3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
3EZFA 3CLVA 1Z0DA 4GBMA 2QMOA 2GESA 3RRZA 2IWHA 2F3TA 2GXQA 4N3NA 5IDVA 1T6NA 4RD1A 2VBCA 2FZ4A 3DOFA 2Q6TA 3AQ4A 4TL8A 4QG7A 5F3WB 1PJRA 3WBKA 4EFMA 4CEJA 1GKUB 1OIVA 2CNWA 1ZW6A 421PA 1T3LA 1LS1A 2CEAA 4B6EA 4NYIQ 4RKFA 1V5WA 3AF4A 2EFHB 5G53C 2YJTD 1U81A 2ZS8A 3EA0A 2A2ZA 4HLCA 4NCIA 2FPLA 4B33A 1RPZA 1ZNXA 2G83A 1AKYA 4LWZA 5FTLA 1FMJA 3LY5A 2GAOA 3QF7A 3CPJB 2NO0A 1R5BA 4I1UA 1R0WA 5F2EA 1AS2A 4X8HA 1AIPA 3NEJA 3A6PC 1BYUA 4C7OA 3HPQA 1XX6A 4NU0A 1RJ9A 1YU9A 1FL9A 4M1YA 2BM1A 4LJAA 1KI7A 3VHXA 4E07A 2ZPTX 5FOWA 1S2MA 2VP4A 3A4LA 4WXPA 4D2IA 1W7AA 2WPDA 3F0TA 4JSTA 2XZPA 2C03A 2J9RA 2X19A 1LF0A 4KO8A 1D2NA 1I4LD 5GVRA 4EPRA 4ILEA 1N6KA 2HCBA 2WSSA 5CJPA 2CCJA 5TB5A 1ELOA 4BZPA 4KVGA 4NYJR 5KYKA 3CX7A 4PAOA 3CPHA 4RZ3A 2ONJA 1ZJ6A 1QHNA 2IYLD 5FTKA 2RGGA 2YWEA 2ZSEA 2P2LA 2GRJA 3WYGA 4Q47A 2REBA 4ARZA 4RD3A 4JYCA 1CR0A 1FX0B 5LB2A 2RMKA 3LBNA 2PZGA 2KI5A 2R65A 4K8OA 4EPVA 3QPVA 4M9XA 3KL4A 2WWGA 3OIWA 2A9KA 4HAYA 1E9BA 4DUGD 2GZAA 3ECCA 4NH0A 3KJEA 1T3HA 2QM7A 2PX3A 3A37A 4RZ2A 4YC7A 1GNPA 1JR6A 3UMFA 2CXXA 4IW3B 2Q3FA 4DIEA 2EFEB 1ZNZA 2QI9C 1TTTA 2V6IA 1F2UB 2QTFA 4P0TA 1NN0A 1ZIOA 4LHXA 3I61A 1G3QA 4FMDB 2C95A 5GJBA 1G8GA 4JL8A 2FA9A 3TSOA 2LKDA 1E4VA 3RS7A 3FMOB 2B8TA 2ZU0C 2PH1A 3K70C 4RD4A 3CB4A 4D0GA 4J0QA 2JJ1A 1U0LA 2CCKA 5AJVB 4V0OA 1E94E 3UK6A 4PHGA 4HYYA 4OHWA 4N0EA 4F4JA 2XAUA 1A2KC 3OFNA 1QG4A 1E2DA 1EFTA 3WMGA 5IRCD 1J8MF 4IJMA 1DTSA 3GLGA 3D7MA 1W46A 2W6JA 3OESA 3DWDA 2XX3A 5LB4A 1XFAA 2XNSA 1JR3A 4C0BA 3QUSA 1QVRA 5L3QA 2QT1A 4CF7A 3G0HA 3CRVA 3IDQA 3ICEA 1GTVA 2FV8A 2CE7A 2KBEA 1KIMA 4NCJA 4HB3A 1AKEA 3RYTC 4BWYA 1S1CA 3LLMA 2OILA 5AJWA 3THWA 4OJKA 4TYWA 2ZS7A 3E2IA 3P20A 1WCV1 1WE2A 4LRWA 3EPJA 1ZD9A 3SEAA 1NI3A 1GNRA 2PL3A 3QKRA 3TQFA 1N5LA 1FFHA 3CX6A 4KLZA 1UPTA 4G5QA 2BM0A 2UZIR 3FPAA 3IGFA 4TYQA 4BFXA 4GFDA 5DI9A 3PUYA 5FTNA 3IO3A 5JFGA 2HCJB 4YQFA 1XTRA 2IA5A 1W47A 5FTMA 4AIIA 5HZHA 1YHNA 2FGKA 5TDHA 1A5TA 721PA 5FPKA 1NY6A 2CHQA 4ERNA 3U7FB 2F9LA 5HPYB 3EPLA 3PIRA 4B74A 4HSEA 3QEOA 2ZVPX 2MSDB 2VP0A 2A5DA 1CR2A 2ZANA 1BYIA 4M1OA 4G3XA 1XJ0A 5CIWA 2FEMA 3WNCA 3X1XA 2V4ZA 2J5XA 1D9XA 2ZRIA 3BIFA 621PA 3U7GA 2BMFA 4NPHA 4IEEA 1SVKA 1SVIA 1KK1A 1TF2A 1OHHA 3JZMA 1JJ7A 1L7VC 1VECA 5FBRB 4G5SA 1CS4C 2Z0MA 5E95A 1KJYA 4L15A 1UBCA 5CJ2A 2ZSDA 4QXAA 4DHEA 3H4MA 3K0FA 2D2EA 1E2EA 1U8YA 2JGNA 2QG6A 4WA7A 4AYWA 1AS3A 1IN7A 2G6BA 2F7SA 3AM1A 2ZI5A 2VHCA 2ONKA 3C5CA 4C4PA 1MO5A 3CRW1 4LI0A 1HQYE 4OQFA 4QBHA 5CM9C 3GEHA 3FWYA 1E9CA 2FN4A 3AB3A 3NDPA 4QFMA 2XOKA 5DIFA 5KO2A 3MDBC 1XMSA 2BBOA 3ZYCA 3OIVA 3PFIA 3V4FA 3N5CA 4AKEA 2B8WA 3TSZA 1U2RA 2IF2A 3R7WB 3U60B 3PEVA 3HP1A 1E2MA 3KZ1E 1Z6YA 3B9PA 5SZJA 4B2LA 1ZM9A 2JASA 3W6NA 5FI0B 4GDFA 5JWOA 1GNQA 3AVYA 1QRAA 4L9SA 5EZ5A 2ZRNA 1LVGA 4ZCIA 2BC9A 3ONWA 4G1UC 3WRYC 4D0NA 4DCSA 1Q1ZA 5AUOB 4CVNA 2C99A 5D3QA 1XCGB 3MGCA 4US1R 5FOTA 5K8UA 3NG1A 3ZVRA 2VP9A 5TVKA 4UNNA 1E9FA 1M2OB 2A30A 2ZRDA 3IILA 3KQKA 1VIAA 2RGAA 3SQWA 1DEKA 1F48A 1WP9A 4C0AC 4D6PA 4DBLC 4D4MA 4CW7A 2NZJA 4JBWA 4UQOA 5L3RA 4F92B 5M04A 3IPXA 2GVZC 3TUZC 1W1WA 2EYQA 2WJIA 2ZUBA 4FMBB 2LCFA 2QORA 1NF3A 4ON9A 2RGNA 4O25A 3MCAA 3DZDA 3GFOA 3IIJA 2QTVB 3EWAA 2YVUA 4DB2A 4KJZA 3UG7A 4WIAA 2WJGA 5J4YA 4IRUB 1KO5A 5TARA 1N5IA 2BHRA 2R6DA 4UJ5A 1FOEB 2IS4A 4OQNA 1VCIA 5BYJA 2B0OE 1VHTA 4V0LA 1F60A 2CL6X 2CLSA 3QSYA 1VG1A 3MAAC 1JBKA 2GEDA 4MYTA 4C0KA 1NVUQ 3AH8A 1P2VA 4LJ9A 5CK5A 3TK1A 2HLDD 1DS6A 4BLPA 1KZGB 2XXAA 4DSOA 4LUCA 1G7TA 1ZYUA 1P9WA 3AF1A 1D2EA 3VX3A 3JVVA 1R0XA 3A1SA 3GJ6A 4CZ2A 5KUTA 4PC1A 4BEJA 5KNBA 4A0RA 3Q9LA 4DUGA 1ZAKA 5EXPA 5IF9A 2O8BA 4EPWA 3Q7QA 4V03A 3KKPA 2IHBA 4Q66C 4DSNA 4NYJQ 1NSFA 3RLFA 2O52A 2OFOA 1KDPA 4TLBA 1XPOA 2AN9A 2I3BA 5L3QB 3FEHA 4Q4HA 1QHGA 1RRFA 1EFCA 2ZRLA 3LX5A 3HYTA 3AVTA 3KB2A 3EZ2A 3DVLA 4GOJA 4TMKA 2ZRJA 2V7QD 2HYDA 2OAP1 3VR6A 1OFUX 4X8LA 4LJYA 2ZRPA 2HJVA 2WMOB 4URVR 5FUWA 4CIDA 4ESHA 3TVTA 3TVDA 4B44A 3U44B 2HF8A 2C9OA 2AWOA 4IHQA 3I62A 1W5TA 4TN1A 2V3CC 3WNDA 3PXGA 3QKRB 3QKUA 5DYIA 4M8NE 4URWR 2IHYA 1G7RA 2CL0X 1NVVR 4RKEA 3RS0A 4QJ3A 3HPRA 3MFYA 1KAOA 1I4DD 3C5HA 1E2LA 1YRBA 3CR8A 1Z63A 3C7KA 3NC1C 5TXGA 5FUYA 2IYRA 4DEXA 3EIQA 5F98A 1UF9A 3H86A 4KBGA 1E0KA 4AY2A 1BO6A 1RFLA 2ZI4A 3V9PA 1T5IA 2C9YA 4HDQB 1UJ2A 4B75A 2WIBA 2F6RA 2XZOA 3U4QB 1NP6A 4P32A 1G64A 1VG9B 3EC2A 3QBVA 3CWZA 3EIHA 1UDXA 4HAUA 1KDTA 2BEKA 1X8JA 1VYUA 3O8CA 2IS2A 1KYIA 5C4GB 1M74A 4Q03A 3GLGE 4QOSA 2W2XA 4KFTA 1Q1EA 2DCUA 1ZCAA 4KFUA 1JI0A 2C2HA 4IFBA 1JR3E 4OHZA 3CONA 5C18A 1ZM7A 3CUEF 3R20A 3K0AA 1Z5ZA 4LHZA 4CDGA 1NMYA 2G0NA 3K0FB 1Q22A 1KSHA 4RD2A 4AG5A 4LHVA 2CJWB 2REOA 1LFDB 1NRJB 1QHXA 4P31A 1XU4A 3MG9A 1DELA 1DARA 3FB4A 1DOAA 3NH6A 3RS4A 4KITB 1FTNA 2QY9A 4Q48A 4B43A 1OT3A 6Q21A 2GZHA 4UJ3A 2NGRA 3GLIB 3U61B 3OE7D 3SU8A 4LV6A 4PSKA 4PSVA 3JZAA 1PUJA 4NBSA 2C96A 3THYB 5CLQA 5HCIA 1KK3A 5TY0A 5CM8B 3U3RA 2R44A 2DB3A 1Y3AA 1Z0IA 2GCPA 5BN3A 4FWIB 1P5ZB 1AGRA 3BC1A 3W8RA 2J0QA 1X6VA 1JNYA 2XTMA 1GFIA 4NCHA 2GHIA 3B60A 4XVUA 1BIFA 4HLUA 4U5XA 3GJ5A 1YR8A 3RRYA 3W5JA 4ABYA 4B3CA 4BEBA 1IN4A 5GADl 1E0AA 1NN5A 4A1FA 4UKDA 1G16A 2FH5B 4DRZA 1OXUA 3K09A 1R5OA 1D9ZA 1G3IA 3LRPA 4A0FA 3K9HA 3DPUA 2WWFA 1ESMA 1RKBA 4MKHA 2ZITA 4QJ4A 4DWJA 2RGNC 2GNOA 2A5GA 1TF7A 2OZEA 1CBUA 4WW0A 3ZZTA 1Z3IX 5J40A 2ZJOA 4HLDA 3VU9A 2ZAOA 2P57A 4TSFA 2ZJYA 1W5SA 2QENA 4E5UA 3FOZA 4NCNA 1BS1A 4WOPA 3ETLA 4LJ8A 3BK7A 1MRSA 4H9GA 4RSGA 2N1BA 3KFXA 2BCJQ 2W6ID 1ZC3A 5J4KA 1KZ7B 2ZYVX 2OCYC 4B3XA 1JXMA 5K8IA 5AWFC 2JLUA 1XEFA 3TW4A 1OPXA 3A1WA 2FDCA 4P4TA 5AUQA 1IXSB 1FQJA 1E9RA 1QG2A 1IY0A 2FGJA 3E70C 3OIYA 1HT2E 1R5NA 2CDNA 4V0KA 3KDSE 2EWVA 1CU1A 2IYXA 3RABA 1T9HA 4JT4A 1WB9A 4B2IA 2E9SA 2CE2X 1E1QD 2OAQ1 2BMJA 2GJSA 3SFVA 1TX4B 3FM8C 1N5JA 4V0ME 4DLWA 2FFQA 1CRPA 4ZI2A 3O8DA 3T1QA 3QBTA 4PAQA 4W5JA 2IYVA 1LF5A 4JSYA 4IFEA 4PQRA 5JCZA 4TTRA 2IS6A 3BOSA 3B8HA 3NBZC 1P9NA 4G0NA 3IKJA 2FSGA 2HV8A 2OEPA 3EASA 3FHCB 5EUMA 2JLXA 1F2UA 1E0SA 3TMKA 4LJ6A 2O8BB 1MO6A 1SZPA 2YV5A 2DWPA 2A5YB 1SHKA 1HTWA 4Q9LA 3SBEA 3TW8B 2O8CB 2UKDA 121PA 1HUQA 1N5KA 2DFLA 2IT1A 2QBYB 1U98A 2FSIA 4PPGA 3O8BA 2OE2A 1W49A 4RD0A 1AA9A 4Q1FA 3AGQA 3BERA 4Y0AA 4QKQA 2QMEA 4B71A 3PVSA 3KKMA 4M1MA 2J7PD 3D6TB 2ZJ2A 3VR5A 1GILA 2GILA 2HLDA 2QQ0A 2A5JA 2VEDA 2JATA 4AYTA 5CYOA 4WXRA 4L4UA 2ODBA 4B3BA 4BFWA 3P27A 1AK2A 1S1MA 3ND8A 3ZDQA 1TEVA 1P9RA 4W5HA 5K8LA 2Q3HA 4POAA 2DYKA 2I1QA 4O2LA 1E9DA 5E7IA 5BWMA 1E2HA 5KSPA 1US8A 1MKYA 2YHSA 5G3YA 1FUUA 1E3MA 1G5PA 4QGHA 5EP4A 1WBDA 1KK0A 1NN1A 3QXSA 1GKIA 3TUIC 2ODWA 4C0SA 3IIMA 2CRRA 3EW9A 3QEJA 1D5CA 1N6HA 1EFRD 3RSLA 2PEZA 4Y0VA 1SVLA 4R71A 3AP3A 1IN5A 1LY1A 2FSFA 3GLFE 5KPJA 5CDFA 5KDOA 3NVAA 1G19A 2PBRA 4PZYA 521PA 2J41A 2IC5A 3I3SR 4PHHA 5AJZA 5F9FA 3BWDD 4GNKA 3VTKA 2V6JA 5EP1A 4WZBE 1SKYB 2IQJA 3PEUA 4I1VA 4FWTA 5KNCA 1XF9A 4MUAA 1CF4A 2GF0A 2IF0A 1FUKA 3QI2A 1ZM3A 4QBIA 2C5LA 2SHKA 2GDJA 4ESVA 3CX8A 3QKTA 4FINA 2MMCA 4BRWA 5TMPA 4EPXA 1G5RA 1Z6GA 3U6KA 2QAGA 4K46A 4MRVA 1E4YA 3AKCA 3B1ZA 2RGXA 3M0EA 3BRWD 3GQBA 4URYR 2A5FA 4M1WA 1ZUNB 1Z22A 1NBMD 3L2OB 3LXRA 4UNRA 5JS8A 3K0SA 1E1RD 3X1ZA 3L43A 1II9A 4OHVA 1G3RA 5A0FA 2ZE6A 3WYFA 1B23P 4KAXA 3G82C 4TMXA 5FOVA 3K0CA 1UKZA 1YZTA 4PC6A 4KVAA 2Q9AA 4KFSA 2GEVA 1NVVQ 2PMKA 2XJ4A 5LD2B 1J8YF 4DLXA 1AZTA 3SBDA 1U0JA 4R9UC 2OCPA 4BFUA 3CPEA 1E69A 1SXJD 1LNZA 3AUXA 2O8DB 4BFVA 5GJWC 4BZQA 5JECA 4UXJA 4FIDA 2H92A 1ODFA 4YDHB 3GEIA 5FBQB 2QTHA 2OBNA 3UMSA 1TADA 1CKEA 1S8FA 4GPTA 1NJGA 1PVOA 3B7GA 3RWMB 1OJLA 2PEYA 3PQCA 4GSYA 3U3MA 4UXHA 3R9WA 1C4OA 2GWHA 1N25A 2ZE8A 3LBIA 4CEHB 2C77A 1OIXA 3R7WA 4DLUA 1IM2A 1E2KA 4TMZA 1NG1A 1P3JA 3I1FA 4M53A 5J4VA 3FMPB 3SQXA 2O0HA 1OIWA 2WOOA 2DBYA 4PSAA 2VHTA 3MRSA 3OE7A 1T91A 2GJ8A 1E9AA 1GVNB 1F3OA 4MH0R 1JJVA 4URUR 1L2TA 3VU9B 2REXB 4EPYA 4Q19A 3NBYC 5EE3A 1T8UA 3P32A 4QHTA 1YZUA 1QHSA 8OHMA 4H1UA 2IS1A 5IT5A 2RGCA 1N0UA 4W5WA 4AURA 4EAQA 4KBFA 2JIZD 3SC3A 3WHKA 5JMTA 4ZCLA 2HXSA 3C41J 3D31A 3PEWA 5EXSA 3UANA 1H8ED 2ZRCA 2ZYWX 1U99A 4F4IA 1P7CA 5FL3A 1HV8A 1V43A 1XRJA 1U9IA 1RRPA 1PUIA 5JZVA 1EWQA 5AUPB 3OF5A 3VMFA 4LBYA 1MABA 1DAEA 2YOFA 4Q9IA 4O3MA 4QHYA 2ORVA 3SN6A 4LBZA 1Q1QA 4LPSA 4OKSA 4C0QC 3T34A 5JJLA 1YZLA 4ZO4A 4A92A 2DFNA 2WWXA 1AZSC 2ZR9A 1X8KA 1SQ5A 2WM9B 3P1JA 1W4BA 1M1YE 2OV2A 5FH9A 1SVWA 2W6IA 3IEUA 4UNPA 3SI7A 1L4YA 4FCWA 3X1YA 4URXR 5FTJA 3X2SA 4GP6A 4HB4A 1LB1B 4Q1DA 3R9IA 3T15A 1XTJA 4X8MA 1W4AA 2UZ3A 3SOPA 2J0SA 1CTQA 3AKYA 2KE5A 3ASYA 3KJGA 4IVRA 4MQBA 4NMMA 1P62B 4QGGA 4YONB 5FUVA 3SFZA 3B78A 1KO1A 4PPFA 1H65A 4HZIA 1XTKA 2GVDC 2QRNA 3KKOA 1TU3A 1Z6XA 1ZU5A 2VSFA 1E1QA 4TL9A 2VHJA 5BW8A 4BUJA 1EGAA 2B6HA 2ZRHA 3TRFA 4W7SA 1U8AA 4AKGA 3ND9A 2GKSA 4G01B 2JJ2D 2Z43A 4GI7A 4RCZA 1E79D 4TL6A 1O3YA 1TQ2A 5GJVC 4D80A 1GKYA 1E2PA 1KMQA 1A1VA 1W36B 1M7BA 1U0HC 3TGPA 5J47A 3KQUA 1KJWA 1ZM4A 4B48A 4QM6A 1HQCA 3ADKA 4OJQA 3H2YA 4PZZA 4RFSB 5FI1B 4BFZA 4FMCF 4M0LA 3SS8A 2X77A 1CEEA 2VP2A 1US8B 3AVQA 2PJZA 4AKHA 1NKTA 1R8QA 5AR1A 4M2LA 3U44A 5JS7A 1EK0A 4OI4A 1G8HA 4BFYA 1E99A 1KI4A 4ZV4A 3VKGA 4LPKA 1SVSA 4OI0A 4K81B 5G3ZA 1JAIA 1EFUA 2EW1A 2J7PA 4JLDA 4TLEA 1J90A 2V55B 4A36A 3B9QA 4IEIA 2C9CA 2IYTA 3DM9B 2Z4SA 3JUEA 4PANA 4DLRA 2QROA 1K5DA 2AXNA 4PO9A 2Z6VA 5BN5A 2YNMA 3EPHA 2JJ8A 3BXZA 4QNRA 2P6UA 3WXMA 3RC3A 2VSXA 4LHYA 1I2MA 1T5LA 1CULC 4DEYA 5AK0A 2OUKA 3AVOA 3R9XA 4PZLA 3QKSB 1NMXA 2H17A 2WAXA 1VIYA 1YRAA 2W83A 2ZQ5A 3K0CC 4RZXA 2VQSA 5H1YA 2VSOA 1HYQA 4HUQA 3GJ7A 4ZPXA 3U4QA 1Q1BA 2QAGB 3WYAA 3V00A 3I8SA 1R7RA 5IK2D 3N2IA 2UVQA 4IOJA 1X3SA 3I8XA 5HE8A 4DIDA 1EFRA 2IYYA 1DE0A 2R6AA 2CBZA 2NO1A 3LA6A 1IBRA 3IHLA 3T12A 3THOA 5KPDA 2I1VB 2AXPA 1HEIA 4FD2A 5DSZA 2OLKA 3MWJA 2QP9X 1UBFA 2VRWA 4TZ0A 1Q12A 1TQ4A 1IAQA 5ELXA 2CVHA 4RCYA 2OLJA 3W3ZB 3CNNA 2CJWA 3LDAA 4PC7A 4Q01A 4L9WA 2QAJA 1YR9A 1ZNYA 1AGPA 2X2FA 1M6NA 2BBWA 4EJSB 4M1SA 4TQAA 2VH5R 3TR0A 5JHHB 1CJUC 4UNSA 3FMFA 2RGEA 5BXQC 1P6XA 2DY1A 3ZQJA 1HT1E 5JHGB 2VTKA 4G5RA 4D4LA 3GLIA 2GBLA 2VP5A 2YOGA 3C8UA 3LO5A 2QGZA 1W4RA 4XWAA 2HYIC 4Q00A 1Q21A 3THYA 5CDFE 1XEXA 4TSFD 1NBMA 3GFTA 1M8PA 2F1RA 1E1RA 3WP1B 5C46F 2W0MA 3CH5A 4NYMQ 3RHFA 4PPNA 4ITRC 2WHXA 2F9MA 2FPKA 4XTCS 4B3GA 4EFNA 1K8RA 2F1JA 2AK3A 1UADA 4AWXA 1KNXA 1U9IC 4HB0A 1YR6A 1N0WA 2P6NA 1II0A 1SGWA 1VTKA 1SXJA 2VYFA 2WBLC 4Q7KA 5JEDA 1E9SA 2DPXA 3EZ9A 2ZUDA 4O2RA 4RZUA 4C2UA 5GJCA 2AD1A 2J1LA 1E2GA 3ZS8A 3MJHA 1G4AE 3LBHA 1ZP6A 2BBTA 3TAUA 2IX3A 3U3JA 4MYCA 4ZKDA 4FN5A 2HDNB 4BE7B 1XZQA 3ZLJA 3NDBB 3NBXX 5B2ZA 3MD0A 4YLGA 2NMVA 4AK9A 2OO7A 3BB4A 1FP6A 3BB3A 2IUSA 4BLOA 3L8ZA 3QE0A 1MABB 3L0SA 1T3SA 2EQBA 1IXZA 2QZ4A 4I99A 1XBTA 3GJ8A 5B58C 2PJRA 4ZDWA 1P2UA 4UXIA 3P4XA 1JB1A 1UFQA 2WZQA 3HWSA 4KSBA 1A2BA 1RW4A 5CIQA 2BBSA 2GCOB 4BGDA 4LOAA 4GP7A 5CITA 1BMFD 3BB1A 4U00A 3G5UA 5D3MA 3A1UA 4JYBA 1TQDA 1KO4A 3OEHD 3TJZA 2JIZA 2HT1A 3IBGA 4Q1BA 2ZIAA 5UKDA 5EZ6B 3NKVA 1H8EA 1XTSA 4HLQB 2V54A 4A2WA 2XEXA 2G0TA 1R2QA 2D74A 3H84A 1F5NA 4AYXA 1TF5A 4BRUA 1OYWA 5JLJA 3AF3A 5FOSA 3SDZA 3BH0A 1Z0FA 1F2TA 1W2GA 2KWIA 1W36D 1NY5A 4IDPA 4PTLA 3UWKA 3RWOA 3T1OA 3CIOA 2D62A 1OFIA 4FCVA 5BN4A 3WMEA 1HY3A 1QBKC 5FOUA 3HYRA 2ZI3A 5EP3A 2VL7A 5K8TA 1NLYA 2VIIA 5EE0A 3VR4A 2ZREA 2O8CA 1E0JA 3CO5A 4YDSA 3B5JA 2JEOA 1NNEA 2QBYA 4M9QA 1XPRA 4CEIB 2P5SA 4Q7JB 1FP7A 3L8YA 1XNJA 4PAMA 3L0OA 2DR3A 1KI9A 1N6OA 3FDIA 4G5OA 4DLSA 4ZDJA 5E3HA 3K70D 2ZI9A 1KMHA 3P4YA 5G41A 4WZAE 2JDID 4KYUA 5JRJA 3TSWA 4QJ5A 3OEED 1CRQA 1XP8A 2RHDA 1Z0AA 3M6AA 1NVXQ 4U02A 1OH5A 3QG1A 4GRAA 4OYHA 2FZLA 2R62A 1E6CA 4V02A 2J0UB 1G8FA 3RS2A 3KKQA 2NO7A 2IW3A 1W0KD 3QPUA 4KLNA 2JJ2A 4ZDIA 3DDCA 4JVMA 1E79A 3THXB 4LK2A 1I4TD 1UKYA 1FZQA 4PQFA 1MH1A 2JLVA 1JALA 1PLKA 3HR8A 4HAZA 2QA5A 4A0HA 4HAWA 3Q3JB 1XTIA 2BKUA 1KO8A 3Q5DA 1ZD1A 5LBIA 3IQXA 2ANBA 2WJVA 1M7HA 2GAAA 3CNLA 5KDDA 4HUQB 4QRHA 2F1IA 2ZTSA 1QDEA 4NCKA 4Q21A 5CLLA 3TQCA 1EESA 4R2IA 4LSGA 5CB6A 2D7DA 2D06A 2WOJA 3AVXA 4BLQA 1KI3A 1UDWA 1AS0A 3VHLB 4CGZA 3PUVA 2WKQA 1NIJA 4LYJA 5KDLA 3WNBA 3MSXA 2ZS9A 2FX3A 1UEJA 3MWLA 3W6OA 4QGAA 5FPYA 5A5GA 3ADDA 2HT6A 3AGPA 4S2EA 2AKAB 2HJGA 2PCLA 2J7KA 1EFHA 1JAHA 1II8B 4Z51A 4NP6A 1GRQA 2QPAA 1GP2A 1N0VC 1OF1A 1OKKD 2NO9A 3KTAB 1BKDR 3ZJYA 1HA3A 1KI2A 2WWWA 1Q44A 3KXIA 4Q1AA 2RAPA 4LHWA 3AF0A 3KX2A 3GPLA 2FPMA 2XB4A 2XTNA 2H18A 5FUXA 4D25A 1WXQA 4Z1MD 1G3UA 5IK2A 3GJ3A 3W3AA 1FQKA 4LGMA 4B34A 4XWKA 1NN3A 1K6MA 1XEXB 3A4MA 3A1TA 1ZVQA 2Y8EA 2ZVQX 3NXSA 2WKRA 2GA8A 1U8ZA 5SZKB 3IEVA 2O8DA 2ERYA 2VF7A 1NJFA 2R8RA 2P65A 4IVQA 4C0JA 1IOZA 1KI1A 1Z6TA 3K8YA 3CR7A 3FVQA 5EJEA 5C2JB 4LJ4A 1G4UR 3OAAD 4KODA 3UIEA 1QZXA 4TQ9A 2JAQA 5HKKD 3LFUA 3PENA 3JVUA 2NZ8A 4CEHA 3H1TA 1SXJB 3QPWA 2YKGA 3I72A 5AUNB 3U5ZB 1J99A 5DH9A 4IDHA 1XZPA 1T0JB 3CH4B 2B92A 4PX9A 1ZINA 2OFWA 3B6EA 3U6BA 5DO9A 2W0SA 1WDTA 5BQ5A 4BLTA 3Q5EA 1XPUA 2GK7A 4C9BA 5C4MA 1NG9A 2O5VA 3BH6A 1GUAA 2H8KA 3U7HB 2WKPA 4DDWA 1LS6A 1QHHB 4GZMA 1R10A 3FKSA 3NH9A 4LV8B 2Q3MA 4JZKA 3UKDA 1ZUHA 4BFSA 3VNVA 1SHZA 3DMNA 1TPZA 4GOKA 1QF9A 2RGBA 2FOLA 1UKEA 2BMEA 2G77B 4A15A 3W5IA 2FE4A 5AJYA 3SR0A 3CNOA 2HF9A 1KSFX 1MRNA 1C9KA 1G9XA 5EE9A 3AVWA 4I81A 1DAGA 3DO6A 4F7WA 2WMNB 1CJVC 2Q9BA 5EP2A 3W8NA 5DHFA 3QF4B 3GLIE 1NLFA 2F43A 5D3MB 3SYKA 2FU5C 4M9ZA 4NDZA 3QJYA 5KOYA 1CJMA 4QM7A 1WRBA 1XCMA 4ACBA 3ZIAA 3AEZA 2ZETA 1RRCA 1G17A 1NBME 3A58B 2CHVA 4EQ6A 2P5TB 4DCVA 5L3SA 3CF6R 1XD8A 1W48A 2HEIA 4DLTA 4EIWA 1QHYA 2D2FA 3DKVA 3GP8A 2VP6A 2W58A 4OQLA 4QC2A 1F2TB 1CIPA 1NMZA 2JLQA 4IOLA 1SVMA 1E2JA 1UEIA 3QXHA 2ZE7A 4P33A 4RFVA 3GJ0A 4BQSA 1YKSA 1S96A 3CF2A 1IONA 3LAWA 3TLXA 3BBPA 1T4GA 4MKFA 1TU4A 2IEYA 4RJLA 5FBWB 1SKQA 2VHUA 1BMFA 3RS5A 4Q4JB 1KTVA 1MO3A 3FTQA 3NBFA 4LYFA 1OV4A 3ZQ6A 2ODNA 3OEHA 1CR1A 2GJAA 2QEQA 1IXRC 4D0LB 3KQLA 4C2TA 4CT4B 3GLHB 1KMHB 4L16A 1GITA 1OH7A 2IBMA 2V8OA 2Z5FA 2BVNA 2MSEB 1FMLA 5DI3B 4HZUA 1KSJA 1G8PA 5JJIA 1JXOA 2FFAA 4MGIR 3ADBA 1RYHA 2ZRBA 3BORA 2D4HA 4PC2A 3LVQE 2ZRFA 2AWNA 1RVDA 1OSNA 1P75A 3C16C 4RFSA 5FR1A 1E96A 4DLVA 1DVRA 2EWWA 4MA4A 1R0ZA 1RRGA 3VNUA 2WSMA 3LVRE 5KSZA 2ZR0A 3FYHA 5EXTA 4F1PA 3REFA 2YWGA 2H7VA 3EC1A 2KBFA 4B76A 1R4AA 4EKDA 3BH7A 2NO6A 1G20E 3LLUA 2GXUA 4HAXA 1EXMA 3PUZA 1DAIA 4IOKA 1S4QA 2WIAA 2WWIA 4DCNA 4LZZA 2JDIA 5F9HA 2ZRMA 4TLDA 1OH8A 4AI6A 4LC0A 3OEEA 4NYMR 1YZNA 2WTUA 4JJZA 3B85A 1XMJA 2EVWX 4G5GA 5BYKA 4DB4A 1T0HB 1YR7A 4IOMA 3VX4A 4C0HA 5J4LA 3S1AA 1W0KA 3QKSA 5ANRB 4M4SA 3MWYW 2VPPA 2DFTA 3QIAA 2WJHA 1G1MA 3E5HA 1CJTC 1TUEA 1KY2A 1Z8FA 2BDTA 3AV0B 1OW3B 1TAGA 2WWHA 3KJIA 3W34A 4OK5A 3AP2A 4H1VA 3FMIA 4M9SA 1IJEA 1VCMA 2YWFA 2V1UA 1R6BX 3C14C 3EX7C 1P2SA 2C8VA 2J3EA 2H57A 3SUBA 4PFSA 3KQNA 4D4KA 4KU4A 2GCNA 2IUUA 4HLUC 3ZVLA 2QM8A 3VKWA 1ZRHA 3EPKA 2Q0HA 1CLUA 4TQUS 1GG2A 4MRSA 3I5XA 3T5GA 1E9EA 3KFVA 4DCTA 2K5UA 2BIFA 4JT2A 4A8JB 2J46A 1G6HA 3K09C 1ZIPA 1HH4A 5B30A 3IBYA 2JLSA 4XOIA 5DLQC 4EJSA 4L8GA 2O8FB 1H8HD 3FFBA 2ZSAA 5HE9A 3QY0A 4D26A 4US0R 1DAFA 2XSZD 1CJKC 5EE1A 1U90A 5J4HA 2N42A 4I1SA 3LW7A 5C1BA 5EQTA 4TZ6A 2BEJA 1Q0UA 4QFVA 1OKKA 1IN6A 5KU1A 3W6PA 4WBSA 4EDHA 1U94A 4V0NA 3LWNA 2ASEA 4XSHA 1SKYE 3K9LA 1DAHA 4GZLA 4JKIA 3KQHA 1TEXA 3FFAA 4Z1MA 2LKCA 5G40A 4CRWB 3H0KA 2XGJA 2MMGA 2KSQA 3SJBA 1FTSA 4IDQA 3KXKA 2IYWA 4LX0A 1XB2A 4MRRA 3CWQA 4JJKA 4Q7LA 5FBLB 5JSZA 1KNQA 2QN6A 1VHLA 4WVFA 2RH5A 4LDJA 5FL7D 4MGZR 1KSGA 3WRXC 4B73A 2QSZA 4KV9A 4Q9HA 1G41A 1W2HA 2E1RA 2YOHA 4ACAA 4LBWA 5FFMA 2MSCB 3OAAA 1TUIA 2F1HA 3EIEA 4JS0A 1DAKA 3QVVA 4HDOB 5HKKA 1S3SA 4MRNA 1UAAA 4LBVA 2F43B 3EZ7A 1RE0A 1W0JD 4HUTA 4B35A 2ZSFA 1Z2CA 221PA 2X2EA 2ZJBA 3I73A 1ESNA 4DT1A 4DDUA 1PZNA 4R2HA 2IEZA 5DYGA 2X8AA 3EA5A 4EQ6B 2X1VA 4F4CA 5L3SB 1COWD 2OESA 2R9VA 4TYPA 3AF2A 1DAMA 3BAFA 821PA 3T61A 2E87A 4Q5IA 3X1WA 1OB2A 4JVNA 4OI1A 3FKQA 1Z28A 2GCOA 4Q4AB 1QHIA 4US2R 2OBMA 3N2EA 3A4NA 3QVUA 5JBQA 3IUYA 4WAUA 5CYPA 2V9PA 4DLYA 2ZM5A 4MDFA 3T1TA 4NL4H 1LV7A 2PZEA 1VKJA 2RB4A 2EFGA 2IL1A 4JL6A 1OXTA 4OL0A 1MT0A 4M1TA 4DDVA 3K53A 3U7EB 5EE5B 2NQ2C 5FR2A 1ZD8A 4A82A 3L0PA 4TT3D 2A7QA 1IY2A 1W36C 1OE0A 3WP0A 5CB8A 5DE3A 3DOEA 4Q4LA 2J45A 1KK2A 2XJ9A 2Q21A 2IK8A 4HZUB 4JLNA 3TE6A 5DNYB 1S0UA 3DL0A 4B6FA 3DKPA 1YZQA 1WF3A 4OBEA 4DXAA 2CMKA 2DFKB 4ZIRA 2AR7A 4M21A 1Z07A 2QE7D 4II7A 2YC4C 1CR4A 5EXXA 4YXWD 4CEIA 3TNFA 1NKSA 4FCTA 4LYHA 1Q3HA 1XXHA 2EFDB 2B21A 3UMRA 1DADA 1MV5A 3N70A 2FFHA 4OK3A 1E2QA 1KDRA 1Y63A 3ICQB 3FGNA 1GZSA 3SNHA 1GSIA 4DKXA 4LCBA 3CBQA 4TTPA 1P73A 2XB2A 3HU3A 3DM5A 2XNDD 4BECA 3J81k 1EX7A 5JEEA 5KTYA 2ZUCA 4AG6A 3DEFA 1PV4A 1AJEA 4JIMA 3T1VA 2AK2A 2D7CA 4MYHA 1N6PA 4Z54A 1N2CE 5DN6D 2JLZA 1VYVA 3TUJC 2GEUA 1B0UA 2A3RA 3ADCA 3K70B 3M4YA 2W00A 4D81A 2O8EB 4FXPA 3BFKA 1SULA 2OT3B 3UATA 3KJHA 4UNQA 2J0UA 3BFXA 3B1XA 2OXCA 4JLMA 3DHWC 2YZ2A 4PO8A 1OH6A 3F8TA 3THXA 1OXSC 1T8TA 2QAGC 1ZNWA 2ATVA 3C4JA 1OYYA 3OZXA 2JLWA 1YJ5A 1Q57A 3PV0A 3F5FA 2NPFA 1JEEA 3V4RA 1Z6AA 1AQYA 2IUTA 2N46A 3S1AB 4MDEA 4JMPA 5DISB 1J70A 2H16A 3KB1A 1X1SA 2HUPA 5HTKA 1X8LA 2TMKA 3NIBA 3NHAA 1I2DA 1W4CA 2WJJA 1Z08A 1XMVA 4TWZA 2ZJ5A 3VR2A 4F91B 2CRWA 3ZVNA 2G1KA 3R8FA 4IXNA 1S9HA 2L0XA 3MJRA 1TNDA 3AVPA 4TL7A 3ZVMA 1N6LA 5FOXA 4EJSC 2Z83A 2QPTA 3HR7A 4F38A 5HR5A 1KKMA 3ZH9B 4F93B 2D3WA 4O0MA 4PR0A 4TMWA 4E09A 4E22A 4OQXA 4JLKA 4P4SB 2NOAA 2PZFA 3A8TA 1G5TA 1KI6B 2I4IA 3TH5A 4GT1A 4Q7MB 1II8A 1XCPA 2IYQA 1A4RA 3ZD6A 4OHYA 4C30A 2ORWA 2BJWA 3KTAA 2ZSBA 2P6RA 4HI0E 1E2NA 1E2IA 2FF7A 3PR1A 3QENA 4ASUD 2WAYA 2AX4A 2VO1A 4HB2A 2AFHE 3Q8XB 3OHMA 1ETUA 3CRMA 3CZQA 3FKSD 3UWOA 2EU8A 4DSTA 4IDNA 1VDZA 3HU1A 3BGWA 4DC9A 2ZE5A 3HJNA 5JCPA 4CEJB 1S9DA 4Q18A 5SZIA 4B3DA 1LW7A 4OQMA 4S35A 3VR1A 4L5BA 3WHLA 2QMHA 2BWJA 2QPOA 3ZZUA 2IXGA 2IYSA 1XD2A 3TR5A 3VR3A 2P67A 1ZC4A 3NHBA 3K9NA 3T9KA 3FHOA 1G6OA 1R0YA 3NC0C 1JECA 3VAAA 2OM2A 1P2TA 2WICA 3LW8A 2CK3D 2G88A 3B2EA 5JSZB 1X1RA 3RANA 3ZS9A 4C3ZA 5B57C 1H8HA 3M1IA 4V0MA 4C7OB 1M34E 1BH2A 4D4JA 1RJ9B 3ZIAD 3AKDA 1JPJA 4A6XA 1X86B 2XSZA 3B82A 3TAHA 1K5GA 4R98A 4CYMA 1E98A 5L3VA 2ZI7A 3B1WA 4MITA 1QHHA 1G18A 2CL7X 2ANCA 4QHSA 2EFCB 3BS4A 4ZCMA 2FJUA 4P4UA 1RC8A 4Q9KA 4U7DA 4GMXA 4GMDA 4DT1B 1PLLA 4MKGA 1G21E 2ZEJA 4MGKR 1NVWQ 1ONBA 2GF9A 2OSBA 4GOXA 2ZJ8A 1DCQA 3B1YA 4HDCA 4RY2A 4W9MC 4XSGA 1DG1G 3BD9A 5E4FA 4A2QA 4LJ7A 5H68A 3T35A 3IHWA 1XDBA 1Z0JA 3AP1A 4JLJA 4NE2A 1VCOA 1AM4D 3Q85A 4ARZB 4BASA 2ODEA 5E7MA 1GL9B 1IY1A 3QF4A 3HU2A 1VG0B 1W44A 4Q9JA 5FL7A 5KHOC 1NSTA 2JCSA 3LNCA 5JJKA 1CXZA 4LV5B 3WMFA 4EPTA 3WY9A 4QGFA 4TMTA 4MRPA 2KB0A 2FWRA 2LWIA 4MKIA 4JLAA 1NLZA 2GETA 1HE1C 4TMVA 2BKEA 1CP2A 1OFHA 2PCJA 3GCGA 5DGXA 1Q20A 3QXCA 3I32A 3MUFA 1TQ6A 1W0JA 3BFVA 1DO0A 4A2PA 2R6GA 2GTPA 3EWSA 2ZJAA 1ZCBA 4M22A 4TYNA 3AUYA 3ZGXA 4X8OA 2CLDX 1RIFA 3UG6A 3I92A 1COWA 1YZKA 4JBXA 2XZLA 2OBLA 3NTUA 2FEOA 5FBVB 2H1LA 3GMTA 2J59A 3PCRB 2ZR7A 4YMSA 1DPFA 1KOFA 1WA5A 4KFRA 4ZIRB 4PPQA 5JWHA 3RVBA 4KCGA 4Q4JA 3RAPR 3WBJA 1M7GA 5CK4A 3VKHA 4FMCB 4QBFA 1XXHB 1YQTA 2BCGY 3GLFA 3LQRA 2J87A 1L4UA 3REGA 4PXAA 3PEYA 3GLHA 3SHWA 3EARA 3ZD7A 1J7KA 5DI3A 1C1YA 4KSCA 3GJ4A 4YMUA 3FE2A 4HEJA 3GLGB 1DG3A 4TT3A 2QGNA 3C15C 5IHPA 1VCNA 3SJZA 3SHFA 4E03A 3RS3A 2FNAA 1R8SA 5L8VA 1EX6A 1PLJA 1JQJC 1AN0A 2OFXA 1HURA 1N3BA 1P60A 1GL7A 1YE8A 2XITA 1MO4A 1FNMA 3CKLA 2AFIE 4TLAA 4A4DA 4KI0A 5KSOA 1L8QA 4DCUA 2HXYA 3THWB 3I5YA 4DLZA 5E7JA 1KI8A 3DZ8A 1KJZA 2ORIA 3SJCA 1GAJA 2QE7A 4YXWA 2OCAA 4PHFA 1GDDA 3MMPA 4HATA 2JLRA 2ZYTX 2JA1A 4XD7D 1G7CA 4PHTA 2IYZA 2AD5A 3X1DA 2ZRAA 3TIFA 2Z4RA 4KXFB 3RC8A 4D82A 3RRMA 4N1AA 4KHZA 1XJCA 4B3FX 3MLEA 2XNDA 3QXXA 4C0LA 4B32A 3CF0A 2DHRA 1Q3TA 1OXXK 2ERXA 3NEYA 1GWNA 4Q1CA 3PJRA 5DN6A 2R2AA 2WJYA 4NYIR 2GXAA 3UXMA 4TYYA 4ZDKA 1A7JA 4JLVA 1Z06A 4BZXA 2GBLC 2P3SA 1NIPA 4IDOA 1KHTA 4NZYA 2VA8A 1XXHE 4LY6A 1FNNA 3EAQA 3D3QA 1ZU4A 1IJFA 4PC3A 1SVOA 2YWHA 2QP3A 3VQTA 5JRZA 5DHAA 3A1VA 3TKLA 1FPMA 2QNRA 1Z83A 3LX8A 2RGDA 3ZZ0A 2ZRGA 4NTZA 1XD9A 2CNWD 4ZKEA 4M1KA 4PQYA 4A0GA 2GK6A 3QG5A 4AD8A 3R8CA 5EUQB 1RYFA 2BMDA 4FI3C 4JLPA 2VF8A 5GVSA 1P61B 3Q72A 5B64A 4A8JA 1SXJC 3SYLA 2FFBA 5H70A 3BJIC 2AL7A 2R6CA 5HZKA 2O8FA 2FMXA 1G3MA 2WVJA 3CRRA 3K0EA 2O0KA 4Q02A 3U3KA 1XD2B 1Z47A 1N6NA 1MOZA 2GJKA 1YZGA 2ZJZA 3GD7A 5A4JA 3DMDA 2PX0A 3MWKA 3PUXA 5J5CA 1A82A 4A6PA 2WPDD 4EFLA 1D6JA 1VG8A 1ZMXA 4JLOA 5FPHA 4BPBA 2FG5A 4OHXA 2NIPA 4AC9A 2YYZA 3IQWA 2WSSD 4FW9A 3VFDA 2RHMA 2Q9CA 4Q1EA 3IO5A 2IXFA 2RKOA 1RZ3A 3O47A 4ASUA 2C98A 4IXMA 3U2QA 4XH9B 1DBSA 5FPTA 4N0DA 2QMUA 2QL6A 2C78A 2VHQA 2FSHA 1ZM2A 3HDTA 3IPYA 2ZXUA 3AKEA 4JVSB 1NL3A 3LV8A 5FPSA 3K9GA 4XJXA 4YMTA 2QQEA 5LDDC 3K1JA 3RRNA 4QNMA 1IHUA 4P3YA 4AKIA 2CLCX 4XTRA 2WV9A 3A36A 1EWRA 3LQQA 1OLOA 1KKLA 1O87A 2ZAMA 3Q7PA 3L82B 1G8YA 3B1VA 1UKVY 2GXSA 4B47A 1GM5A 1BOFA 1YVDA 2B7CA 1P4SA 2PLFA 2F3RA 2ZYUX 1UM8A 2EYUA 4Z8XA 1E2FA 4DZZA 2V1XA 5JI2E 4DDTA 2W2TA 2IWRA 2CK3A 3QXJA 1ZUIA 4XVRA 1IQPA 2ZROA 3KXLA 1UBGA 5AJXA 4MUBA 1HE8B 3F3YA 2CHGA 2DWQA 3P26A 2H5EA 1OB5A 3RNLA 4NKRA 2P0EA 4DVGA 1XMIA 3AVUA 2QU8A 4HAVA 4JBYA 3KUCA 1WMSA 4OK6A 3U3OA 2QP4A 4KYIB 4Q4AA 1EG7A 2J0VA 5JWRA 2CVFA 1VMAA 3EZ6A 4I1OA 2F55A 1FX0A 1JEDA 1QVAA 2NG1A 3BE4A 3IIKA 2ATXA 4LYAA 1SXJE 1ZBDA 2JJ1D 1TL7C 2OHFA 3PG5A 3T5DA 3KUDA 3OFND 3PITA 1LTQA 3FHTA 3QNUA 2G1JA 4R7ZA 2B7BA 2AKYA 2QT0A 5P21A 2CCGA 1WBBA 2BV3A 2XXAB 1Z29A 3L0IB 4BFTA 2W6JD 3GLFB 1GL6A 4JL5A 2G9NA 3ASZA 1JR3D 1UBEA 5TV2A 4PO1A 2OCBA 2RCNA 2OG2A 2GZDA 1KAGA 2GJ9A 3D8BA 4JVLA 3GEEA 1N6IA 3CM0A 1DO2A 1TMKA 1OXVA 2NPIA 4FMDF 1XEWY 3RDPA 4GL2A 4BLRA 5LPNA 4TLCA 4YMVA 1XTQA 2BOVA 4Q4HB 2IXEA 1J2JA 2JLYA 3LH5A 2ZI6A 2PMDA 3EXAA 1F6BA 1FW6A 4DJTA 1S3GA 3GJXC 3UPUA 5KSYA 2PT7A 2QUZA 3CW2A 2QRZA 3SYNA 1Z2AA 3RSOA 2VLIA 3OIUA 3SE0A 1GRRA 1OFTA 1KY3A 4QL3A 4JLBA 4RVCA 3KKNA 2DWOA 3SJAA 5JI3E 2O8EA 4URZR 4ZI3A 1G7SA 2XTZA 3LJUX 2BJVA 4OI2A 1KDOA 3PUWA 1GIAA 4NONA 4I4LA 1GOTA 4BLSA 3W90A 4YMWA 3CRQA 1G291 3I4LA 1XJQA 4MGYR 1Z0KA 1ANKA 3W9YA 3AVVA 4LJ5A 4IKEA 3EG5A 4NHOA 1XWIA 5SZHB 1D2MA 2A78A 1JPNA 2PLRA 1MR3F 2ZRKA 3TBKA 2G3YA 1VYTA 2IYUA 2V7QA 3GFPA 2AHOA 1N6RA 1AQUA 3T06B 1OHHD 3GLHE 5LD2C 3E1SA 4QBGB 4CT5A 3B13B 4A8JC 2NTYC 2C04A 2WWYA 4XD7A 3QOFA 1D8TA 4XVQA 4JKYA 3QQ5A 1GRNA 2OWAA 4TTQA 2ECKA 1IN8A 2YINC 2YC2C 1KO7A 2KJQA 4RD6A 1P72A 3LD9A 3K0AB 4XIGS 4DSUA 2XOKD 4IVPA 4WZ6A 4P4SA 1XEWX 2W2VA 1VPLA 3CZPA 1KI6A 4EUNA 1KGDA 4MYUA 1JQLB 4LC1A 5H8WA 2PT5A 2O0JA 4XWOA 2ZU6A 2R6FA 1WQ1R 2OXRA 3SZRA 3LXXA 4Z8YA 3O8RA 4B2PA 4A9AA 5KNDA 1E32A 3NWJA 2QSYA 5HCNA
chains in the Genus database with same CATH superfamily
2VK2A 1KEKA 2NSHA 1BGXT 5IDVA 4GNRA 2FZ4A 4I8XA 5F3WB 1P91A 4HYQA 1OIVA 1M2EA 3K94A 1IYZA 4OQ4A 3I39X 2M1XA 3HNPA 4GI1A 3IBSA 1B6RA 2VP3A 4BGVA 3W2TA 1IZ7A 1FW8A 4HS2A 3WO1A 2I3AA 3T7DA 3TQTA 4Q15A 1QP7A 2WTMA 1OI7A 2HCBA 2WSSA 3R0JA 1T1RA 5KNLA 4OUDA 2RGGA 1IBCA 2P2LA 4DPMA 3WYGA 2OGTA 4PTZA 5FWQA 3NWEA 5LB2A 4ME2A 5DV9A 4OD0A 4HTFB 1VXRA 5T3UA 2H4WA 1FYWA 1DAOA 3GT3A 2QI9C 3H87A 3JYPA 2AFVA 3GZSA 4E1BA 1EUZA 3EQZA 2EGUA 3RU9A 2VJ8A 3TSOA 2CHEA 4HFNA 5EEHA 1NNUA 4YH1A 3QFRA 1NF8A 4J7AA 1T43A 1J8MF 1DTSA 1MB9A 2RBKA 4MW1A 5AICA 4CF7A 5BOSA 3FNRA 4QLAA 4YHHB 3UKRG 2KBEA 4TWBA 4BWYA 4LRWA 3ZNPA 4E6HA 3ZN3A 1JB9A 3IQIX 2BM0A 1HT3A 1TA4A 2YVLA 5DHUA 1BE1A 2HA7A 5F7OA 5KJLA 1H2AS 3DMYA 4BNMA 3QVGB 1XTRA 2PMEA 4BVBA 5HZHA 4P6VF 1Y6GA 5JQGF 3FUXA 2ZTMA 3CZCA 4GCOA 3SSNA 4NATA 4DL9A 1Z5VA 4KQMA 2ZU6B 1U9CA 1R3DA 4NBKA 4IHAA 2QL7A 3P2YA 1NTOA 4AS3A 2NYUA 1X7YA 3K4PA 3ENQA 4G5SA 2YVRA 1JJAA 1U8YA 4WA7A 2YRFA 3HY4A 2G6BA 2ONKA 2G5GX 3AHGA 1J0EA 4F21A 3ZYCA 3V1UA 3V4FA 3DPLR 4WLOA 1WR8A 1KP9A 1CFJA 2R17C 1XZCA 4XQGA 1FF9A 2OM6A 2OKCA 1JS1X 4ZCIA 2ZOSA 4D0NA 2C99A 4XFJA 3MGCA 2AJBA 3IUSA 1GZ5A 1NMSA 1VM6A 2OBFA 3NG1A 3JSXA 3L11A 4GP9A 4X91A 4LKAA 4PCUA 3UB3A 4RDCA 4PN3A 4H7FA 4NBRA 2ZZNA 4ILGA 5BMOA 4IMJB 4UEOA 4BVKA 4RVOA 3MWGA 3WAKA 4JBWA 3AU8A 1JQDA 2EYQA 1OU0A 3IP9A 5JJ5A 1SCNE 5AO9A 4KDEA 4IHJF 2I22A 1EX9A 2R4QA 3N8DA 4S1PA 4DLKA 3RR2A 1VCIA 5HZMA 2CLSA 3EFOA 2R8OA 1YJ8A 4OH1A 5CFNA 1DS6A 4DQVA 1M5RA 4RVSA 2FPUA 1CE8A 3SEZA 2HSWA 4GSKA 3GCXA 3K2EA 4UC0A 4WT7A 1R0BA 4DSNA 2V9CA 3A05A 2BFAA 5HJEA 4OLAA 1W30A 3AK4A 3H6GA 4I9FA 3TVDA 5JASA 2JGJA 4IDGA 3WNDA 3RO3A 5IC6A 1YO6A 3LEWA 3FPSA 2IHZA 4QJ3A 4DBLE 2ONYA 1YDHA 1E2LA 2WV7A 2XGGA 3EGCA 1BJKA 1UF9A 1XR3A 2RHLA 1RFLA 3RUDA 1BXRA 3MGGA 4HDQB 4KXNA 3HMQA 1NJ8A 3C45A 2XUFA 3F49S 3QBVA 4IGKA 4YV7A 1KDTA 2F8MA 1K27A 4XUEA 4FJ2A 1Q1EA 4HN4B 1NXQA 4IFBA 3OTQA 4OB7A 4BNDA 1Q22A 1LFDB 3P2IA 4P31A 3MG9A 2H7YA 3OLQA 1PG5A 2AOWA 4LNAA 1TIPA 1PZHA 4GOLD 2F8LA 1Y3AA 1GDHA 2J0QA 1JNYA 2Y68A 4NCHA 1Z0UA 2ZYDA 2NAFA 3C3KA 5HBGA 3S6JA 4XUCA 5HWSA 3AB7A 1DJQA 3R0IA 3QLVC 2G04A 3K9HA 2PX8A 9LDBA 3KTFA 3CUUA 2XVXA 1NUPA 4NY1A 4TSFA 3FOZA 3Q73A 3MTGA 1V45E 3HWX1 4RSGA 1CNFA 1ZC3A 4RACA 2VYVD 3A6GA 4P4TA 8AT1A 1QG2A 4QUAA 1PGNA 4JOQA 1EP2B 5I5EA 2J5QA 4I7DA 5EEGA 3O2JA 1TT5A 2FFQA 4NFSA 4ZI2A 4FOTA 1MRZA 1LNQA 1P9NA 2C7GA 2GM3A 5K2OA 1KC1A 2N75A 5DGIA 3FHCB 2YHEA 2LP4Y 3IQFA 3A6LA 3DCNA 3ONVA 2YV5A 2OGUA 4WNFA 3UMBA 2O8CB 1GUFA 3LC2O 1VA5A 1HUQA 2IT1A 3KEFA 3ZNNA 1UXKA 2FSIA 1D1QA 1W49A 1RYNA 4YRIA 1Q91A 3D2LA 5CEDB 1XGWA 1L8AA 3D6TB 1C3JA 3OTNA 4UHHA 1SIBE 4OFZA 4DJAA 1YK0A 2DYKA 1QQ5A 4D8TA 3RU7A 1U4OA 5L45A 1FUUA 1BXGB 4PRYA 1ECFA 5EP4A 1KK0A 4DAOA 3DMHA 5CXXA 3QWWA 2IOQA 2XH8A 1TEHA 3BE8A 4CDMA 4RK6A 5KPJA 4TRQA 1XKLA 2Q6VA 4GNKA 1BW9B 4FHJA 5GV7A 4D44A 1AB5A 3PNQA 1J00A 4ZREA 5JXWA 3VU0A 3ZBUA 2GDJA 2GPNA 4BRWA 1Z6GA 3ZE1B 4MRVA 1RKUA 4EUHA 1MEEA 1NBMD 3AB8A 1JYEA 3ZKAA 2QJRA 3MTEA 2D8UA 2IZ6A 1FRQA 1AZTA 1X7GA 3HRHA 4BFUA 3GHHA 1QWOA 1XNGA 4Z7OB 1HDXA 2FPRA 3L6EA 3VGPA 4GPTA 1Z4OA 1M1YB 4WXYB 1BRMA 1U0EA 2ZE8A 5SYAA 2GTIA 3HUUA 5ELMA 1W2WB 1JJVA 1WILA 1PVDA 1A9OA 2P75A 4Z4QA 3UM9A 3TPFA 3P32A 1OWOA 2DX8A 1W8DA 4E5KA 1EXVA 3IT0A 4TWAA 4W6QA 2IPMA 3KTDA 4ENSA 5GZ3A 1MABA 1DAEA 3U4HA 1H0AA 3WE7A 2QN1A 1OUVA 3A4TA 4JI8B 5COBA 4FCWA 5IVIA 4DUYB 4X8MA 3NHSA 4YONB 4JC4A 1H65A 5M72A 2YRXA 1XTKA 3ORFA 4NN2A 4QQFA 4DLPA 4D45A 5JVDA 3VSDA 4L75A 1E79D 3NDRA 5IHXA 4ERXA 3RJVA 1XTZA 4Y2TA 3ADKA 3F67A 3IAM1 4DMMA 4MQFB 4OXIA 3O90A 3OZFA 3W5VA 4RVUA 5DP1A 3FSGD 4BFCA 1B00A 4G2VA 1IUNA 2J7PA 2IYTA 3ICOA 5I4BA 2JJ8A 2VSXA 3G9XA 3CVWA 2WZDA 4PZLA 2GW1A 1R50A 1DBQA 2VDLB 4RZXA 2G72A 2VSOA 4ZPXA 3WGJA 4L2IA 3TZEA 1ZUD1 3N2IA 4K6FA 5FV4A 1IUPA 1IPFA 2QW8A 5EG5A 2I1VB 1YS7A 2OLKA 1TTPB 1S02A 2FXVA 3DMGA 1IAQA 1DDOA 4MKXA 4L9WA 4F3YA 5JHHB 3LRQA 1JIVA 1GGNA 4D4LA 5LMUB 3TWRA 1FS5A 1QZTA 5BNIA 4RGYA 4IUDS 4A8HA 2F1RA 1KU0A 1HH8A 3M63A 2FPKA 2Y1LA 1K8RA 3TLBA 3ZC3A 1Y48E 3VDMA 5FO0A 3VXKA 1N0WA 1II0A 5B1YA 1DQNA 2HLPA 4FYHA 4OLBA 2VHZA 4O2RA 3RUPA 3BWEA 4UUPA 3GIDA 3FU5A 1WVGA 4YLGA 3SYTA 3ZV6A 4L72A 4YIHA 4QDTA 3ND5A 3WX0A 1YOVB 2UUOA 1I2CA 4NMHA 2H4HA 3AR3A 3NAZA 1Y4AE 2R1TB 2OR3A 3IJ5A 2Q2VA 5HOEA 2L9BA 1WULS 1VLHA 3MUNA 4BVEA 4MIEA 4UZEA 1U2DA 2O20A 4NENA 5MN5A 3OTWA 3EZNA 1TKBA 5J59A 1DXYA 1QGED 3UM3A 1IE3A 1YBAA 2ZI3A 3Q75A 3N3AC 3II6X 3BVPA 4I55B 1NNEA 4MW5A 5EMHA 5DBHX 3RTCA 3FDIA 3ZYMA 3P4YA 4CM8A 4JQZA 3C3RA 2JDID 4UULA 1RXVA 3TZQA 5D1NA 2ZIWB 3NBQA 2WILA 1QZUA 2EKBA 3RYCA 5JCOA 3ZJVA 3X1KA 1GPAA 3OT5A 2UZ0A 4ZYUA 3NT5A 3U7JA 5DF1A 3TQCA 5AVOA 4QYIA 5GM2A 5DASA 4RMJA 1NIJA 5GGXA 3IBTA 5JO9A 1QSGA 4NCXA 1Z2EA 1NSYA 3AGPA 5D84A 1GGFA 2PZKA 3PA6A 4RVFA 4LHWA 2VJQA 5EX0A 3ASUA 3PTZA 1T2NA 4F3NA 3JZFA 1RI5A 4QSHA 5IK2A 1BFKA 1FQKA 5CFMA 4INZA 5EMMA 5C8YA 2VF7A 1CUZA 1FQOA 1FDVA 1G4UR 1QZXA 3WNVA 3QPWA 2YKGA 4DLLA 2CJPA 2FW1A 2Q8PA 3DV2A 5BQ5A 3RGGA 1HLGA 3BGSA 4C9BA 2ZWMA 1HPLA 2ZCUA 1SQSA 1WG8A 4XKBA 2CG3A 3R3JA 2PKEA 4JWKA 3I9V1 3ZU7B 2JARA 4DWVA 1S2NA 2E4UA 1W6UA 3N3BC 1IIBA 1G9XA 3GG2A 3JPWA 3Q9SA 3RFXA 1HK7A 1B1AA 1RRCA 3DKRA 1W48A 4Z9YA 4CMJA 2G1PA 4LQCA 4JGIA 1RXIA 5AW3A 4CL3A 1O2DA 3GJ0A 2C7OA 5SY4A 3I1IA 3RUHA 2CHXA 3LAWA 3DV9A 5HUJA 3DAYA 5EY5B 3PL1A 1T9AA 3FTQA 1OV4A 2VZ9A 2SCUB 1FTGA 4CT4B 2Z5FA 5IUNC 3RPEA 5JJIA 5KB3A 1PZGA 4UTOA 1N5RA 4K03A 4G1MB 4RFSA 4XASA 3K92A 4BNVA 4UUBA 2ZK7A 3URKA 1E20A 1U6KA 2YWGA 1BXZA 5LJLA 3B7SA 3AF5A 4W99A 4FBLA 3IMGA 1CZHA 2C83A 3RSHA 3D9OA 4UBMA 1QRUA 2BD0A 2IHKA 1TFRA 2DFTA 3RSCA 4TM8A 2P9NG 1KEUA 3SIPA 1VCMA 2H57A 1WW3A 1BCSB 4P7GA 3EPKA 3S8MA 2MRIA 5HA5A 4TQUS 4DCTA 4BO1A 1YRWA 1U0RA 2CUZA 3DZFA 3I6IA 1YQQA 4UP5A 1IATA 2CLEB 5DHTA 1BDJA 5CNJA 2MD8C 3GEGA 5K3QA 4CKBB 4U3JB 2CLFB 3K9LA 1R0RE 4WNCA 2LKCA 4QQRA 2ODAA 4RMGA 4JB8A 4ZD6A 4GTPA 2WQ7A 1XB2A 5JSZA 1VHLA 1L8LA 4L0DA 2HLHA 4Q9HA 5DMXA 2VUIB 4N7BA 3OAAA 2EKZA 2I54A 4HDOB 4EHNA 3VLFA 1C4XA 3MFQA 2FZVA 3EZ7A 1JLRA 3H04A 1K86A 4I4NA 2C97A 4UAUA 4WMLA 2R9VA 4FWBA 1QUEA 3T61A 4OI1A 3PFFA 3OZEA 2GCOA 1U2PA 4TX1A 3CJQA 2G17A 6PFKA 2RB4A 1PJBA 2FFWA 4B0PA 4BFLA 4J0UA 2QQGA 3IA7A 3CHYA 3PNPA 2AI1A 2I29A 3KUXA 4CHGA 2ZSKA 3KEZA 3B1JA 4JEUA 2BKAA 5DWDA 4KQWA 1AKMA 4JQCA 1REQB 5EXXA 3T5AA 4FCTA 3LGXA 3OCJA 4RS3A 1NNI1 3NHYA 2GT1A 4K1XA 4B79A 3L5KA 4JIMA 1H66A 2EINE 1YXMA 1VYVA 4DMLA 3K70B 4F12A 4AG3A 4FADA 2FPIB 4QTTB 4CTOA 5KKCA 2IUTA 1I4OA 1ZPDA 1Z4QA 2MHCA 4X65B 4IXNA 1UFKA 3PRYA 5HIMA 3TOVA 1Y1SA 1Y33E 1KKMA 4Z4IA 4BIMA 5BXUA 3PCTA 1GGVA 4L76A 3ZD6A 1OT8A 4JY7A 4YYZA 5ITZA 1XL0A 2BFCA 4O4IF 2FF7A 3VZDA 3CKBA 1WIMA 3JQRA 3OHMA 5BV7A 7REQB 3DE3X 1RXUA 3OKFA 1P5HA 3A3KA 1N9GB 1CYEA 3QVOA 5IM4A 2OV4A 1TUGA 3WGGA 1R0YA 1XRLA 2CK3D 5J9FA 1X9GA 1BQ4A 4CCSA 1BH2A 5E3JA 3WGVA 3GCWA 1WMDA 1QHHA 3W77A 2FJUA 3UA3A 1GU7A 4U4AA 2ZEJA 4E33A 4JGGA 4XSGA 1DBVO 4HNSA 2L7PA 3WOVA 5H68A 5DGTA 5LR6A 4DCOA 3KLMX 1FSFA 1BPOA 2WQHA 2YXLA 4XPZA 3B5IA 4MRPA 2C3YA 2KB0A 3RIHA 3VTAA 2ZTVA 1JSLA 2EZ8A 2PCJA 5DGXA 1W0JA 1SRQA 3EUEA 3W9SA 3UHPA 2PA3A 2XZLA 2IDMA 1ECLA 4JD5A 1PL7A 3LX4A 2EODA 4ANUA 3RAPR 3QOYA 3LLSA 2OXEA 3SHWA 1MG5A 2AE1A 2PZAA 4LECA 1L9XA 4GKAA 3OPYI 5HNKA 3U48A 2P9TA 6REQB 3OJEA 2AR0A 3IODA 2OCXA 3PC3A 4QXPA 3TPCA 2QSJA 2AOVA 4KE6A 2Q4RA 3VOAA 4DLZA 1NX9A 2OZPA 4LF9B 4UEJA 1B8NA 3ZGVA 2WKSA 2XNDA 4ZMSA 1NAIA 3CF4A 3PJRA 5DN6A 4JLVA 5CUQA 4LTNA 3MRTA 5DNUA 2OVBA 1I2BA 5H81A 1PR3A 3D3QA 4H7EA 5CBOA 3WVNA 2FRDA 3ZZ0A 1RKXA 3LK6A 2FWIA 1WLSA 1CUEA 3V8NA 4YUXA 4I1RA 3S0JA 2R00A 1P3Y1 4U39A 1D4OA 1G3MA 3K0EA 4R7LA 3DH0A 1MQSA 4R3WA 4NFHA 1WEPA 2NLOA 4H6VA 4FW9A 2RHMA 2X6FA 1M1XB 4IYPA 3HDTA 3VAYA 1PQ4A 3QUAA 4JI4B 5F2OA 4P3YA 2WV9A 2I6QA 3Q7PA 5IEBA 5CFPA 2PLFA 2F3RA 2ZYUX 1E2FA 1GKLA 3JQ1A 2W2TA 1XL1A 3EC7A 2WABA 3Q6MA 2QD1A 3RI3A 1IC6A 3G85A 1OB5A 1DC6A 4C21A 1J2YA 3UENA 2J5KA 1J1IA 1YF3A 1H2YA 2I6UA 3HP4A 4RY0A 3T3DA 3AONB 3PGA1 1HI9A 1SXJE 1Z2PX 2CB9A 1RWNA 1RHMA 4NNJA 4LTMA 5E0KB 4EVQA 4N5QA 3ASZA 1P7WA 4F3TA 1HGXA 5TV2A 4PO1A 3TX6A 1NI5A 3FNHA 1UMDB 4MR7A 2IELA 1J2JA 4U63A 1E8XA 5EJMA 3CVNA 1OFTA 1ELRA 3IXMA 3K1YA 4PF1A 3HLTA 4L8FA 2OK7A 3EVBA 2CBXA 3KQPA 5CFOA 3PUWA 3FVWA 2BLNA 3L7DA 3JQGB 1E7WA 3AVVA 2KREA 5JS2A 4HVLA 1DRKA 1ZVJA 1C8KA 3SKXA 1LBEA 4FJYA 1JEYA 5LD2C 3WB9A 1OFVA 4B4OA 1SG6A 1FYEA 1P44A 1G9SA 2FEPA 4DM3A 4HQ0A 4J4BA 3BK1A 2HDOA 2XMSA 4AFNA 3AG3E 4DOMA 4B2PA 1E66A 4JLUA 4EPRA 3L7YA 1CZKA 4N3NA 4RELA 2Q28A 2YT5A 2WUGA 2P9GA 4JJFA 2ZSUA 4B6EA 3GDGA 2B99A 1EVLA 1IU9A 4U7JA 4HLCA 2R8PA 3C1TA 3DTVA 1OCRE 4I1PA 3T94A 1JX6A 4S2UA 4ZAWA 2XB9A 4RUKA 3HPQA 1RJ9A 2QUBA 4FYKA 1WSBA 3VHXA 4D4HA 5LIPA 4QXMA 4GVPA 3NBAA 4F84A 3C7CB 3K05A 4RMNA 1WZIA 3LXUX 1DWPA 1M2OA 5K99A 1K2VN 3BG5A 3E37A 5JALA 3O7AA 2YMLA 2PZGA 3RVDA 3CZ4A 3FP3A 2VT7A 1E9BA 2A4MA 5ALMA 4DUGD 4RYDA 3KJEA 3A2KA 1C5KA 2XMZA 2EFEB 4G0WA 1ELKA 1F2UB 1VP9A 4LHXA 2CB0A 3SSAA 1X70A 3O83A 1EGQA 3K70C 3FOAA 4J0QA 4LVCA 4U6SA 2PT6A 5KS2A 3DJFA 2NAAA 3R9AB 3U64A 2HW8A 3QUSA 1QVRA 1T5HX 5I9SA 4LRUA 5C1DA 5LLDA 1IXVA 4MV0A 4AY4A 4YAKA 2PU5A 1L4KA 2DTEA 3PQ7A 2B4RO 3KHKA 1Z37A 1A5TA 1NV9A 4ERNA 1FEZA 1JQAA 3OM9A 4HSEA 2LXLA 5K3AA 2J9GA 3SIWA 3PQ6A 4G3XA 2W71A 1NT4A 5CMLA 3BPSA 4UHBA 1Z5PA 1ENPA 3BIOA 4B0ZA 4D3DA 2XMCA 2D2EA 1ZRMA 3AM1A 1YYHA 3A9SA 1MO5A 3R5XA 2BT4A 3UJNA 4JHXA 2L75A 3FWZA 1U2RA 5HF8A 1YGPA 4U0UA 4Z4EA 3D6AA 1WX1A 1NVMB 3W6NA 1CHDA 3HBMA 2EG5A 5THQA 4Q93A 2X4DA 4RBNA 2X6IA 3NORA 3NCHA 4L5CA 5I51A 3Q40A 2QWXA 3KQKA 5GMOA 1U1IA 2JIQA 4DBLC 1PDOA 3GJYA 3L16A 4IIJB 1DX6A 4URFA 3IPXA 1RYBA 4NMWA 2WQ6A 4BNZA 2O3SA 3A70A 2JRCA 3OZBA 4KOAA 1YR1A 1XU9A 4NJEA 1VHTA 4MXDA 3H2BA 3HADA 5FTWA 2B4YA 4LERA 3A2NA 4H7KA 1ZYUA 3A1SA 1AMOA 2DVMA 1UW4B 2IHBA 4NYJQ 4OREX 1GXSB 3CVVA 5B1EA 2FDXA 5JOQA 1WU7A 4AIFA 5KYXB 4FP9A 5IAKA 3DB2A 4AZWA 1F06A 1DBPA 4CR7A 1YB5A 1XEAA 2P9JA 3IPLA 3MFYA 5JO0A 2Q1TA 3C5HA 3ASOE 1HZ4A 1VHDA 1UZUA 4MHSA 2OYSA 5TXGA 1F2VA 4CXMA 4CQMA 2PIAA 2EJUA 1RIIA 3R9XB 2P9CA 4RFLA 4B75A 3R1IA 2FW7A 3HKEB 4BIIA 1X8JA 2AUMA 2KLBA 2ZYGA 3K0HA 2P79A 5C18A 4GZ6A 4CTMA 3WGYA 2IKQA 4A3SA 1FSZA 4CDGA 3UUGA 4MW9A 4YJ2F 3SLGA 3FTSA 2QY9A 4LYGA 3LUKA 2X6KA 2O1SA 2Y99A 4X93A 5BWBA 4IH1A 3MJDA 4R0VA 1F7VA 3PPYA 4FWIB 1AX9A 4UUAA 2DJ5A 2XTMA 1W9MA 3LZCA 1TN6A 3ZWKA 1NN5A 4A1FA 4UKDA 4ZCTA 1Z2OX 4ILIA 4G0UA 2PO5A 4QYSA 3IUJA 4MKHA 4KIJA 2GK3A 2ZISA 4UBJA 3IMCA 2I3DA 2DF8A 4LXIA 3RVNA 2CXNA 2YZNA 4DGQA 3KR0A 3VHRA 3HK2A 1QBGA 2GKGA 3F3SA 1JWBB 3DE6X 2OO3A 3KEOA 2FGJA 1HT2E 4A7PA 1DQPA 2PUWA 4LI3X 1B93A 4OKIA 1QYMA 1PTJC 1N5JA 1A96A 5DKFA 4B7UA 1X7HA 2C58A 2ZXEA 3N74A 4W5JA 2IS6A 1WZCA 4F71A 3CLSC 1S0PA 3TMKA 4BNJA 5BV0A 2LXHC 2NSLA 3AUKA 3TRHA 2QBYB 3IMEA 4RD0A 3ZWVA 4DJ5X 1BKSB 3V2UA 1X7ZB 4YPOA 1E60A 4C5CA 4UFPA 4L4UA 4QQNA 1VPEA 4LN1A 2B6NA 2YXEA 5LYJA 1CUJA 5KSPA 1MKYA 4IJQA 1LLFA 3EW9A 4J7XA 2VG8A 4B80A 1EE1A 3PDIB 5DHRA 5NULA 3EB6A 1QV9A 2GPWA 3LVBA 5H9MA 2JI9A 4KK4A 1ZM3A 3SO8A 2V6MA 1IVYA 4ESVA 1UK9A 4LZAA 3U6KA 1K75A 3VJLA 1XZ8A 3SY8A 1II9A 4J3JA 5A0FA 2C2GA 3KETA 1YZTA 2Q9AA 4CV2A 1DWUA 4KFSA 2GEVA 4P7KA 2X3MA 1EZ1A 2P9SG 3IEGA 3E2PA 1H1TA 2A9FA 1T0PA 3D7KA 1KMCA 1PVOA 1CKEA 1UG3A 2A86A 4R16A 3RJMA 3IKMB 2C77A 2CN1A 1E2KA 3INTA 3I1FA 3T7LA 4XE0A 2ATEA 1DJOA 3HABA 2DBYA 5HKOA 1JG6A 3OQVA 1EYHA 1FCJA 2VT6A 3KQOA 4BYMA 2J6CA 4H1UA 4PAGA 3N53A 4CL2A 3G8YA 3LVFO 1TA0A 1U7PA 3UANA 3HU5A 4LZLA 3AHHA 5FL3A 1YACA 4MTCA 3D9HA 4Y6SA 4AP4A 4V3KC 2QICA 2XIJA 2YOFA 1TLTA 3ML1A 2QTVA 1V7PC 3VR4D 3ZU6A 4AP9A 1GQRA 1M1YE 3IOEA 2QL9A 2ILTA 1E90A 1LDMA 2VYVA 1LX6A 3H0EA 3SOPA 3VU3A 3D59A 3KJGA 4NMMA 1G4HA 5ALHA 4MLCA 4ZFHA 3KKOA 3UPTA 3JR7A 5LA6A 4X9XA 4G01B 2HPAA 4NFLA 1NAHA 1TM2A 4JI2B 5CBPB 5J47A 1EFKA 3H2YA 2GD6A 4BFZA 4B83A 4HOUA 3LHIA 3SZ7A 3A7DA 3U44A 4E15A 5DCLA 1NVAA 1Y3DE 1WZ2A 3U5MA 3HDQA 1CJCA 4Z3KA 5CFLA 2PGAA 3REOA 2PRKA 1A3CA 3G9UA 3TSYA 2R751 2VTBB 1C7ZA 1U65A 2VQSA 3EAFA 3I34X 5ICGA 1RI1A 2Q4EA 4FTWA 2H1FA 3D5EA 2XDYA 4IOJA 4BP9A 4ES6A 1DE0A 4O29A 5CFZA 1ZCZA 4QWWA 3TVYA 3HDYA 3LKVA 1ZZGA 2IEJA 4Q3AA 4KR9A 1Q12A 3I9OA 4MEJA 4PRKA 4R8RA 3E9RA 1MXFA 4EKEA 1QOZA 1HT1E 1RYYA 2VTKA 4GXQA 2AB0A 4XWAA 3NS7A 4Q00A 3L77A 1NBMA 3UKUG 3CH5A 1THTA 3GPIA 5C7LO 4P0QB 2FEXA 4DABA 1QGZA 1X9IA 2IDJA 3E6AA 1WOYA 2HRZA 1ZP6A 4MRMB 4FN5A 4B8WA 3HCOA 3A1NA 2NMVA 4AK9A 2OO7A 3BB3A 1L9KA 1HDEA 1Y42X 1IXZA 3KLNA 3MUOA 4KO2S 2KGIA 2LAIA 2E6SA 5CIQA 4JUBA 3ZYLA 2HMVA 4B7ZA 2XEXA 3PX3A 1TK9A 4QQIA 1Z15A 1TM3E 3CX4A 1NY5A 1KQOA 3AJEA 3NATA 3BA6A 1M6VB 1A88A 3WDSA 3HYRA 2VIIA 3TW8A 4AN0A 5ARFA 2I55A 3FVTA 5A05A 4Q7JB 3L8YA 5HM6A 4XDGA 5F5XA 2XBLA 1SG9A 1XP8A 5HKBA 1JU3A 1E6CA 3A0RB 1JUDA 3LS8A 2C9DA 1E79A 1X0XA 4DPRA 5BR7A 3DAPA 2X0DA 1JALA 3OG9A 4EMTA 5FNZA 2QA5A 5EAIA 4B45A 4MAMA 3NZEA 1M7HA 2AXEA 1NDUA 2F00A 4E2XA 1NF2A 2F1IA 4UUOA 3HUTA 2D7DA 1ISIA 1FYVA 2D06A 3Q5MA 3B38A 3FSGA 3L9TA 4V0RA 1ZW1A 3ZV3A 5KDLA 5KAMA 1H4TA 3AUTA 2IZ5A 1MBZA 4R54A 2C5BA 4IJ6A 2EJTA 2J7KA 3KOOA 1L4EA 1UJ6A 3ED1A 1WXHA 1TYEB 1RWXA 1AB6A 1EB9A 2H5LA 2C8KA 1BHSA 2GRRB 2N0SA 3WLJA 2BJHA 4B7CA 1IOZA 1MHPA 1VL8A 2IPAB 1FXWF 4CF6A 4EZBA 4KODA 4CM1A 2DKFA 3JRWA 4IIBA 1SXJB 1XYYA 5AUNB 4CPDA 3F2IA 4UE6A 2H9YA 5K4HA 5EJ6A 3U6BA 2DPMA 2XWSA 4YJFA 1K7CA 1K3UB 4JZKA 2JIPA 3W5BA 3NYRA 2P0YA 3NAGA 4A15A 1DGQA 4E5YA 1POWA 1CJVC 3BMCA 2EAUA 3SYKA 5DTQA 3GLVA 3MINB 1Z6UA 2A35A 3MQ2A 1KY5A 3LJNA 3S2SA 2VP6A 2W58A 2CV1A 4QO8A 2ZE7A 5D6OA 1YKSA 2D0PB 5IAOA 3AR8A 2OC4A 3BM5A 2Q5LA 4PBRA 3BQOA 4QUHA 1CK4A 4D0LB 3TFQA 3EOAI 2V8OA 3VVCA 3H65A 3RNOA 1SZJG 2X5KO 4D5EA 3C16C 1E96A 2QI9F 1RRGA 3OMXA 3HI4A 2ZIXA 3EQ2A 1R4AA 2PJDA 1V1MA 4RW0A 1JOCA 2AFHA 2WP8J 4HOQA 5SY9A 4LZZA 2JDIA 1YZNA 2QTAA 5JXHA 1P8JA 3ZQ4A 4UZFA 1URPA 2X4GA 4OB6A 1F62A 1Q11A 1KY2A 1Z8FA 3WRWA 5J3JA 3FSRA 1PD0A 5C2YA 1P2SA 2J3EA 1WP4A 4LF7B 2JANA 4OUKX 3GX1A 1JHDA 2Z2YA 4MRSA 3U19A 4XI9A 3IB3A 4N0PA 3ZNIA 4RKQA 4UWFA 2QX4A 4XOIA 1HU3A 2G8LA 3N07A 1LDBA 2BELA 4ZCSA 2PH5A 2GASA 1O96B 4L85A 2PKQP 1UWLA 1Z5WA 1RQ2A 2KYRA 2W2NA 3LECA 1ULSA 4X1YB 2QDKA 3RBXA 1YUMA 4NJMB 3LPAA 4OAOA 1Z8HA 5CRUA 2I66A 4UQPA 4FFWA 4EARA 2YOHA 3R6DA 3QVVA 1EKXA 5SV2A 4MRNA 4HVTA 3C5VA 4LJLA 1V3QE 1YRHA 1PZNA 3I2KA 5LC1A 3EUVA 3GROA 2Z3ZA 4FONA 2OESA 1ID1A 5D87A 3ZHTA 3HXFA 2JFBA 3X1WA 5IC5A 4TUYA 1QHIA 4YO8A 4RU1A 1O5IA 4QRDA 1YBVA 4EWLA 5FORA 1LV7A 4UTPA 5KH3A 1OXTA 3GGCA 4OL0A 3S70A 1QLJA 4E7OA 4LNGA 4WVLA 2GEJA 5K05A 4ECAA 3RT1A 2IK8A 4H3KB 4B6FA 3ITDA 3UHJA 3KSRA 3RVLA 2I1KA 3COVA 4YXWD 2XPYA 4M8KA 1TJPB 3LK7A 1NYQA 4TXHA 3ZWOA 2GN8A 4NS4A 2Z09A 3LUFA 5KTYA 3QE2A 4IIVA 1AJEA 4ZICA 4D81A 4EUSA 3UATA 3BXOA 2H07A 1U4SA 1JEEA 2UUCB 1QB7A 1FLAA 4ZU6X 1Y5MA 3SOXA 3GT7A 4AIRA 3I9NA 2OCCE 2L0XA 2C3UA 3MJRA 1SA4A 1ZLXA 1O1TA 4F93B 3AUFA 1W5AA 2I4IA 3TH5A 5JNSA 2V0PA 3KTAA 3U0BA 4NI5A 2WAYA 2VO1A 4L6IA 2R1UA 5FB3A 1VDZA 3JQ8B 4FGZA 1S9DA 4YJ3F 2I99A 5A3QA 3QHQA 1FRNA 3NBUA 2H54A 4GX1A 1PHPA 4Y6OA 1B2LA 1I24A 4OJNA 3T1YB 1A5EA 4UFOA 4FSDA 4V0MA 1MPXA 3TIIA 4IN3B 2HH9A 2DP4E 4R98A 2ZI7A 2WB2A 3AFNA 5CB4A 2HREA 4L8YA 3L82A 4GOXA 4BLVA 1GARA 4KIWA 1AM4D 4MWSA 1JW9B 1DEHA 2BZ1A 4Q9JA 1OWNA 2D0OB 2RBEA 4TMTA 4ND3A 2JH3A 5KYYB 4Z0OA 4OYRA 5LMZA 1FNBA 4QXOA 3KSDO 1ZKMA 4TV8F 1J6UA 3H16A 1KR5A 4OXRA 2YQ4A 3RSZA 3GMTA 3Q7AA 5GWXA 4KFRA 1I6MA 4GYKA 2H5IA 4DG8A 3VKHA 1QGYA 1WY5A 2J87A 5KTNA 4O1HA 3RW9A 3DLHA 3GELA 2J33A 1YVUA 8MHTA 3P9YA 2J9FB 3CQCB 4O3FA 4I5GA 3BE6A 2IPNA 4LZWA 5HFAA 1RHKA 3HO1A 2QTRA 3LFTA 4GW3A 1QCCA 2YX1A 4KSYA 2ZRAA 1HNNA 2DHRA 3ZOZA 4KXKB 5EJIA 4NYIR 3R3UA 2RSLA 3E5MA 1LEHA 1BN7A 3P2EA 4E11A 2WP0A 2P9HA 3PIDA 3HXCA 3S1LA 5DHAA 3PS6A 3RE1A 1N5OX 4X7MA 3PI7A 2X23A 3P2MA 1SXJC 3BDIA 4YJGA 3INRA 4LG1A 3U3KA 1Z47A 1AU9A 5A4JA 2VJLA 1NRWA 2WUWE 3OQBA 2JAPA 5F64A 3DXFA 5A04A 2YW9A 4BB5A 3DBLA 1U11A 2YXPX 4EW1A 1SOVA 5HW0A 4KN6A 3DYBA 5IBPA 1V9LA 3RRNA 5AQ7A 3WJ1A 3B6MA 3A36A 3M9WA 1ZR2A 3MXTA 2GXSA 3QWFA 2DBAA 1Q84A 3ZWDA 3H2ZA 3TWOA 5M2QA 2CK3A 3JQQA 1TNZA 4GNGA 1HE8B 1G5FA 2CZQA 4ZEWA 2WVHA 2H6EA 1L5OA 5FTPA 1ORRA 4KYIB 2BFWA 5FBKA 4ND1A 4RHCA 2HO1A 1LTQA 1TJFA 4BX8A 2B83A 2J31A 2NU9B 5ETJA 1WBBA 3PQ5A 4JL5A 3H8SA 1XRNA 1MX2A 3L46A 3SBSA 4MINA 4XUGB 4HGPA 4GL2A 4KYOB 4ONEA 3OHSX 4RF2A 2BOVA 3ULQA 5A03A 1YC5A 4EHMA 4OXQA 4K6HA 1TN7A 3U39A 2PT7A 1MQ8B 3DDNA 4NZOA 1M8JA 2JMIA 1F4VA 4QL3A 2GPBA 4CG3A 4G0OA 1GA6A 1F8FA 1Y6FA 2A5EA 3UJ8A 5LQAA 2DRIA 3FOBA 4RVNA 2A78A 1JPNA 4ZQHA 1HSOA 2PZ8A 4OA5A 4GEGA 1KHHA 4ZT7A 4B31A 4FEYA 1MQ9A 1PFVA 2NV6A 1DPGA 3B13B 3PE6A 2J4DA 1C30B 1H69A 4REOA 1GRNA 1DFGA 1WDWB 3ONEA 4RD6A 3R7AA 4XKCA 2V9ZA 2W6NA 3CSDA 1JNXX 2VCYA 2Q2WA 2VWHA 4EUNA 5T67A 1YMVA 1JQLB 3P19A 2PT5A 2O0JA 3LKZA 2V7PA 3OM1A 2O0MA 5CD1A 1QHFA 3EZFA 1CZUA 4DY4A 1SO8A 2QMOA 3RRZA 2MSWA 5DEOA 1A7KA 5BR8B 3PXCX 1WUTA 4YT4A 4HN9A 3AF4A 4EMBA 4H7HA 5L51A 3L6BA 1JTVA 4I1UA 4LGCA 3H6HA 1JLLB 3A6PC 2A1IA 2GNAA 3A4LA 5DW3A 3F6YA 5HQJA 3RU0A 5KYKA 1JL3A 4RJIA 2QC9A 3TD9A 1QRTA 4NIMA 4Q47A 4MUKA 2WSYB 4BCDA 1FX0B 4O2AA 2EF0A 3ETJA 3QPVA 3OIWA 5EUCA 4QPDA 2GOYA 2BCEA 5L6LB 3OP4A 3CEPB 1T3HA 2ECPA 3OPYA 3K1TA 1WHSA 1ZESA 1BOOA 2R3SA 3H97A 3ZLBA 3NDJA 4BX3A 4XX5A 4XM0A 1OX4A 3RKUA 1A9YA 2QRHA 4OGGA 3MWDA 5HBRA 1N57A 5IVKA 2A0UA 3FPCA 2EZ9A 1BEUB 1QZ2A 5AW2A 3SZMA 1ZZEA 4OJKA 3EB5A 3FLMA 3PZ1A 1GNRA 1JHRA 3AG2E 2MIIA 5FLKA 3JQFC 1KFJB 3IGFA 5BW4A 5B1IA 2WF9A 5K7SA 3M33A 1U0SY 5K4GA 1S70B 2WB4A 3HV0A 1UPFA 1PDVA 5HFJA 1EUCB 2WTXA 4DM4A 2AFRA 1SVIA 3WWZA 5D51S 1ISRA 1R37A 4AWAA 1JJ7A 1OILA 5CJ2A 1R4MA 3AXTA 1GTMA 1U28C 1ADGA 3OXGA 3I37X 4FIPA 3U4DA 1L5HA