A 1E9SA 3CKLA 4OHWA 3KKQA 1LW7A 2JLSA 2IBMA 1RRPA 4LJAA 2ZJYA 4B6EA 1D2EA 4NYIR 3SDZA 3AP1A 2VPPA 2IF0A 2GVZC 3BE4A 4P4UA 4D4KA 5JCZA 5IT5A 1XDBA 3OIVA 3LW7A 1LF5A 1U0HC 1GSIA 2ZRFA 3FHTA 1VKJA 2WHXA 1KI2A 4TLCA 4F1PA 3FOZA 3LLUA 1TEVA 4O25A 4PO9A 2RGNA 2D7CA 5JWOA 1R4AA 4C2UA 2CBZA 3C15C 3LFUA 1N0UA 4Q7LA 4V03A 2ZSFA 4Q9HA 5CM9C 1NY5A 4DB4A 4BECA 1IY1A 1NY6A 4NCHA 3R9IA 1NIPA 4XTRA 3T15A 2J45A 4E5UA 1GNRA 5KNBA 2VL7A 3ICQB 4LHWA 5FR1A 5KOYA 4V0OA 1DAMA 5EXTA 4TWZA 4ZKEA 1G8GA 1TQ6A 3KKPA 4W7SA 2F1RA 4QGAA 3H2YA 2BIFA 4G01B 1J90A 2PMDA 3GJ4A 5HTKA 4JL6A 4MYUA 1G5PA 1QHHB 3U3RA 3VR4A 2IYSA 3K9GA 1WDTA 2F3RA 2KBEA 3B1YA 4PO1A 4QRHA 5IHPA 1U90A 3NEJA 1OH5A 4RD2A 1GFIA 5EQTA 3K0SA 1JEEA 2FU5C 5KSPA 4KVGA 2F55A 5EUMA 2ZS7A 4NDZA 1Z6AA 4AWXA 4CYMA 5B64A 1R2QA 4BEBA 1PZNA 1AZTA 4KVAA 1W48A 3KJIA 4JT2A 1G41A 4PHGA 5FI0B 3PEVA 3VR6A 2B7CA 4BUJA 3CF2A 1OV4A 4KFUA 2AK3A 2OXRA 3TMKA 1M74A 4XWOA 4DSOA 1YZLA 4Q03A 3QJYA 5DI3B 3LAWA 1OFTA 5C2JB 2P5TB 3GLGE 1RC8A 3UK6A 5A0FA 4OHXA 3ETLA 1Z6YA 1DCQA 1NN0A 2WKPA 3EW9A 4B33A 4QNRA 1DO0A 2QE7A 3RVBA 2F7SA 2I4IA 2ZJAA 4A6PA 4KLNA 2JDID 4PAOA 4RD0A 4PZLA 3ZJYA 4LV6A 5DGXA 3EX7C 3T9KA 1ODFA 1I2DA 1Q3TA 121PA 2QA5A 1XWIA 2J5XA 1UKEA 3K09A 4G5RA 4BZQA 3EPHA 5C4MA 4ZDWA 1Z6XA 2WSSD 4M9QA 3C7KA 3ZGXA 2PZEA 3CZPA 2WZQA 3KKOA 2AWNA 2D7DA 2HCJB 1WCV1 1YU9A 2J1LA 3KTAB 3EASA 2J46A 1W1WA 2JDIA 2A3RA 3QIAA 4OHYA 4BLOA 1QHGA 1Q20A 1U98A 3LVQE 1JAIA 2AKYA 4MYHA 1KZGB 1S96A 2ZE7A 5KUTA 2P57A 3ZVNA 2IQJA 3KB2A 4BLRA 4LBYA 2WJIA 4NCIA 3GLIA 1AQUA 4FD2A 3AM1A 1Q21A 3X1WA 2YWEA 4C9BA 5B58C 2VEDA 1DS6A 3KFVA 1YRAA 2VSFA 2OG2A 2JA1A 3U3JA 4A92A 3MSXA 4Q4AB 1XCGB 4LJ9A 4D0NA 1HE1C 4KCGA 5IRCD 3ZQJA 4H9GA 1W46A 2W6JD 4MKGA 3BGWA 3CWQA 4NBSA 2GVDC 1XD9A 1UJ2A 3ASZA 4EPTA 4BZPA 4AYWA 4DDTA 3TKLA 1KGDA 4RJLA 2VSXA 4HUTA 1N0VC 2V6JA 5J40A 3W6NA 4B3XA 5A5GA 4GZMA 5JFGA 1XTRA 2QY9A 4OQNA 4WA7A 1RYHA 1YZTA 4R9UC 1Q1ZA 3B8HA 3EZ9A 3B9PA 3Q7PA 2O52A 3ZS9A 2WWGA 1JEDA 3DKPA 4KFSA 4A8JB 4B2IA 1T5LA 2W6JA 2R6AA 4OJQA 5FPSA 3T61A 1YVDA 3AF0A 2BM0A 4PC7A 2XOKA 3I5XA 1LY1A 4LUCA 1X6VA 3LH5A 4OJKA 2C95A 3ADCA 1KSHA 2FX3A 2X19A 2VHQA 2HT6A 2K5UA 3P4XA 2REXB 1Z6TA 1VMAA 2ORVA 2G0NA 3P32A 1N6KA 2DHRA 1XFAA 1Z0KA 3FB4A 4BLSA 1N5KA 1XZQA 2WPDD 4FMDF 1KYIA 4V0KA 2H5EA 3AQ4A 2DBYA 3ECCA 4BLPA 1MH1A 2VHTA 4IW3B 5JHGB 2OE2A 3VR5A 1IY0A 4QHYA 1YR7A 3A4LA 1SKQA 3EAQA 2F43A 1T9HA 4KU4A 2AK2A 1RFLA 2GJ8A 5L3SA 2VLIA 4PQFA 1E4VA 2FFAA 3EXAA 4HLQB 2H16A 5AJVB 2P0EA 2NTYC 3U3MA 1J8MF 1CR4A 2Z5FA 3LY5A 1W0KA 4TTRA 3SZRA 1X86B 2ZI6A 5F9FA 2UVQA 4F92B 2RGCA 1DOAA 3PENA 4M1WA 1FMJA 1RW4A 2YOHA 2ZYWX 5DN6A 5EP1A 4IHQA 4NYJQ 2CRWA 2H7VA 1Z0IA 1XMIA 4QNMA 2V9PA 5HPYB 5IDVA 4TMTA 1GL6A 4H1UA 3U4QB 3V00A 1GUAA 5H8WA 3FPAA 1CJTC 3IBYA 3SUBA 3RDPA 1E2IA 2W6IA 2PT7A 2YNMA 2J7PA 3F8TA 2C77A 3MWKA 3ZS8A 2HLDD 4TL7A 2FN4A 3KXIA 1TQDA 1MR3F 2ZE8A 1NN1A 2JATA 4JBYA 2EWWA 5DN6D 1Q22A 2NOAA 3VKWA 1AJEA 3I72A 1F2UA 5BN3A 3CBQA 3NWJA 4U00A 4GFDA 2OBLA 1G19A 4LHZA 4D80A 3N70A 1IBRA 4LC0A 3AGPA 2RAPA 1Q1BA 2O8DB 4FMBB 2W6ID 5AUQA 4LWZA 1YKSA 1ZNZA 1NF3A 3FM8C 2RH5A 1P60A 4R71A 3WY9A 1KMHB 2IHYA 2PJZA 4CEJB 1I4LD 1GRQA 2CL7X 4MUBA 2R6FA 4BRWA 2HT1A 1E4YA 2GDJA 3CW2A 4RD3A 2ZR9A 3EC2A 5FOVA 5EZ5A 4JLMA 2VSOA 2ZRJA 5J4HA 1P2TA 4MGZR 1UM8A 3GJ8A 4I99A 5JWRA 1KO7A 2WM9B 3MRSA 2RGGA 4P4SA 4TTPA 3Q8XB 5EE0A 4IVQA 4UJ5A 4QGFA 3VR1A 2IXGA 2R9VA 3KTAA 4G5SA 4KJZA 3WNDA 5D3MA 5JJLA 1KSGA 3CPEA 3KKNA 3A1WA 1Y3AA 1UBEA 4HEJA 4O3MA 5HZKA 4LPSA 3RAPR 4TMWA 4DCTA 4X8HA 1AIPA 1FQKA 3OFNA 4EQ6A 4MGYR 5FUXA 3KB1A 1H8EA 3GLHA 3GLGB 4ESHA 1K5GA 4RD6A 1AGPA 5J4LA 2D2EA 1ZP6A 2OBNA 4AKHA 3P20A 4QBHA 5L8VA 4FN5A 2ZJBA 5KSZA 1OB5A 1W5TA 2QROA 5DI3A 4ACBA 3K70B 4FWIB 3OFND 5CLLA 5AJYA 1JAHA 4TLEA 2LKCA 1EGAA 3VX3A 2P2LA 3GEIA 3FKSD 4TN1A 4EPWA 4HB3A 5LB2A 1W36B 1NVWQ 1ZJ6A 4PX9A 1CR1A 4ZDIA 1SXJB 3ZVRA 5DNYB 4ESVA 3LA6A 4MYTA 3KQLA 1FQJA 1GAJA 1R10A 1NBMD 5JCPA 1V43A 2CHQA 1E9EA 4IRUB 3EPJA 1ZBDA 2QQ0A 1PVOA 1HQYE 1XD2A 4BWYA 1KK2A 1XX6A 2FSIA 2R62A 4GNKA 4K46A 4JBXA 3REFA 5ANRB 4LDJA 2FOLA 4MYCA 3IILA 5LDDC 1SXJC 2YWFA 4FCWA 4URUR 3UG7A 3C5CA 4M4SA 4BGDA 2XB4A 4PR0A 2GRJA 3CF0A 5L3VA 4M53A 2R65A 4IDPA 4WIAA 4EPYA 4C0JA 2W83A 4BQSA 3TVTA 4KSCA 4OYHA 2C2HA 1FUUA 4KFRA 3LLMA 4DB2A 3EZ6A 1IJEA 4PC2A 2XNDD 3FTQA 4GOKA 3DEFA 2AKAB 1E2MA 2V54A 2I1QA 4LJ8A 4KHZA 3U44A 2DY1A 1KI4A 1TUIA 1M7HA 1CR0A 1FX0B 3MWLA 3NC1C 2JLQA 3QUSA 4Z51A 4I81A 5SZJA 1NSFA 3TUJC 2WMNB 1TL7C 1ZM9A 1E2HA 3AP2A 4FCTA 2ZUDA 1YR6A 4PTLA 1CS4C 4EAQA 3BB3A 3MG9A 1ESNA 2ODBA 3AKEA 4TT3D 4WVFA 4RCYA 1UBFA 1H65A 4HUQA 1YHNA 2P3SA 4CRWB 5FPKA 5FPHA 1VYTA 1XJCA 3SJZA 4BFXA 3I8XA 5BYJA 4BFVA 3U7GA 3W8NA 2VO1A 1S1MA 2WJHA 4JLOA 3U7EB 3G5UA 5BYKA 2XX3A 3VHXA 2F1IA 4PFSA 4TMZA 1VECA 1D8TA 4LOAA 3SYNA 2CDNA 2D2FA 3FKQA 4R2IA 4OBEA 4C7OA 3W5JA 3O8DA 1DARA 1VCNA 3NBXX 4IDNA 3BORA 3BRWD 1E2DA 2V7QA 3OEHA 3UMRA 2QZ4A 3THYA 3LBHA 4R2HA 2V55B 1E2EA 1WXQA 4O0MA 5JBQA 2KWIA 2GA8A 1SVSA 2WKQA 2SHKA 1OJLA 5AUNB 2FPLA 2CMKA 3DM9B 3W3ZB 4B2PA 4EPXA 2OUKA 2RB4A 1OFIA 3WP0A 1GRNA 4JLPA 4OI4A 2V7QD 2ZE5A 4PSAA 6Q21A 3E1SA 2VTKA 1LS6A 1NVUQ 5DE3A 5FR2A 1OXVA 2FDCA 2GXAA 3KX2A 4TZ6A 4XWKA 1O3YA 2J87A 2MSEB 3TR0A 3QEOA 3R7WA 2BM1A 1OKKA 4UXIA 1ZRHA 2RGNC 2OWAA 4A36A 1CJKC 4Q01A 4C0KA 3NTUA 4EDHA 2XXAA 1N5LA 2RGEA 1E9DA 5GVSA 3K0FA 4TL8A 3X1YA 2FEMA 4LK2A 4Q1DA 5UKDA 2MSDB 2Q0HA 1P72A 5DH9A 1YZKA 5E7MA 3MFYA 4Z8YA 1JJ7A 3AH8A 4NCJA 3GLHE 2HJVA 4XD7D 3SR0A 1DAIA 1IAQA 1DG3A 3LBNA 4DJTA 4LBVA 2MMCA 3NC0C 5FUYA 1HE8B 2OAQ1 2OCYC 5EJEA 3AP3A 1HT2E 2VP2A 4C3ZA 1SVWA 1OXUA 5CJPA 1NN5A 2GWHA 2XZPA 5HE9A 3W5IA 1UEIA 3R9WA 2VF7A 2QMUA 3KXKA 3MWJA 3QBVA 2EFDB 1AM4D 1BYIA 3BOSA 4TLAA 4A6XA 1W2GA 2BBTA 3BS4A 4DSTA 2B7BA 4AC9A 1SVIA 2O8CA 1UBGA 5DHFA 4MRNA 3W90A 3E5HA 1DBSA 4MUAA 1P2UA 2QRZA 3THXA 1BH2A 4BFTA 1OH8A 2ZRHA 1E3MA 1KY2A 2AWOA 1CIPA 1KTVA 3SYLA 3MAAC 3DZ8A 2QP3A 1LTQA 1N6OA 1IN5A 2CJWA 2QAGC 1RRCA 2QENA 4GBMA 4IFEA 1Z83A 4LJ5A 1NJGA 2VA8A 2ZRKA 2GXSA 2IYYA 2PCLA 3IIKA 3NHBA 1R5OA 1DAKA 2ZI9A 1EFCA 3CRMA 4TMKA 4C30A 1KHTA 1JECA 1IM2A 1U8ZA 1Z2AA 3QKRB 4NCKA 4NU0A 1LVGA 3PVSA 2QAGB 3BB4A 1CU1A 4B75A 1KZ7B 1PLLA 1TF7A 3SEAA 4OK6A 4JVSB 3QEJA 2QUZA 3SQWA 1G8YA 3U3OA 3SQXA 1NIJA 4Q48A 2QPTA 1TF5A 1XTSA 4UNSA 4CEIA 2Q6TA 2PZGA 3EWAA 5J4KA 1IJFA 1GOTA 5EXPA 3HPRA 1IXSB 2QE7D 1ZVQA 3QF4A 721PA 1A2KC 1CLUA 3B1ZA 1Z0JA 3K0AA 1E9BA 1GNQA 4DSUA 2J0UA 2DR3A 1COWD 4RFSA 1KOFA 1UKVY 2XJ9A 4W9MC 1KDRA 3ZH9B 1S3GA 1E79A 4LV8B 5HE8A 2WSSA 5CYPA 4XOIA 3I8SA 1G7TA 3IHWA 4AG5A 3KQNA 2DCUA 4PHTA 3KDSE 1FP6A 4ZO4A 5FBLB 3ADBA 2GK6A 4OQMA 4YQFA 1TU4A 1EWRA 2DWPA 3SE0A 3ZQ6A 4P31A 2IWHA 1X3SA 2QORA 4V0NA 3U44B 1NKSA 1UBCA 5JJIA 4JS0A 2V8OA 4QJ3A 1AS0A 1COWA 1E2JA 2WWIA 3SJBA 4F4IA 1Q1EA 1GILA 1E79D 4IFBA 4D6PA 2OILA 4DCNA 1KKMA 3OAAA 1PUJA 2Q3FA 4OQFA 4PPQA 3TUIC 3E2IA 4NCNA 2AR7A 4DBLC 3THWB 3A1TA 4FINA 1L8QA 8OHMA 4GL2A 3EC1A 4DDUA 2IC5A 4V02A 4RZ2A 4XIGS 1Z29A 1XP8A 4IOJA 2GEVA 3QY0A 3D31A 2PEYA 2BEJA 3I61A 1W36D 2IWRA 1J7KA 4EPVA 4CW7A 4JZKA 1ZUNB 3CLVA 2EWVA 2CNWD 5F2EA 5JLJA 3KKMA 1L4UA 3DOEA 2GZDA 4BFUA 1Q44A 4KI0A 1KDTA 4BFYA 1VPLA 2YWHA 1DELA 1K6MA 1NG1A 2N1BA 2WMOB 1E2NA 3AKDA 4IDOA 4Q9LA 3X1DA 1E2FA 2GHIA 1Q3HA 1PV4A 2GCPA 4B35A 1EX6A 3QKTA 1OIWA 4CT4B 2WWXA 4JLAA 3B13B 1J2JA 3Q3JB 4PSKA 4QC2A 2OLJA 3OEEA 1BKDR 1IXRC 2C9CA 2O0KA 4ZDJA 4P4SB 1FPMA 3GJ6A 1YZNA 2W2TA 1R5BA 4YDHB 1BOFA 2QU8A 4Q47A 1F60A 2XOKD 4W5WA 1KJWA 1CTQA 4QJ5A 2D4HA 4Z54A 4YDSA 1ZD1A 2D3WA 4ZV4A 5FTLA 3NHAA 4YMSA 2BBOA 2QI9C 3OEED 5J4VA 3QPVA 4OI0A 3EIEA 1Q57A 2NO1A 1VIYA 5JMTA 2A7QA 3A37A 3TQCA 2QGNA 3EG5A 1Z47A 5CITA 1FMLA 1KO1A 4IEEA 4US2R 3LD9A 3KXLA 2L0XA 3TK1A 4TYNA 3AVTA 1A2BA 2B8WA 4F93B 2KJQA 4YMWA 4NP6A 5JS8A 4AY2A 1XU4A 3B82A 4XTCS 3C4JA 1W0KD 1EG7A 2MSCB 1KO8A 2J41A 2OFOA 3B1WA 4ARZB 4L4UA 4TMXA 3QNUA 3IPXA 4K8OA 2B8TA 3F0TA 4MDEA 4UNQA 4WZ6A 2FPMA 4MRSA 3A1SA 1EWQA 4Q1EA 5TXGA 2QNRA 3BBPA 3X1XA 1CP2A 1KMHA 1N6RA 3R8FA 4UQOA 2ZU0C 5FBVB 1IN6A 3UWKA 2OEPA 2J7PD 1AS2A 2HLDA 5FTNA 5J4YA 3TE6A 5L3QB 2GAAA 3AF1A 4AI6A 5CJ2A 3L43A 1Z07A 3A4MA 2BMFA 5C18A 1G4UR 5FTKA 3TNFA 2IS4A 3HP1A 2XTNA 3SFVA 4G5QA 1Q0UA 2ZVPX 3EWSA 4A8JC 3LO5A 5JECA 4DVGA 2BCGY 4URVR 1IY2A 1JQLB 1GL7A 1OF1A 5AUOB 2BVNA 4PPNA 4RY2A 5G41A 2ERYA 5JSZA 1P4SA 3T35A 1XTIA 2J59A 4URYR 3IHLA 4D82A 3T1TA 4LY6A 1L7VC 4HDCA 1G7SA 4JL5A 4RZXA 3BAFA 3LQQA 2NPFA 3RYTC 1N6IA 2IYTA 1KO4A 4GP6A 4TL6A 3FE2A 3VR3A 2NO9A 4I1UA 2UZIR 4C4PA 3V4RA 3U4QA 4RD4A 5GVRA 1FTSA 4JVLA 3RWMB 1DADA 1DEKA 1XXHA 1SHKA 3PUYA 1GRRA 2PBRA 3Q5DA 5AK0A 2A9KA 2Q3MA 1H8HD 2ZI3A 4Q9KA 1QDEA 2ZRLA 2JGNA 5DSZA 4PC1A 1NP6A 3L0OA 3X1ZA 3W8RA 2IUSA 5JI2E 2IYWA 5JHHB 2PLRA 3B9QA 1KI1A 3QI2A 5M04A 3GCGA 2KBFA 4P0TA 2CK3D 3CWZA 4CIDA 2W58A 2CXXA 5KPJA 1EXMA 4JIMA 2EQBA 3SJCA 1NVVQ 1G4AE 1FP7A 3MCAA 1E2GA 1MABB 2UZ3A 3U3KA 3VAAA 1M2OB 2OFWA 2GNOA 1ZUIA 5LPNA 4NYJR 3RRMA 3TVDA 3WBKA 1AS3A 4K81B 1M7BA 2CK3A 2EFEB 3QPWA 3T5DA 1T0JB 2QEQA 1OHHD 2C98A 3BWDD 4Q4JB 1R7RA 3IIMA 4P4TA 4TQAA 4UNPA 4TYQA 4U02A 3HYTA 1G291 5LB4A 3RS2A 4MA4A 2NZJA 3KFXA 4IKEA 5CIWA 2FH5B 3SN6A 3ZZTA 2PL3A 3CNOA 4S35A 4XVUA 2R44A 1JBKA 2A30A 4GDFA 2JLWA 2O8FA 1OSNA 3H1TA 1BO6A 1SXJD 2HV8A 3J81k 3SJAA 3NBZC 4S2EA 4RZUA 3T1OA 3PUXA 3C41J 1DAGA 2YC2C 1XF9A 1YZUA 1OYWA 5K8UA 1MO6A 1KK1A 5B2ZA 3A58B 3SU8A 1NBMA 3ADKA 4EFLA 1PUIA 4Q00A 4TYWA 2VP4A 2C04A 2NQ2C 3NVAA 2IYUA 2ODWA 2Q9AA 3CPHA 4Q9IA 4CDGA 3K70D 2QSZA 2JLXA 5F98A 3E70C 3PEWA 1O87A 4D25A 5CM8B 4QOSA 2MMGA 4Q4AA 1JXOA 3DDCA 4JYCA 1TF2A 1AK2A 2QL6A 3N5CA 4XVRA 4JJKA 4AIIA 1NLFA 4A0HA 4OK3A 1W0JD 2ATXA 4HDOB 1XTQA 4DLSA 3U6BA 5GJVC 2FFBA 1TADA 4HLUC 4Q4HA 1MABA 1V5WA 1HTWA 3BXZA 3GLIB 1CJUC 1P6XA 1QG2A 4PHHA 2B21A 2R6CA 2G9NA 2C99A 5HZHA 2FEOA 4HSEA 3ZD6A 3LXRA 3HJNA 2VP9A 3QKUA 1RYFA 1QF9A 3PEUA 2WJYA 4Q1AA 1U9IA 2JJ1D 1ETUA 4NYMR 5SZKB 3RC8A 1F3OA 1W0JA 2BHRA 5IK2A 5TARA 4M1SA 1GNPA 1YE8A 2OXCA 2ZS8A 4JKIA 4M1MA 4FW9A 3K8YA 2A5GA 1XJQA 3W34A 2AD5A 3TSWA 2NO6A 2NMVA 4UNNA 1KSJA 1R0WA 3QBTA 4TT3A 2P6NA 3JVVA 3QXSA 4LCBA 3VKGA 4DRZA 4HB2A 3QPUA 4GPTA 2UKDA 2CHVA 4P3YA 3CR8A 3EZFA 1C4OA 1DTSA 1NMZA 4DCVA 5IK2D 5JRJA 3T1QA 4ABYA 1G8PA 1E9RA 1RVDA 5AJXA 2JASA 3L0PA 4BLTA 3K1JA 4B2LA 2IW3A 1BS1A 2GF0A 1ZCAA 2NO7A 2FGJA 4TSFD 3H84A 2ZM5A 1CJMA 3WMEA 1K5DA 3L8ZA 1G18A 2OM2A 2WWHA 4A1FA 3EPKA 2XTZA 2G83A 3PR1A 2EFHB 3RS7A 3AVXA 1OXSC 2GKSA 3JZMA 4WW0A 2BC9A 2QRNA 1WB9A 3FHOA 3OEHD 5KSOA 3A4NA 1M7GA 1MKYA 2WIAA 2WVJA 4Y0VA 2G1KA 1VCIA 4PQYA 2XITA 2ZSDA 4I1SA 4PZZA 1HT1E 1ZW6A 2WOOA 1S3SA 4L8GA 221PA 3DHWC 3GFOA 1CJVC 2GTPA 3BFXA 1R6BX 1T3SA 3QF7A 2AXPA 3UATA 1IN7A 4HATA 1E9AA 3I73A 1QHHA 1T4GA 2DWQA 4ARZA 2CL0X 1X8KA 3AEZA 4DHEA 3O8BA 2QTVB 4WOPA 3U61B 3K9HA 4DWJA 4B73A 2VP6A 4D4MA 4E07A 1Z8FA 2H57A 4RVCA 2CVHA 2OCPA 2XEXA 1OKKD 2AD1A 1GKIA 1YZGA 3QOFA 4LI0A 4RD1A 1ZM7A 2AXNA 1TMKA 4NKRA 3GPLA 1JQJC 1II0A 1UFQA 1OYYA 5DYIA 5LBIA 3CIOA 5EUQB 2BBWA 1WF3A 4PO8A 3AV0B 1KO5A 5AJZA 2GBLA 3AVUA 3D7MA 3DKVA 5TMPA 1NNEA 3A36A 2BJVA 4Y0AA 4C0AC 1NLZA 2JLVA 4MGIR 1XJ0A 5BXQC 2ERXA 1JR3D 2Z4RA 2QM8A 3FFBA 1ELOA 1Z5ZA 3BFVA 1E0SA 1D2NA 4JMPA 4EKDA 4DLUA 4XD7A 3DO6A 4B3DA 4TLDA 3S1AB 4O2RA 2QBYB 3WP1B 1L4YA 2PZFA 3NKVA 3GEHA 1KAGA 2A5YB 1S9HA 3HR7A 5FI1B 3SHWA
chains in the Genus database with same CATH superfamily
4QIHA 4G0OA 4L16A 4RJIA 3DCJA 4KWIA 4MP3A 4W5JA 4M1KA 1UN8A 1TU0A 2NZ8A 2V1XA 3B5JA 2PH1A 2QJRA 2HCBA 3EPPA 1ZK1A 1C3LA 1M72A 4MQMA 4H6PA 5IVDA 2IYZA 4LV5B 5TMBA 2DTDA 2WU1A 2LDBA 1GPH1 4LBZA 4MQFA 2N1MA 3DHVA 4FMDB 5SYNA 3WFJA 1VBKA 1WA5A 4CKCA 2Q2NA 1Q0QA 1QGOA 1VBMA 2DQZA 5FIUA 5LSAA 2AZ4A 2CLDX 2DPHA 2NSLA 3RIXA 4A8PA 4K6KA 2R05A 5KYXA 3E7PA 1AMNA 3DL2A 3M4YA 3H8VA 3TLBA 2PJUA 3GNTA 4F91B 1DAHA 4WXHA 2GZHA 5B7PA 2BEWA 3KYJB 4Z9FA 1RE0A 3NIFB 1NI3A 3B2EA 3HE3A 1REQA 2JFFA 4NEGA 5CHEE 3HDQA 1KAQA 3AESB 1PT8A 5DMXA 4KV7A 4RVOA 2IU0A 1X81A 2R6DA 4WA8A 4IJMA 5BR7A 6CHYA 1PUXA 1RE1A 5GV8A 2QG6A 3IO5A 3B1XA 4FIPA 1UZUA 4BVJA 5BNZA 3EB6A 2HJWA 4G65A 2ISCA 1YMVA 2YNMC 2ZPTX 4MINA 5KNCA 3DDZX 4B6OA 1BOOA 2WJVA 2MTBA 3ZW8A 2FWIA 2UXBB 1FZTA 3PFWO 1TYAE 2Y71A 4F9FA 2PJRA 4N3NA 1B42A 2JIZA 1YO6A 5BSKA 3UXEA 3L0CA 4Z8XA 2YV2A 1CHCA 1FDRA 3PUVA 5HILA 2GJAA 1U6GB 1RXEA 2AFRA 3PFIA 3V9PA 5CA1A 5IT0A 2JFBA 3BYZA 1GRVA 4D0LB 5LM3A 1F7UA 4YT4A 1XEXB 4QM7A 3EQ7A 2ZR7A 1Z26A 3PGMA 5IEBA 4P4NA 3IAAA 3UJNA 2YOGA 4BKPA 2JG3A 4CODB 4H1WA 5CVDA 3LL4A 2YIMA 2YS7A 2ZLBA 2QN6A 3ABIA 3CMCO 3RAUA 4JLKA 1JDVA 4W1QA 3W5DA 2PS1A 4JASB 5HUQA 1YFZA 1R5NA 3CX6A 1RU3A 4YUAA 3QF4B 4HFGA 2ECNA 1H6OA 4P5OB 4FJ2A 3SS8A 1ST2A 4L28A 2IFUA 4A15A 4ZVPA 2CNKA 3QMPA 4UUBA 3OM1A 2GJSA 1KI8A 4IX1A 3ZHBA 4ZHBA 4WNYA 5EKDA 1VBNA 2DXIA 3ML8A 2EQAA 4DLVA 4FYXA 2YL2A 5TR9A 4CEIB 1I4TD 4RL6A 1HEYA 2JH8A 3PGVA 1X7DA 4TV8F 1P2BA 3EIQA 2NM0A 3F67A 4Q7JB 5G0VA 3ZLBA 4LF7B 4UXHA 4QG7A 2YJTD 4XEHA 4P86A 4N6GA 1Q7EA 4RACA 4W9NA 3JD3A 5E3JA 1L1EA 3OAAD 1P3JA 5BV1A 3VO8A 5K8IA 4R7EA 1LBEA 3ECAA 2SNIE 2CVQA 2QRJA 1UWKA 3QKRA 1T3HA 4HT3B 1G1MA 1GITA 1SGWA 3A9TA 3PWTA 1VE6A 2IHKA 2W2VA 4NJMB 1E7QA 2EDAA 3LHKA 1CUHA 3FUVA 5CLQA 5LQJA 4N6NA 2BEVA 3AJDA 1JB1A 1PNTA 2YS6A 3LCMA 4M6WB 1KJZA 1O6GA 1QB8A 2Q4BA 3AY3A 1ZC4A 4G0ZA 2I1VB 1J23A 2B7LA 5F76A 2R02A 4E33A 3N7UA 3CEQA 1RI4A 5FUVA 3TCKA 3AU9A 1I9CA 2WINI 4YMHA 2UZ1A 1P4HA 2GM4A 3BXXA 3K0EA 1EDOA 3V80A 1NQVA 3IUYA 3PVZA 1HUQA 4G5OA 1IEVA 2VDNB 4BEBA 2UXDB 3E3OA 4RKWA 4RIHA 4P38A 2ZYVX 4YBRA 3RYHB 4D9HA 1E20A 5CB6A 5LN1A 3M33A 1G66A 4PS7A 2GBCA 3O8RA 3QSYA 1X7WA 1OFUX 2XMSA 1K3ZD 1ZD9A 2Q2VA 5AHWA 3BA1A 3IGFA 3CHQA 4IGIA 1L4KA 2A5FA 3EISA 3OE7D 3V79K 3ASHA 2ATVA 3ORSA 1SVMA 2Z1DA 2BF4A 2FFQA 1PQPA 2AFHE 2TMYA 4M9UA 1S4QA 4P9NA 4XE0A 1WU7A 3VUEA 4I8IA 2P2SA 4JC5A 2E5WA 3ZWMA 4YADA 2A7XA 3UAOA 2PGIA 3FTDA 1VL8A 1Y3FE 3K5PA 3RGWS 3VU0A 2AJLI 2B2CA 3BK2A 1ST3A 4R2KA 7MDHA 2QB5A 2VDQB 3MWYW 3VHQA 4C4XA 3DDNA 3F6CA 1FS5A 2RHMA 4BFLA 1JR6A 4KZPA 2B94A 1DJMA 2XCUA 3U4HA 4L2YA 3SE7A 5I01A 3QK0A 2NUAA 4JKOA 2X7XA 2OCAA 2O2DA 1QO7A 2JLYA 3OOHA 5B12A 4Y2UA 4QEKA 3PNLB 3UJ9A 4Z4EA 1WEKA 3LHDA 1A96A 3JWHA 1OTYA 1P19A 4EQZA 4C6TB 4BX3A 1XEXA 2XRFA 3D4IA 4RH1A 3RU7A 1WTAA 4EBAA 4I2NA 1OH6A 2FZEA 3BH7A 2DBVO 3AMVA 4WKCA 4JYPA 5BN1A 5EILA 1I24A 1JQ3A 2P2DA 3DEHA 2WAAA 2A4MA 3B7TA 3G2LA 2JLZA 4BNHA 4ARIA 3KU1A 3M6IA 3NBNB 3UWMA 4UP5A 2EKBA 2P5YA 4KB5A 1PEKE 3KPUA 5CFOA 1Y5RA 1RZ4A 3ONKA 2AR9A 2YFYA 3I2KA 3SYKA 2DQYA 4KX5A 3UOWA 1BKYA 5ENVA 1WV1A 2XYVA 3C3WA 4U3JB 2R6GA 2GK7A 4MKHA 4MPRA 3O9MA 4G0YA 4OQPA 3I09A 1E1CB 1N5OX 2WU3A 4LHYA 3C8MA 1J7JA 4LYJA 5TE9A 5BQPA 2YJNA 3IDSA 2CFUA 1A04A 5JS7A 3THYB 1P2SA 1YS9A 4QFCA 5GOTA 2M85A 1JEOA 1H0AA 4G24A 4J8DA 3OFJA 2R2AA 3PQ8A 3NNSA 3IEPA 3R20A 2FPIA 3O9VA 3BF8A 3KT8A 2IUUA 4CLRB 4W5RA 2VT3A 1D2MA 3M2TA 2ZKLA 3HDYA 5KYXB 3GH3A 5ALGA 3TDNA 5JDIC 5C8VA 2RR4A 1D1SA 1OGIA 1W93A 4NBTA 1NBOA 2ETBA 1PLKA 2NYVA 3DLBA 3P0EA 2DUUA 4ZVUA 1JPVA 1T8TA 2HADA 4MQFB 5HQ3A 4TYYA 2WA2A 1L2TA 1U9YA 2W0MA 2ZB3A 2O0MA 3V6LA 1PI3A 5B75A 1MRNA 3VDMA 1EUCB 1DV1A 1Z6GA 3SWWA 2E1PA 4AS2A 3BBLA 3CN7A 4HUQB 1DAFA 1ZU5A 5GOZA 2ZJ3A 3IPAA 3FETA 4E32A 4YX9A 3EOAI 4A2QA 1JSXA 2ZI4A 4XPIA 2Z2ZA 4YXFA 1XPUA 2QBYA 5B3SE 1DFGA 2CT2A 2BMVA 1JJBA 3I01A 2J0EA 4Z9AA 3C5KA 2W2KA 3EVZA 5B1SA 2WSIA 1O0SA 3CRVA 4J7XA 3B7GA 3S1AA 2BH2A 4U7TB 3U6KA 1NF9A 4GE0A 4RKQA 4A0QA 2FUUA 3HXMA 2R4UA 4FX5A 1N34B 1FX0A 2XWBF 3DZDA 1QF6A 3HCAA 3N71A 3IMFA 4J0GA 1WFKA 2JLRA 4RYLA 4BFCA 5C8ZA 1SQFA 2BFAA 2WWVD 4ZYUA 4CI0B 1WY6A 3NWOA 5CEJA 1XBTA 4EIWA 3CUVA 1V71A 3HUDA 3KZ1E 4GR4A 4D3FA 2PBLA 3KOWA 3HXBA 4BO0A 3OZTA 4DY4A 4E22A 2HPVA 5E9WA 3A4IA 1C30B 4UNIA 2RHDA 1PDVA 4R0VA 4Q02A 3C8ZA 4R68A 4TX1A 1E6WA 4E5PA 2LN0A 3GLIE 3P9CA 4F7WA 3L0SA 5JMOA 4N9WA 2Y0BA 1A97A 1LK7A 1DO2A 4D9NA 1CK4A 1JZSA 2E9SA 4HKTA 5SZHB 1EFLA 1P73A 2XNKA 1WQ1R 3PSAA 4TLBA 1UDXA 3OEWA 4MUYA 3GGCA 2OYSA 4NBWA 4A5OA 3VPXA 1T6NA 1BHQ1 1P3DA 2ZEJA 1V54E 3F74A 1XA4A 2B1GA 3LJNA 2GFIA 2OFXA 2WF6A 3BAZA 4WY2A 3RRXA 5AN8A 1JIUA 2QF7A 2QJ0A 3GG9A 3DD1A 3SZGA 3GLSA 1XOIA 4G9BA 2Q1UA 3U7FB 4RIIA 4KL8S 1ATIA 3Q9UC 3C6YA 4CGYA 1P45A 4MB6A 4BVEA 5HS4A 1EWKA 1WOYA 1ELWA 3ENQA 4JR2A 4RNDB 5EGNA 2CBXA 2WXLA 1Z22A 3K5IA 2CLHB 2XGGA 3ORFA 2CZGA 4RSMA 4LJ7A 2QD2A 1E8WA 3TW0A 3IKOB 4D44A 2RHCA 2Y67A 2AVPA 3N07A 2JAUA 3ZV6A 3P27A 1U2RA 3ANTA 1X1DA 2RHOA 3GT7A 4FOTA 4M21A 3GUVA 4HBGA 2ZM6B 2J9RA 4BSXA 1KI6A 4PZAA 1GVNB 1KAOA 2WPVA 2PD6A 1I5OA 1J0EA 4MRRA 3OP4A 4GTVA 1UDCA 1RHJA 3EXHB 4KQJA 4YECA 3W8FA 4DLXA 2BFWA 3UM0A 2GHQA 2XECA 1SKYE 3PIRA 1U9JA 4FADA 1HV8A 4Q3CA 2AS0A 4G9GA 3VYWA 4UJ3A 3SAJA 4YMUA 1O4WA 1ULHA 3H2GA 5G3YA 3JU3A 3SFYA 1OIVA 4HGQA 1U8CB 1K06A 1RI1A 1Q2XA 1XTKA 4OYYA 3ED5A 4GBED 3QOUA 1CZHA 2COKA 1U2DA 1JW9B 4I9FA 1N32B 2BDTA 2E6RA 4KO2S 1HEIA 2BF7A 1KJJA 1D9ZA 2JJ1A 4RKFA 1SHUX 2GJKA 1UJKA 3FWPA 4C5CA 1ZSNA 1IHPA 1MJ0A 1KJIA 1SM4A 2NT4A 3DZIA 4MZXA 1VRCA 1CRWG 4FYMA 1SKYB 1UFOA 4HAZA 1Z8DA 1ES9A 4OHCA 2WI8A 1VL6A 4H18A 3ZDZB 2X8JA 3GT4A 3IS3A 4ARBA 4H08A 4GMFA 3UPUA 5GJWC 2QTRA 3N2LA 1BD3A 2B98A 1NP7A 3VUFA 4U7DA 2AMJA 2KWJA 3D6UA 4LPKA 2I87A 4TYMA 5AOBA 5BPFA 3GG2A 2EOAA 1YJBA 4ZREA 5AW5A 1R0BA 4ZCLA 4LY3A 4AWBA 5DN9A 4ZT3A 3X0DA 4P36A 4AYXA 4LMAA 1HZJA 5LKTA 2Z43A 3NEYA 1UDAA 1CY6A 3L8MA 3QLVC 4ZXFA 5J2UB 3M6FA 3STTA 1GP2A 3WLEA 3WQRA 3M1YA 1U0SY 3LDHA 3I32A 5KMGA 5KJ1A 1TGVA 4IQGA 1TD1A 3BHMA 1A4IA 3WTBA 2VDUE 3MJ4A 3A6PC 3OCWA 1I14A 1QUFA 1MUUA 4H4DA 3WHPA 1OBVA 2XMBA 4ZTBA 1V5EA 2V5UA 2V6IA 4O63O 3Q2KA 1TR4A 6AT1A 4A16A 1GAXA 3C98A 4W4UA 3QAQA 1EEHA 1T9BA 2XBLA 3DTVA 3N6RA 3QPAA 4L7XA 5G2OA 3TTXA 2HV9A 2HCRA 2WM8A 5DK4A 1NJ2A 3NONA 1TQ8A 3M5PA 3V8RA 1HH4A 4LUNU 1P7ZA 1L6IA 2I4TA 3CUUA 4GPAA 2XVMA 5H83A 3HK2A 3MV3B 1H19A 1T0HB 2AXQA 3NVMB 2L5UA 2O8FB 3LYLA 4DLYA 1O94D 4CKBA 4EI7A 5KKCA 5KSWB 4L95C 1X92A 2GHRA 3DEZA 4GTMA 1IFXA 2A9VA 4EYEA 1UFVA 3JYHA 2X2PA 2F6RA 3EZ7A 3JQGA 1K6JA 5FF9A 1N6HA 2VYVD 2FAXA 2A35A 2HWKA 3A7EA 3SBDA 3UT6A 2H2GA 1UPBA 3G0GA 5G53C 2QYJA 1CEXA 1SQ5A 1TFRA 2R1TA 2QL5A 2ZCJA 2QSJA 3D9QX 3IBTA 2G88A 2E49A 1R18A 3DB2A 2ID9A 1AKTA 3RIBA 1PWXA 1ITZA 3ZW9A 1ADJA 4BESA 1XCPA 2GTIA 1UKZA 2FE4A 2Q8PA 1USIA 3BB1A 2HC9A 1TKBA 2NU7A 3GK3A 2F0YA 3I1FA 3QW2A 5KTRA 2QQGA 5I5EA 4I1OA 4XLZA 5L3SB 1BE1A 4P58A 3LT4A 2RKBA 3TDKA 3UCXA 4CQMB 2F43B 5KQSA 1K8KG 5G05B 3UIOC 2ON6A 1J09A 1UPFA 1ZQ1A 3G9UA 4M8NE 3W7AA 5L4LA 2XWPA 5EWMA 3LPLA 4RIFA 3SFZA 4D97A 3AG2E 2N47A 4PYQA 4QREA 2GEBA 2XB8A 1EJ6A 1H2ZA 2XTMA 3I9FA 4IGEA 5AVJA 4F3NA 1FRNA 1T8UA 2IO3C 3RSOA 2WSBA 1IDN1 4KGVA 3FWHA 2GZMA 4QUAA 2EYQA 4HNVA 4HS9A 3LW8A 2GXUA 4ISBA 3VLEA 1R3DA 4M1TA 3TSAA 2FZWA 5EJ8A 5ECYA 2H29A 5DX1A 2BFDA 2RG1A 3KQKA 2DJIA 3LBFA 2VUHB 4FFNA 4H7HA 1VZ2A 3DYIA 2P9SG 1XC7A 1ZK2A 2H54A 2HRRA 3WIDA 4CFZA 1XXHB 4B47A 1C8KA 3GCZA 1CDEA 1H0RA 4FGZA 2HA6A 4Y6PA 2ZWMA 1CRPA 1TX4B 3WYCA 3P4UA 1YF3A 3M1LA 1GWNA 3EARA 1NVEA 3CVNA 4A1SA 2FX5A 1JCQA 5GZ1A 3ESBA 3R41A 4HZIA 4P54A 1U63A 1NVVR 3CLRC 3F2IA 4K6HA 4EKIA 1VRWA 1WESA 1MO4A 3PE6A 4HQOA 3G5LA 1MHPA 1NBAA 2HCFA 2XZTA 4K3VA 4N7RA 2B0CA 4UUPA 4CMJA 3DVAA 4NS1A 2A9PA 1RAFA 1L5KA 4WNDA 3SX2A 1EM8B 3TKYA 3WKDA 4MP6A 1JHVA 3VDNB 5L7TA 4C48B 3F1LA 3WGZA 4GYYA 3L16A 3RRZA 4E6EA 4HDQB 1SZ9A 1J1UA 2VDMB 2ZR0A 4WXMA 1ID1A 4F1JA 1IWOA 2H52A 2O7QA 2X8BA 4CQLA 3RJ9A 1VHDA 1MVNA 1KQNA 1RQRA 3AONB 5CDHA 5L3QA 4ZQBA 5IP5A 2D5IA 1PNVA 2P2NA 1FE8A 3QU5A 4PXAA 3WWZA 5E95A 2HMSA 1PS8A 1EFKA 3C5HA 4EYQA 1NW8A 2PSHA 1MJNA 4O08A 3V2OA 5BVHB 3TWUA 1WB6A 2OCIA 1R0XA 2RI7A 2QUIA 3NALA 2I2OA 1ZNQO 2E6UX 3QVSA 4E1AA 3D9JA 1Y33E 3BH6A 3C5EA 5CDFE 4UREA 3KCNA 3UMYA 2BHTA 4AN0A 1SBYA 5I4KA 1RAIA 1ZC3A 2PV0A 4EGJA 5JY6A 2OESA 4I46A 1TQHA 1KZHA 1HDXA 2RBEA 5IVHA 3F78A 3IYLW 5K6RA 3HM9A 2WKRA 3KTFA 1WDKA 5JR3A 1OIXA 1WS6A 2DX8A 4D4KA 3ZWWA 3UMSA 4AFNA 4TXPA 4AP9A 2O8BB 1NKTA 3EDMA 3AL2A 4GF5A 3R3ZA 1A4XA 1L7BA 2FNAA 2HM7A 4OAQA 2PU7A 4R9SA 4EOGA 2V7VA 1RDFA 1BIFA 1X7HA 3GARA 1A9YA 1C0IA 4L9WA 2BW0A 3H6KA 4W99A 3REQA 1GPBA 4GMXA 3ZWKA 3FZGA 1O9GA 1Z39A 3D3WA 2ZJ1A 3NOQA 4YRFA 4EHAA 3MGBA 2AV6A 4Q6FA 4H17A 4US0R 1LV7A 2IHNA 3DEPA 3CQ9A 2PQRA 1QGUB 3FULA 3DKIA 4R2YA 2IK8A 1M34E 2WWRA 3KTDA 4FIDA 1ZIXA 3CNEA 4UDYX 3VHLB 3KEQA 1EE9A 1U0NA 2I6TA 3G1TA 2W42A 1L3CA 2G1PA 4WFIA 2ONZA 3E9MA 3F4BA 2B1IA 5LA6A 2XSZD 1QRTA 3M1IA 3CNNA 3RTAA 1VMIA 1EI9A 4MYDA 3HO8A 5AI4A 2XUIA 3AI3A 4ZAWA 4ZZ2A 2VIIA 4ZI3A 4J76A 3UXYA 1PFKA 4NAUA 2A6PA 2G36A 2ODEA 3I4RB 3PS6A 9ATCA 1N4SA 2B5OA 3WGGA 1G5QA 5HG0A 2C7OA 1ZIPA 2FHPA 5JXHA 1Z37A 1BROA 2FUG1 3U9TA 3V8BA 1A88A 1YQEA 3QWBA 4R9VA 2YJ4A 1TM3E 4LHEA 5C4GB 4AUEA 4JEMA 4XZ4A 1JKFA 4OGWA 3B13A 3GLFA 3R3HA 4AKEA 5T4YA 1XZLA 4QQNA 3I5YA 1WKBA 2PLFA 3QFRA 1X77A 4DA6A 4YS6A 2VYCA 4DG8A 1KR2A 4AZ0A 2H2IA 2AL7A 4HLUA 2IVZA 5KVVA 4I08A 5AW2A 4CDNA 4U8YD 1JI3A 5HCNA 3OLCX 4QAQA 3NTOA 4C76A 2H4ZA 1V9SA 4IXMA 4Q19A 3W77A 5B36A 2D7JA 4KIGA 1LI5A 4PG7A 3WVNA 1Z5SC 5MGNA 1AZWA 3HDGA 4PANA 4KODA 3ZIAD 2XIQA 4XQCA 5FLEX 3F3SA 2ZJZA 5CT6A 3FNFA 3AI2A 2F59A 5I9TA 5FOQA 3NMUF 4L15A 4PAGA 2FMKA 3DHYA 4MUNA 4HX9A 3N9PA 5JARA 5IVKA 1EX7A 4HAXA 4J29A 5FT9A 1Z5NA 2MYNA 3FMIA 3BA6A 4RQBA 5HDQA 3UWSA 5IXJA 2DX7A 2VWGA 4FYYA 4H7PA 3ZWPA 1Q7TA 5D5PA 4Q4JA 5HCUA 2D6FA 2HYZA 4GUDA 1C7QA 2X5KO 3R3YA 2IHBA 3ZIAA 3WGHA 4G0NA 2YHEA 1NONA 2IGTA 1JTFA 1PSZA 2G25A 4R9NA 4D4JA 2XDQA 2I33A 5K8TA 5EZ6B 3GLUA 3GFBA 2V8BA 4B7ZA 4O1MA 1UJ5A 3J7TA 5CECB 1CB7A 2GPWA 1CUYA 1V7CA 2REOA 3EY9A 4M0PA 4QPDA 1WIMA 2YZMA 1Q11A 3JRWA 3S55A 2VKTA 5HKKA 1TT7A 2QLMA 1KEUA 1H94A 4X8OA 3TF5A 3W6UA 1T5DX 2QN2A 4BPBA 2YICA 4NH0A 2OKGA 4CM6A 2OO7A 1LNZA 4MTLA 3H1PA 4PZ9A 4UMDA 4M0LA 3S8EA 3WHKA 4HRNA 4DX7D 1EGHA 5G3ZA 4F4DA 1XL1A 2A8YA 3H5LA 5LQCA 2UAGA 2VDOB 3BIFA 3EY4A 3ZHTA 5CBPB 5DB4A 1EVQA 3RYCA 3AJIA 3ZXUB 5LXTF 4PPYA 4N7JA 1GKYA 4FGUA 4UBKA 4AKGA 2VRBA 3QE0A 4B8YA 5ALDA 2VQSA 2FW8A 2JCGA 3N8HA 4XARA 2YWGA 1XTUA 1QCYA 1V8FA 3DEKA 4L0CA 4NK5A 1J33A 2DIWA 4Y2TA 4BN5A 3P9SA 4TRNA 1VDZA 1XPJA 3M6WA 3AJRA 4JUFA 1TNZA 1PL8A 2V7WA 3HN7A 5P8WA 5IPFA 3LX5A 3FOAA 3NBFA 4LVNA 2KZTB 4FMPA 3DL7A 5AUPB 1A72A 2VNIA 3A9WA 3D4LA 3E4CA 1N3BA 4HAYA 3RFUA 3TQFA 3BD9A 5SY4A 1MJGA 2VF8A 5B3AA 2JAXA 1QHNA 2TMKA 1QE0A 3FH8A 1T4CA 2QMHA 2NYRA 5HVNA 2H1WA 2FWPA 1UMBA 4GC5A 1CRQA 4KQXA 2CV0A 4ACLA 3KPVA 1OWPA 4FHGA 2V5VA 1DWPA 1O95D 1GG5A 1YGYA 2R8RA 1PDWA 1N54A 4D02A 4MVTA 3QELA 4CM9D 4JLJA 4E03A 5LCWB 2C1ZA 3QX7A 3U56A 5JSUA 2EGPA 3ND8A 3NIGB 1F6BA 3KAJA 3TO5A 3WLTA 1C0LA 2FLKA 3OEYA 4PLTA 2QM7A 3THXB 5D87A 3DWDA 1LDKC 2OGZA 4W5HA 1H69A 4RK7A 3AUKA 2AJCA 3MTAA 5JAMA 2KI5A 4HF7A 3G0CA 3IJEB 2O7RA 4FNAA 4KYIB 4YBTA 5JO9A 5JADA 5CYOA 3EJNA 3WLMA 2C3UA 3GUZA 1PAUA 2WIGA 3F5QA 4W1RA 2IZ6A 2AUMA 3AXTA 4JLNA 4XDYA 1DRJA 4QNNA 5EHIA 4AURA 1KK3A 2E6KA 3U4GA 2DKFA 3MTBA 4FHFA 2WF5A 1O6ZA 3MX3A 1V3UA 1W29A 2NZVG 3MM4A 1JEQA 3TD2A 3LT1A 1ZCBA 2PFKA 3VOSA 1SO8A 2Z9DA 5C52B 1EIWA 4ENSA 4RX1A 2RSDA 4KR3A 2HI0A 3AVVA 1JN0A 3Q8WA 4KO8A 4P0PB 1XZMA 1OPXA 1S89A 1XEWY 3R3UA 1VLHA 3O74A 5ULLA 5D1NA 4F6LA 4C0MA 1SG0A 2PRYA 4FZVA 3VR5D 1QRAA 1X7YA 1I1NA 1SVKA 4G81A 1OY3D 3DL0A 2OV2A 1FDVA 4GTPA 3QWIA 2X0NA 1GDDA 3CB4A 2VXOA 4NL4H 3A32A 4HDRA 2VPIA 1JBEA 2HHLA 1IU9A 3CH4B 1JE0A 5FWAA 2K4DA 2BGUA 3IRVA 4ITVA 4M1OA 1HWYA 2J9ZB 2GRMA 2X6IA 1Y3CE 3A04A 2QYSA 3NTLA 3FFTA 2HDHA 1A71A 1S8OA 2JJ2A 3P19A 3PEFA 5J2TB 2UY1A 4EF5A 3GEMA 4HB0A 4D43A 4BGIA 2IS2A 1Q15A 4WDQA 1YYHA 3HWRA 1Z45A 3THRA 1QVAA 2Q5JA 3DPDA 1Q3KA 1W1IA 4RANA 4U5XA 5BPPA 5SVIA 1GIAA 4QDOA 4KGXA 2BGRA 3IT3A 5EY5B 3WYFA 2CV1A 4A23A 3P96A 5A6VA 1I6KA 1KXJA 4CNBA 4EZLA 2EKZA 4EG1A 5K0GA 5CK4A 3TEMA 3C5VA 3JUEA 1EUDA 1K2VN 1C9NA 2L9BA 2GSWA 3VU8A 1TKRA 2R5NA 2WOJA 2P6UA 4DLKA 1I6WA 3S7DA 1XQXA 4LW8A 5FOTA 5TB5A 3H3JA 1SG9A 1YS6A 2JJ2D 4PTYA 1JALA 2A5JA 2GILA 4D6XA 4YRQA 4KZKA 4REMA 2WQHA 5GWXA 3EB5A 3R9MA 2XVXA 3SEZA 3T0GA 3AG4E 2G67A 2VSYA 1VSQA 5EVCA 5J5VA 3WYBA 1TMGE 5CCLA 3GEBA 3D6NB 3LDGA 3AGQA 5EIHA 4B32A 5J3JA 3K8QA 3LI2A 2Q50A 3K2QA 4GA0A 1TLLA 3CX8A 4ZJPA 2E85A 3WMWA 3A2NA 3UHOA 5HS6A 2QRGA 3QEMA 2VQDA 3LUFA 3UT5A 4EEZA 1EHIA 4J6FA 4CKYA 2Q5OA 5EJ7A 5B1BE 1FOEB 1BCSB 4KQEA 4U0SA 2DFNA 5FBHA 1CIVA 1G6Q1 2LW7A 2C7GA 1EX1A 5LZ9A 4X5OA 2A9FA 3MMNA 1LFDB 2ZRPA 4LXQA 4NIMA 2OKCA 2BOVA 3ULYA 3E3LA 1EGVB 2A0WA 2LWIA 5JAUA 4GYOA 1VG9B 2ETAA 1IWPB 3ASDA 1QIGA 4G4SO 4ZTZB 1KNXA 1R0LA 3HBMA 1Q0ZA 3OPMA 4N7BA 3V2IA 2IZ1A 2IIPA 1NXPA 4AJIA 1NVDA 5HRAA 2YRXA 3RW9A 2XQ0A 3H86A 2WMNA 1J2YA 1GKLA 3H5AA 2ZRAA 4GMLA 2GHTA 4RPGA 5JOQA 3KLBA 1T1GA 1XCOA 3UANA 1MJ5A 2P5SA 4X91A 4A0GA 4I6EA 3KNVA 2Y0EA 5LLTA 2X4DA 1K6EA 3HL0A 2NAFA 5JLAA 4V38A 5EFZA 4B40A 3H0KA 4JKYA 3L8GA 4LIPD 4Z53A 5T3RA 4NG4A 1VGRA 2O7VA 3HYCA 4NZ9A 4JA2A 3AW9A 4PGMA 1UBNA 1LSUA 2Z1NA 4AICA 3N58A 2JZCA 4ACAA 3SF4A 1ZGGA 4B44A 4BRUA 3GOHA 3U5OA 1QOQB 2HMVA 2XE8A 9LDBA 2YXBA 3FB1A 5D2MC 2FVYA 4CA1A 3ONWA 5FTWA 1M1YE 3Q72A 1XHEA 1XEWX 2H0RA 4GL4A 2H1VA 3WLNA 3AVUA 4MV1A 5AJZA 3W9FA 1CHDA 4FD3A 3TLGA 1CUUA 2OHXA 2OZKA 1TT5B 2FPOA 2Q2OA 2C4KA 4BNDB 3TFOA 2GN2A 2ZUBA 2DC1A 1YRYE 2CLIB 2OHVA 4GI7A 5LQUA 3KWMA 3EYAA 3UJAA 3KV5A 1FPPA 1T13A 2N9UA 4DUPA 5KZMB 2XCIA 4HXGA 5GQSA 4FB5A 4YCBA 2HSWA 2D74A 3RSLA 1ZM4A 5D0QD 1EJBA 2QHXA 3M49A 1B93A 1QFXA 2A1UB 2R79A 3ZHZA 3LNCA 4PUCA 4CF5A 3MB8A 3M9LA 4AIIA 1T5OA 3HNOA 2HHAA 4QPPA 5AKKA 4CR6A 2WT9A 2O7SA 1Z2CA 4CL2A 3EPRA 4L9PA 3D2LA 2KS6A 1GGMA 4FEYA 2WPNA 3K1TA 2J0SA 4Q1CA 4B43A 1PJ4A 2IHVA 4DLBA 3I2DA 3N9LA 1RHKA 3IT1A 3RS0A 1BNCA 4TV8A 2WHPB 4R3UC 5IKEA 3F8SA 3ZJVA 2OA0A 3FPFA 3W8EA 1NW5A 4IDDA 1WZUA 1YT5A 2GJ9A 3CINA 3TXYA 1QU3A 3P26A 4HLEA 3I9V6 4E13A 3W3AA 3EXHC 1EFRA 4F60A 2O2XA 1L5JA 1PV1A 1MN6A 2FSAA 1K8QA 2XNSA 1QIMA 4KXXA 4MQLA 3FCEA 5CXXA 4EHIA 4ZYZA 2I91A 2PA0A 3WKBA 4C88A 1ZWLA 4V1CI 4A6EA 4YHBA 3HJGA 2EFJA 4W1SA 1JHAA 1YMPA 1AKWA 2M1RA 5C46F 3FAOA 2VNAA 5G0TA 3IR6A 1II9A 1TJYA 2WTMA 3NATA 4LN1A 5U1PA 2A33A 3B3GA 3JCZA 3NDBB 3V43A 1OLSA 3WGVA 1B3BA 1FFHA 4L9SA 5CBKA 1F1JA 3ONVA 3PEYA 2IE8A 4CKEB 1J4AA 1SU4A 2BKUA 4FILA 2WXJA 2ETVA 2LNDA 2H5IA 1H1TA 3OESA 1VCOA 1X2EA 1RSZA 3FIJA 2OHOA 4OLBA 2GCOA 3MUFA 4UDXX 4WNGA 4ZIRA 3MPUA 4MWZA 3KYCA 1YMUA 3B1JA 1XPOA 1LX7A 1QRRA 3NHRA 3CISA 1U0EA 4ZCQA 2IFTA 2PU5A 2LV9A 1X19A 3HYSA 2Y68A 3K4HA 3NIBA 4DIOA 1IIBA 4NH4A 3HLTA 1IJKA 1JG4A 1TUBA 4OATA 3RO3A 3TIXB 4NI5A 2GH1A 2QL9A 3K4PA 4Q7KA 4EG4A 1X1RA 2ZITA 3FUUA 2VJOA 3PD0A 3UKDA 1DG9A 2G63A 4LJNA 5CTAA 3ROMA 3PUKA 4V3IA 2I78A 1KGSA 3HU1A 4HYTA 3ZHEA 4EB6A 1RZRD 4X61A 2JS7A 4JB8P 1WD7A 4KLCA 3TR6A 4ENUA 5I6DA 1ANKA 1H6BA 3SEQA 4ND8A 4BEWA 4E2WA 5JJBA 4YQZA 1ZVJA 3GLGE 4D0GA 1Z6ZA 2CBGA 1Y9AA 2JGJA 3BMQA 3OFVA 2VHCA 4INOA 1U1CA 4LCJA 4KKXB 4KPYA 3T5GA 1K8RA 2H5LA 3RR2A 3BZBA 5DO9A 2LCFA 4KQCA 1ZH0A 1C1DB 3ZK8A 1O5MA 3MRVA 5D7NA 1I4DD 3QIVA 1L3BA 4PBTA 1SUSA 2A0KA 3FNQA 4REQB 4ZCPA 5CFZA 3FZYA 4JT8A 4QE3A 2Y05A 1Z2QA 2LRIC 1YJAA 5G2NA 1ADGA 2ZRQA 3GJ5A 5C80A 1GD1O 4YPOA 4MV7A 4FC6A 1SURA 1YOVA 3DUFB 1MB4A 4HH1A 4YUYA 2ZJ8A 1GFSA 3IX7A 5EHXA 1Z3CA 5BUCA 4UI9J 3E48A 3KNZA 4FMCF 2X2FA 3FUEA 4MS6A 1NUSA 3ZDRA 2P8JA 4B6JA 3PHJA 1J24A 3Q9UA 3A4VA 4JEHA 5F73A 4GX5A 5DYTA 2AXZA 1F4PA 2ZBRA 4PZ0A 3VPFA 4YT2A 5JY1A 2J9QA 3F5SA 4R1TA 1P5HA 5B30A 3FTSA 3HFGA 3HJRA 3GBSA 2F90A 1E63A 3AFMA 2P69A 3H75A 4E2FA 4YDQA 1W96A 5H02A 4WUTA 1NFQA 4RELA 3TOXA 2ZB2A 3PFKA 5AQBA 4LECA 2VK1A 4G8KA 3DSSA 1P1IA 4X1KB 3DPUA 3L6BA 3QEKA 3GLVA 4LYYA 3AB3A 5JBNA 1Y8QA 4D10C 7ADHA 5JCJA 3K1ZA 2OEVA 4UEJA 5ER9A 4JI0B 1T1EA 2JKZA 2H31A 3EGDA 2PL1A 1D2EA 4Q3KA 5I8WA 1WY5A 4Z3OA 4JY7A 1E3LA 3AP1A 3ZVYA 5IUJC 4MJXA 2IF0A 1PGJA 4AM8A 1YR1A 2QJOA 3AHCA 1IWBB 1ULBA 3HN2A 1RI3A 2C7BA 3OIVA 1THMA 4TTTS 3VZDA 2I1WA 4Q94A 4YRSA 2C2VS 3U16A 2X4GA 2POCA 4PLGA 3SF8A 4GWGA 5CX4A 3E5MA 2V5FA 4KUGA 3H4VA 4BAUA 1PSDA 3UFXB 2I55A 5JWOA 4BSZB 3QTTA 2YJ5A 1ZGHA 4JJ8A 4V03A 3LFUA 4Q7LA 2ZSFA 2C94A 4GTTA 1GU7A 3ZJ5A 1LH0A 3ET4A 1I3NA 4S3OC 2BGKA 2JGRA 4XI0A 4XTRA 5IC5A 3T15A 2Y0BG 2J45A 2BZGA 2JLCA 1O95C 2XRZA 2XE4A 3OX1A 4X84A 5JE8A 2K87A 3SBXA 1N3LA 2B83A 2N0SA 2P5UA 2B9VA 1XL0A 5EXTA 4ZKEA 4DQXA 2DLCX 4KPGA 4PLYA 1G8GA 4EG7A 1MW8X 1WWKA 1U80A 4EB3A 3UUFA 2BIFA 1SHJA 3W1WA 1GNVA 4G01B 4MVYA 2CSXA 2BSAA 1JB9A 4EVQA 4WFKA 1QHHB 4MRMA 3U3RA 3HB7A 5FA5A 4ZOAA 1VL2A 1WDTA 3K9GA 4PO1A 1MM3A 4QRHA 3NHUA 1JHRA 4FHZA 5IHPA 7MHTA 1GGKA 1ZLYA 5CA1F 1R37A 1RJFA 3DF7A 2EW8A 3NWBA 4KK4A 2WE7A 1AKQA 1JEEA 1VGQA 2FU5C 4IR7A 4KQGA 5EQTA 3V4OA 4AVYA 4I7BA 2BHSA 4AWXA 5B64A 3D9MA 4M88A 4FHDA 1R2QA 4HQDA 3SHBA 1P77A 1LVHA 1V41E 1AZTA 2WVGA 2XT0A 3D8NA 3LKUA 3SHOA 4YAKA 4PHGA 1R4MB 4OXRA 4L2IA 1KVQA 3CF2A 2R1VA 3UC5A 4BUJA 1DIHA 2B4AA 2YN0A 1OV4A 2QOEA 1JKJB 1WX1A 4JUDX 4WA6A 1KT1A 2VCEA 3A1CA 4DSOA 3TXAA 1CUVA 3KYDA 4OQZA 5B8DA 1PV2A 4IHJA 4HOSA 3O82A 4Q03A 4XKJA 5DI3B 5IARA 4Z2AA 2E6SA 5C2JB 2VGYA 1A9SA 3CZAA 4UE6A 3SOZA 2FPPB 4FNOA 3V8QA 3E03A 1IBLB 3I9KA 1SEVA 1DIOB 1YU6A 1T0BA 1Z6YA 1WG8A 2E37A 2PGLA 3I6MA 1Q2ZA 1O1TA 1D4FA 4JELA 4JQZA 4A1OA 2WFMA