3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
4RZUA 1AN0A 1WQ1R 2MSCB 4YDHB 4YMSA 3HU2A 2YHSA 1KKLA 1P7CA 3W90A 3GCGA 4KAXA 3OFNA 2QE7A 1PJRA 3QF7A 2WZQA 1GFIA 1WRBA 4RCZA 4ZCIA 4PO8A 1DELA 3GJ4A 2BMDA 1KIMA 1BKDR 4KYUA 4P4UA 1F5NA 1W36D 4DSOA 4A0GA 1XEXB 1U81A 1XTJA 3FMFA 4CEJA 2PCLA 4KBFA 2Q6TA 4MITA 3U3MA 2F7SA 3P32A 2QQ0A 4IHQA 4JSTA 4L15A 4AI6A 2V54A 2CHVA 2VHJA 5BQ5A 1F48A 4K81B 5FPKA 1U0HC 3AH8A 2O8FA 1BO6A 2GF9A 3B8HA 4NU0A 3BH0A 3UKDA 2BKEA 4TMKA 1GG2A 2XJ9A 1NKSA 1ZUHA 3DOFA 3EZ9A 2X1VA 4WBSA 4LGMA 3CBQA 4NONA 2FJUA 4YDSA 2A2ZA 2CJWB 3D3QA 5EUQB 5JS7A 4DJTA 2GK7A 3QNUA 4ON9A 1MRNA 2IYSA 3UATA 1XCGB 5GJWC 4LJAA 5IK2D 3IO5A 3B1XA 2X2EA 1FP7A 4IRUB 4A8JA 2V1UA 2YC2C 1NP6A 4MGZR 1G9XA 1ZM7A 4URUR 2WWXA 3SDZA 3V9PA 1UKZA 1NSFA 2REXB 2VHTA 1E9SA 2ZS7A 4CIDA 4LK2A 3LW8A 3QXJA 2ZI4A 2O8CA 3VAAA 2DWPA 2GAOA 2QM7A 3TSOA 3AVQA 3FPAA 4TQUS 5DGXA 3GFTA 3LNCA 1XNJA 3SFVA 5D3MA 5JI2E 1WMSA 3CUEF 3FKQA 1KMHA 5CM8B 5DHFA 4YMVA 3BAFA 5BWMA 1G5PA 3U7GA 2H5EA 2ZE7A 4ACBA 1YZNA 1WBBA 2I3BA 2JJ1A 5BN3A 3L8ZA 2P2LA 5TY0A 1PZNA 2XTNA 2JATA 3AVPA 2D74A 1S3SA 1E0SA 5EP3A 1D8TA 3TMKA 2QP9X 4PO9A 5EXSA 4BASA 3FOZA 3LO5A 2V1XA 3K9LA 4XWAA 3U44A 2GCNA 2QZ4A 2JLVA 4ERNA 2Y8EA 2PT5A 4Q02A 1KSHA 3U4QA 3LWNA 5DI9A 2ATXA 2OCBA 4URVR 2DFKB 5JSZA 3NC0C 2ZI3A 2IS2A 1N6NA 1WF3A 2DCUA 3A4MA 4GI7A 2ZE8A 3H0KA 1W1WA 2JLYA 2AR7A 3CRRA 2YV5A 3GEHA 4D4LA 1GVNB 1VYVA 4UNRA 721PA 2RMKA 2EYQA 2ZUDA 2ZRJA 1U9IA 3CRVA 1T6NA 1Z3IX 3QG5A 4LRWA 1E2JA 2JGNA 3J81k 1T9HA 2E9SA 2Z5FA 3KB1A 5CIWA 5KPJA 1NNEA 2CLSA 2IHYA 1XXHB 1T3SA 2H1LA 3QJYA 4JLAA 4US2R 2BJVA 1YR8A 2YZ2A 2ZRMA 2ZYWX 4HUQA 4BLSA 2UVQA 2NIPA 3BD9A 3ADBA 2C99A 2JJ2D 2VA8A 4WXPA 2GVZC 3RABA 4EFNA 3X1DA 4I99A 2N1BA 3ZH9B 4GP6A 1SXJE 1IXRC 4MYUA 1EFCA 5DSZA 4B3GA 2QMOA 2PT7A 1UJ2A 2V55B 4R98A 4UJ5A 1FQJA 4EPRA 1TNDA 3VU9A 2J41A 3N5CA 4OQLA 4CEIA 4OL0A 4C0BA 2IK8A 3U3RA 1LTQA 4JVSB 2OHFA 1P60A 3ZVLA 2ZSEA 4AKIA 1FOEB 1SXJD 1EWQA 4NCHA 4B48A 2EFHB 4C0KA 3OESA 4LHVA 3TGPA 2XZLA 4WOPA 1UKVY 4CEJB 1W49A 2OESA 4NYMQ 4R71A 4UJ3A 4KODA 2QGNA 1J7KA 1DAMA 5H70A 3UPUA 4MKGA 2O8FB 2VP6A 3Q5EA 2Q9CA 3OEEA 5FOUA 4F92B 1X3SA 3T1TA 3U6KA 1NVWQ 1Z22A 2G0NA 2LKCA 4Q01A 4W9MC 1I2DA 1XMVA 1G6OA 2IHBA 3GPLA 2BIFA 3BS4A 2IXGA 1Z07A 2ZR0A 3X1WA 3IDQA 3OAAA 5BN5A 3LQRA 4EJSC 3LD9A 3QPVA 3CZQA 1JAHA 2C03A 2GZHA 1KZGB 4A8JB 3EWAA 4QJ4A 3SJZA 1Q20A 4TLCA 1KI6A 2BKUA 1Z63A 5KO2A 2BV3A 2ZU6A 1G3UA 1DEKA 3R9WA 1DG1G 2D7CA 3AB3A 1KI8A 2W58A 1UADA 4CYMA 3O8CA 1R10A 1G7CA 3TSWA 2QT1A 4II7A 4C9BA 1QHIA 3WNDA 5C4MA 5C18A 5ELXA 2BDTA 1E98A 3HJNA 5IF9A 2OEPA 4QJ3A 3CRQA 5D3MB 4QBIA 1KZ7B 4DCSA 1X1RA 4DRZA 1NLYA 4URXR 3W6OA 3IIKA 4JS0A 3KJGA 1KMHB 4F4JA 3T5GA 1BMFD 1MO6A 1DAGA 1JQJC 4EPTA 5BXQC 1FPMA 1ZW6A 4G5GA 4YXWD 1SHZA 2JLWA 1Z6XA 4KO8A 4Z8XA 1H8ED 1RRFA 1DAFA 1T3HA 2O0HA 1ODFA 3OIVA 4BLRA 1N6KA 3QUSA 5B58C 2W6IA 3DM5A 3U44B 4P4SA 3U4QB 3CM0A 3MWLA 4JSYA 2QAGC 3L82B 3M6AA 3KFXA 4Q1CA 2CE2X 2QRZA 4WZAE 1D9ZA 4HAXA 2QP4A 4CEHA 2LCFA 2EWVA 1KAOA 1Z2CA 4B74A 4DDTA 5HKKD 3AF4A 3WRYC 5B64A 3GEIA 1CR2A 1JJVA 4LJ6A 4QGGA 4E5UA 2ZS8A 5KUTA 3U3OA 2I1QA 1Q3TA 4B2LA 4Z51A 3R8FA 4PQYA 5EQTA 1ZAKA 2WJGA 3DVLA 3TR5A 2OWAA 1D6JA 3AP1A 1QHXA 4LX0A 1F3OA 2JIZD 4HATA 4HLQB 3K0FA 2EW1A 2F43A 4LUCA 1MOZA 1M7HA 3R8CA 1X8KA 3M4YA 2VSOA 2ZRKA 1YJ5A 4BZXA 4GOKA 3A1VA 3GLFB 4P0TA 3VMFA 1KO5A 4OHWA 5AUQA 1F60A 2PBRA 2H17A 3K9GA 4Q00A 4F4IA 1Q21A 621PA 3C5CA 1JB1A 2CK3A 4ITRC 2FX3A 5LD2B 4B2IA 2OSBA 1OH8A 3RVBA 3GJ0A 121PA 3B60A 2OFWA 2BVNA 3CX7A 1IONA 4JLOA 4P31A 4YMUA 3I32A 1XXHE 2XNSA 4KLNA 2YWFA 1JEDA 3RLFA 5FUVA 4PANA 3T5DA 3SHWA 1FFHA 4DKXA 1E9CA 3B13B 4ZI2A 2XAUA 3A1TA 2CCGA 3IKJA 1TQ4A 3A58B 4U02A 1DOAA 4D0GA 3P27A 2WIBA 3RS2A 3AKYA 1L8QA 1COWD 4TQAA 1ESNA 2IYXA 2W2XA 4M4SA 4NL4H 1II9A 3R9IA 1HYQA 4D82A 2Q3FA 3OZXA 3HDTA 4Z1MD 3O8DA 2ZR9A 5KSOA 4FXPA 1ETUA 1GAJA 1QRAA 1KSFX 2X77A 4NYMR 4WAUA 4F4CA 3FGNA 1GM5A 1OXSC 5L3RA 1KI4A 2BOVA 2Z83A 4O2LA 4GBMA 5G3ZA 5AUNB 5DIFA 5DISB 5BYJA 5GADl 5CIQA 5EE5B 1PLKA 2MMGA 4H1UA 1E2HA 5FL3A 4RD3A 4AURA 3P20A 5FPYA 3NWJA 4KBGA 3RS5A 3VX4A 1T3LA 3OFND 2QE7D 2HXSA 3TKLA 1GRRA 4Q4AB 3FM8C 1I4DD 5IK2A 2Q21A 1K8RA 4AIIA 1WDTA 4PZLA 2Z6VA 1SVIA 5EZ5A 4B32A 4TWZA 4GNKA 1KI6B 4MRRA 4Q1FA 5ANRB 5SZJA 3UMSA 1GRNA 5E7MA 4PPQA 2ODBA 1P75A 2J7PA 1R0XA 3H84A 3KQKA 3EPHA 3PEVA 1Z5ZA 1KKMA 4B2PA 3PUWA 1RFLA 4RZ2A 4BLPA 3ZS9A 4L9SA 2EVWX 2FFHA 1O87A 4A4DA 1FNNA 5J4LA 2EYUA 1NJGA 2F55A 1Q1EA 4UXJA 3IO3A 2CHGA 2ODWA 4IOJA 3SUBA 2ATVA 4IW3B 5B57C 1B0UA 1M7GA 2C2HA 3A1SA 3U6BA 2A78A 1E9BA 4PFSA 2O8BB 2HLDD 3T06B 1MO4A 1W4AA 1CS4C 4NKRA 2ZI7A 1EGAA 4B76A 1ONBA 3BH6A 4P4SB 1EWRA 4Z54A 2F9MA 1SKYB 2F1IA 1Z08A 3GLHE 4PX9A 2Z0MA 4JJZA 1DAEA 1EFHA 4OJQA 3NBXX 1QHGA 2RGDA 2K5UA 3W3AA 4OYHA 3WYGA 1LS6A 4WZ6A 5JRZA 1UBEA 3MLEA 4LYAA 2DFNA 4FCVA 3K0EA 3ZS8A 1YZUA 2PLFA 1G3QA 5K8LA 1P6XA 2J0SA 3L2OB 1RRGA 1FUKA 4AG6A 2Z43A 3LDAA 2F1RA 3DL0A 1IN4A 5L3QB 3QPUA 3NKVA 3K0FB 2F43B 1G3MA 4POAA 3BORA 2IUUA 4OK5A 1ELOA 2JJ1D 4O2RA 1NL3A 1HUQA 3IIJA 1TEVA 3B9PA 1SULA 1K5GA 2GK6A 2W6JA 1ZP6A 2FZLA 3UXMA 1AKYA 2ZRDA 4RFSA 4Q21A 4EFLA 4Q7LA 2GXQA 1S0UA 3TUZC 1DAIA 1UDWA 2BBWA 2ZSFA 3CNOA 4Q5IA 1TQDA 5SZIA 1W48A 3KXLA 3W8NA 4JMPA 4AKHA 4PSVA 4A92A 2WPDA 4IFEA 3AF2A 4AC9A 2FMXA 3K70C 4KJZA 4BFYA 4F93B 4FW9A 2QBYA 2ZSDA 2P57A 1E1QA 4PQRA 4D4JA 4URYR 4B34A 2R6AA 2HF8A 4PHGA 4Q03A 1JR6A 1G3IA 5LB4A 5BW8A 3LV8A 2GCOA 4DHEA 1K6MA 1FUUA 1DO2A 4UNPA 2QORA 2F1JA 4JIMA 3S1AA 4DZZA 1NLFA 4G0NA 4LI0A 2B21A 4C0QC 4PSKA 5DYIA 2WHXA 4DLVA 1R4AA 5KHOC 4IXNA 4QFMA 1AZTA 2MSDB 2G3YA 2QI9C 5FBQB 2D2EA 1L2TA 4JKYA 1OXUA 1H65A 3WBJA 3LW7A 4EPVA 2HUPA 4EPYA 3GEEA 3W34A 4AKEA 3ZVRA 2FGKA 4IEEA 3HU3A 3NDBB 2VHQA 4CVNA 3ZQJA 4HLCA 1TUEA 2FEMA 1SVKA 1UFQA 4OI1A 4HB0A 2J1LA 2IEZA 3Q72A 3EC2A 1FMJA 1U2RA 1KNXA 3KB2A 1A2BA 4QGHA 2JJ8A 4R2HA 2ZPTX 1E32A 2FH5B 1UBGA 1IBRA 4GPTA 3LXXA 3WMGA 2G9NA 1E2DA 2ZI5A 1WCV1 2WVJA 4B43A 2PL3A 3MMPA 2BEJA 2FFQA 2B8TA 4QJ5A 3GFPA 4TZ0A 2JCSA 3WNCA 5LDDC 4LYJA 5CITA 4EFMA 3VQTA 5IDVA 3PUYA 1RVDA 3OEED 3SQXA 3SU8A 3I3SR 1J70A 1EXMA 1ZM4A 4B73A 1JAIA 3ZLJA 2NO7A 3LVQE 4CGZA 1W47A 1Y63A 2CJWA 3WP0A 1GNQA 1GIAA 4KSCA 3KQUA 2ERXA 1E9DA 2REBA 5EE9A 1N6LA 3OAAD 4IJMA 2IL1A 2E87A 3BFKA 5KNBA 3RANA 3TW4A 3HYRA 1ZJ6A 1G7RA 2ZE6A 3EPJA 4TMZA 3KUDA 4DSNA 2ZYUX 1VG0B 4IVRA 1G5TA 4NH0A 1ZIOA 2GXSA 2P67A 2AK2A 4JLVA 2P6UA 4TMVA 2J0VA 2RAPA 2EFCB 3KL4A 3FHTA 2OCYC 4EJSA 2FOLA 2PJZA 1R8SA 4Q47A 5FOSA 1R7RA 1ZD1A 2IS1A 3A1WA 4D6PA 5FTLA 1RZ3A 1TU4A 1I4TD 4DBLC 2GHIA 1KK2A 1M8PA 4URWR 1W5TA 1P4SA 4TTQA 3WMFA 3PUVA 1M7BA 4QXAA 2WAYA 3WP1B 3NXSA 2PMDA 1SKYE 4PZYA 1CF4A 2IYUA 4YMTA 1OW3B 5FTKA 4YMWA 4OK3A 3C41J 3EA5A 1XD8A 1XCPA 2RH5A 3DM9B 3KJEA 3K9NA 2A7QA 4OBEA 3L0SA 4N0EA 4MKHA 1UAAA 2BBOA 3GQBA 2GZDA 3PJRA 2EU8A 1QVRA 2XITA 4I1SA 2W6ID 4NCJA 3IGFA 4QHSA 5LBIA 2ZJZA 1S1CA 1NY5A 4HAYA 4LV6A 4GMXA 4G1UC 3VR1A 4A0RA 1TQ6A 5FTNA 2ORVA 2QA5A 3DO6A 1CJMA 1BOFA 2G88A 2HXYA 4FWIB 2BMFA 3SI7A 3CPEA 2ODNA 4M53A 5CJ2A 2QBYB 5GVSA 3P4XA 2J0UA 4Q9JA 3AVXA 2VSXA 4B3XA 2JLXA 5AUOB 3K0AA 5M04A 1GDDA 3T15A 2V4ZA 3RS0A 5FBRB 4EQ6B 1E4VA 1YZKA 5EP1A 4MDFA 4N3NA 3Q9LA 2GCOB 4HLUA 3SR0A 5FOXA 4YQFA 2CNWA 3I61A 4Z1MA 5BN4A 3S1AB 2WWFA 3NH6A 5FFMA 5KPDA 1ZU5A 3Q5DA 2R9VA 5FPTA 4CT4B 3B9QA 4GT1A 3T1VA 1YQTA 1GL6A 3NC1C 3QOFA 4U00A 3R7WB 2CK3D 5CLQA 4H9GA 4JLJA 4QBHA 1Z0DA 4M1OA 1VHLA 1E94E 1KK0A 1HEIA 3THOA 1YR9A 4V0NA 1QHSA 2MSEB 3C16C 5A4JA 5J4KA 4ACAA 3UG7A 1NRJB 3CZPA 5KOYA 3A4NA 1YHNA 2YJTD 3W3ZB 3QSYA 4TZ6A 1XFAA 2ZAMA 3T12A 1JBKA 2WWWA 4DSUA 4MH0R 5JMTA 4ZCLA 4MRPA 4LV8B 2QQEA 2WKRA 2YOGA 4US0R 2OE2A 4LJ5A 2N46A 4LJ9A 4LJYA 3SC3A 3CH5A 1W44A 5KSPA 3MJRA 1KO7A 5L3VA 2NPFA 1KAGA 4M9XA 4Q4JA 2BCJQ 4Y0AA 1KI2A 1R0YA 2OXCA 4LYFA 3HPRA 2Q9AA 4D81A 3R9XA 1LF5A 1PVOA 3KQHA 4JLBA 3TJZA 2IYYA 3WYAA 4DDUA 2PZGA 1KSJA 2J5XA 3IUYA 2VP4A 3CH4B 2W0SA 4WZBE 1AGPA 2EFDB 4OI2A 3KUCA 3MSXA 1ZYUA 4L5BA 3I4LA 2HLDA 2ZE5A 2QNRA 2BCGY 4LHZA 5SZKB 5DI3A 3CRW1 1QG2A 2CMKA 4NHOA 3AF1A 1ZIPA 5HCIA 2DYKA 2IYWA 2XSZA 2PX3A 3E70C 3KQNA 3DEFA 1L4UA 1TADA 4QFVA 2B6HA 5JS8A 4EJSB 2FGJA 2J7PD 4AKGA 3CF0A 2GILA 2O8BA 4CZ2A 2OAQ1 2OFOA 3TE6A 2PZEA 2VL7A 2XX3A 4KV9A 2REOA 4KFTA 2R6FA 4OQNA 4KITB 4LJ4A 5KSYA 1P2UA 3B7GA 4R2IA 5CJPA 4NMMA 3UANA 3R20A 3KJHA 4WA7A 2WM9B 3GJ3A 3LXRA 3EW9A 1TX4B 5JLJA 1R8QA 1XPUA 1H8HA 4MUBA 2WWGA 1VYTA 2IUSA 4HAWA 2FPMA 5AR1A 4PR0A 2A5JA 4QHTA 2FSFA 2ZRLA 3FFAA 3C15C 1GP2A 4QM6A 2RGGA 2CL0X 2XNDA 5J47A 4GZLA 4WW0A 2ZRPA 4XWKA 5KTYA 5JEDA 3KX2A 2NMVA 2UKDA 4TQ9A 4BFVA 2ZRCA 5KDDA 4V0OA 4KCGA 3AVWA 4M22A 1CBUA 3NG1A 1PLLA 4G01B 4JVNA 4XSHA 1NN0A 2ZETA 2CHQA 3IQXA 3KKMA 3RAPR 2D7DA 1E4YA 1NVVR 1U0LA 2J0UB 1E2EA 2QP3A 3PUZA 3GLIA 1TUIA 3K0AB 4JL5A 1EG7A 2A5FA 2NG1A 2QAGB 4MKIA 4MYHA 4ZV4A 1KY2A 3EZ7A 4R9UC 3BH7A 4KXFB 2B0OE 1NVUQ 1YVDA 1IOZA 3TNFA 3TUIC 4D2IA 1DADA 4O3MA 2NGRA 5GJCA 3THWA 3JVVA 4DCVA 1FTNA 3CPJB 3MJHA 2PJRA 3LLUA 1LF0A 3PCRB 1TEXA 3PIRA 5DO9A 6Q21A 1NMZA 1I4LD 4P4TA 2BWJA 2QPTA 2W6JD 4QNMA 3Q7QA 4IDHA 4LPKA 1NVXQ 1Q12A 2ANCA 4U7DA 2ZYTX 3G82C 4RD1A 2VPPA 3MAAC 3UMRA 3OE7D 5AJZA 3WNBA 4F38A 3TVDA 3LRPA 3QG1A 4JL6A 1W5SA 1GRQA 2BMEA 4DB2A 3ETLA 2WPDD 1SVWA 4V0LA 4B44A 3OHMA 5JHHB 1NMYA 1E1QD 3Q3JB 2VF7A 1DE0A 3D6TB 3DPUA 2WOJA 1NN5A 1XTIA 2IT1A 3MD0A 2RGNC 3OIUA 3QXHA 5FR1A 2ZRNA 2AXNA 3PEUA 4UNQA 2N42A 1P9NA 4US1R 2CLDX 5HCNA 4C0AC 2OLKA 2R44A 1KMQA 3I73A 4Q4JB 1ZRHA 1CEEA 3NH9A 4NTZA 2GESA 1T0HB 4OI4A 4C2UA 2CBZA 2CE7A 3D7MA 4PTLA 1QF9A 4RD6A 2GXAA 3EXAA 4FD2A 1KI3A 2YNMA 4G5QA 3C5HA 4JLDA 2D4HA 1P3JA 2R8RA 1E0JA 3RSOA 4PC2A 2AD1A 2VRWA 3BFXA 4Y0VA 1T5IA 2ZI9A 4NZYA 5GVRA 2P5SA 2P6RA 5FOWA 2A5DA 5DI3B 4Q4AA 4Z8YA 2WKQA 3ICQB 1SQ5A 5FUWA 4A2QA 1ZVQA 2GA8A 2YWEA 5KU1A 3SFZA 1QHNA 3SJAA 4GZMA 4BEJA 4FI3C 4OJKA 1YR6A 1R0WA 1JECA 1E2MA 5F3WB 2IQJA 3EG5A 4RZ3A 3RRNA 4FINA 4FIDA 4DWJA 3SYKA 3CX6A 2ZUCA 1HE8B 4Q19A 4Q9IA 1S8FA 3BK7A 1M1YE 4C0LA 4ZKDA 1E2QA 1ZU4A 1W0JA 4TSFA 1QBKC 3VR3A 2ZITA 4HB2A 1X8LA 2HT1A 2XZPA 1LB1B 1Z0JA 1BIFA 1JEEA 2KBEA 4NCKA 4MGKR 3QKTA 2ERYA 2G77B 4E22A 2IX3A 4TL6A 3L0IB 4M21A 3JZAA 1SVLA 4B6FA 1WA5A 3PENA 4DLTA 5J4YA 2GBLC 3QVVA 3KZ1E 3HR8A 1LNZA 2WWHA 2GZAA 1DAKA 2W83A 4JVMA 4QRHA 2EFEB 4DLSA 2YWHA 4W5HA 2IEYA 2WMOB 1US8A 4TLBA 1SVMA 3NEJA 4KVGA 4X8LA 2BM1A 1JXMA 5F9FA 1EX7A 5EUMA 3TW8B 1LS1A 1E2IA 4BWYA 5L8VA 3E5HA 3QY0A 5FPHA 2XEXA 3GLIB 1MV5A 2AWOA 2HEIA 2W00A 1NG9A 3Q8XB 3EX7C 3BE4A 3BB3A 2YINC 1OH7A 5L3QA 3VTKA 2O0KA 3THWB 1AK2A 1VDZA 1YRBA 4HDOB 4TL8A 1E3MA 4D0NA 2C78A 3RS4A 5HZKA 4IEIA 1NN1A 3BC1A 3I5YA 1QG4A 2H57A 2IF0A 3WXMA 1SKQA 1TF7A 1YZTA 3FKSA 4LC1A 1XEFA 3UMFA 5E3HA 3NHBA 3MFYA 5C1BA 3IQWA 4YONB 5JJLA 4LDJA 4IDPA 1N6PA 4DIEA 4DLXA 1FNMA 1XD9A 2DY1A 2BMJA 5K8UA 3ADKA 3KKOA 3LBIA 3KDSE 1U8AA 3FHOA 5JEEA 2FSGA 1Z6TA 1CP2A 3HP1A 4QM7A 1Q1BA 2HV8A 4NYJQ 5J5CA 4GOJA 1FX0B 1QDEA 1OYYA 2PEZA 4P3YA 4M9QA 4KI0A 3ZQ6A 4LHXA 2BBTA 1ZBDA 1DCQA 1E2KA 3CB4A 3ZZ0A 3NTUA 2CNWD 3QIAA 2B7CA 2NOAA 3K70B 4M1MA 4RCYA 1CTQA 1KYIA 3EIQA 3ZIAA 2BHRA 1II8B 3UWKA 2JLQA 1IHUA 1L4YA 4BRUA 1O3YA 3ZD7A 2AFHE 2FFBA 1TF2A 3SS8A 4BFWA 1KSGA 1RRPA 2GJKA 3KFVA 1R2QA 5C46F 1KHTA 2P0EA 2W2TA 4JLNA 4PAOA 1W4BA 5JZVA 1N5KA 3A1UA 2F6RA 1IY2A 5TVKA 4HSEA 3RHFA 3H1TA 2AKYA 1Z28A 1E69A 3DKVA 3T35A 3AQ4A 4LCBA 2G6BA 3MWKA 4S35A 2NZ8A 1DAHA 2V6IA 1RE0A 3HWSA 4AK9A 2X8AA 4NP6A 2C77A 4HAUA 4Q1BA 1FL9A 3K53A 1J99A 4TL7A 1W2GA 3ZVNA 2C9CA 2LWIA 4RVCA 1TF5A 4A8JC 3IEVA 4D4MA 1FTSA 1SGWA 2ZTSA 5JWRA 4LZZA 2R6CA 3C8UA 4D0LB 2ZM5A 1VMAA 4K46A 1RC8A 3KXKA 3C14C 2QG6A 2QSZA 4J0QA 4JT2A 3W6PA 2FV8A 4L9WA 3G0HA 3X1ZA 1U90A 3FTQA 2OZEA 3MUFA 3EARA 1IJEA 2FSIA 5TDHA 1HH4A 1UF9A 4EKDA 1KY3A 1T0JB 2JDIA 4PPGA 3F8TA 1VCIA 1FW6A 1XPRA 3RC3A 1F6BA 4N1AA 1XTRA 2XJ4A 4GL2A 1P2VA 4EPXA 1LY1A 3UK6A 1NG1A 2VIIA 5DE3A 2FNAA 1KO4A 4FCTA 4V0KA 1VG8A 3LJUX 1ZM2A 2V7QA 2RHDA 2GEDA 1N6HA 1GKYA 2XSZD 3CIOA 2QGZA 1US8B 1KK1A 4ESHA 4C7OA 221PA 1OFIA 2MMCA 3RC8A 3BXZA 4TL9A 1K5DA 3EASA 1XJCA 2LKDA 5AJWA 3PUXA 4HUTA 4JT4A 2VF8A 1XX6A 2OO7A 3AKCA 3ONWA 1E0KA 3VKWA 5EP4A 4F1PA 1ZNZA 1E2LA 4I81A 2WOOA 1HA3A 4IOKA 1E9FA 3DMDA 1M6NA 4M2LA 2OCPA 1XTQA 3FFBA 2ZXUA 1ZM9A 3GLFA 1VECA 1KDOA 2GKSA 1VCNA 1E9RA 4DEYA 1U9IC 4NBSA 1D2EA 2IS6A 1QVAA 1VG1A 3B5JA 4AD8A 4DIDA 1H8HD 3CW2A 1Z0KA 1EFRA 2ANBA 2JAQA 3FYHA 2ORIA 4C2TA 2IXFA 4V03A 5JJKA 4RFVA 2FN4A 5EP2A 3LAWA 1IAQA 2V9PA 3GLIE 5TMPA 2O5VA 1GNRA 2XNDD 2WV9A 1AS3A 2IBMA 2YC4C 3QI2A 4PPFA 2GJSA 3OE7A 1M2OB 1RYFA 5FOTA 1XMIA 3SZRA 3AGQA 4B3BA 1KI1A 3DMNA 3JZMA 2F3RA 1D2MA 3I92A 3PG5A 4TYPA 2DPXA 4C3ZA 2DBYA 4GFDA 4R7ZA 2GEUA 2NO0A 3M1IA 4FMCF 1Z6AA 3H86A 4DCTA 5FBLB 2BC9A 5CB6A 2IYVA 1G4UR 4EQ6A 1XDBA 1AA9A 4NYJR 4TYNA 3U3JA 1OIXA 2ZRBA 3Q7PA 3A37A 4Q7KA 1G3RA 3B1VA 3AF3A 3PVSA 4B71A 2FE4A 1GSIA 4C0HA 4M1SA 3FWYA 3QEJA 5J40A 4F7WA 1G64A 1OHHA 3R7WA 3GJ6A 4XWOA 5JCZA 1IN6A 3VKGA 4KFSA 4EPWA 2QENA 4LY6A 1IN8A 1NJFA 4B35A 5EJEA 4ARZA 2NZJA 1WP9A 5G40A 3SOPA 2GETA 3BB1A 2FDCA 4TMTA 1E2NA 5AK0A 2CVFA 2SHKA 1DVRA 3X1YA 4O0MA 2J87A 1JI0A 4JBYA 3V00A 2QUZA 1ZNWA 4G5SA 4Q1AA 1HQYE 1YZGA 3BBPA 5TARA 3QQ5A 1E9EA 1Z2AA 2B8WA 2A3RA 4BFUA 1DG3A 1LV7A 4I1OA 1NI3A 421PA 2R65A 4LBYA 4GDFA 2R62A 5JJIA 1OSNA 4GSYA 2CCKA 1S96A 1WXQA 5J4HA 4RJLA 1N5IA 2BM0A 2J3EA 3CRMA 1EESA 4XIGS 4MKFA 3K70D 2WBLC 3ZJYA 5JCPA 1NF3A 1ZUNB 3DOEA 2CRWA 1E0AA 2ZROA 2RGBA 1NSTA 4ESVA 1IN5A 2RGNA 5EE3A 2Z4RA 1JPJA 2Q9BA 1Q22A 3VX3A 3A4LA 3LBNA 2WJVA 4LHWA 1TAGA 1WBDA 2XTZA 4ASUA 4LYHA 3CKLA 4C4PA 4Q4HA 1JR3A 521PA 1JXOA 4XH9B 1NMXA 5G41A 1Q1QA 4BE7B 2D62A 1R5OA 3TSZA 4CT5A 4TYQA 1TL7C 3F0TA 3TAHA 4M9SA 1OB2A 3WHLA 3K9HA 4C7OB 4TYWA 2O8DA 4LSGA 1P73A 4C30A 3EIHA 5FL7A 3IBYA 3B1ZA 1RPZA 2D3WA 1UBCA 3FHCB 2ZAOA 5HZHA 4B3CA 5EXXA 3C4JA 1UDXA 1MT0A 3KTAA 4M1WA 2OXRA 2AD5A 1W0JD 4TSFD 1YZLA 4BRWA 2PMKA 1U8ZA 2JA1A 5G3YA 3ZGXA 4E03A 2UZ3A 5DN6A 5FPSA 1VYUA 5C2JB 3OEHA 2GAAA 3FB4A 1KJZA 3NDPA 1XJ0A 2ZRGA 3AP3A 1AKEA 1XZPA 4FMDF 4L8GA 4Q1EA 4TT3A 4PC7A 1EK0A 1XBTA 5CB8A 5A0FA 4BZQA 4A36A 1N6IA 1IJFA 3CF2A 4MRVA 2OUKA 4TMWA 3DWDA 4Q9HA 1D2NA 2P3SA 3IBGA 1E9AA 4FWTA 3MWJA 1T5LA 1TPZA 1XF9A 3AVYA 2B7BA 4UQOA 4JKIA 1P9WA 3IHLA 3CX8A 2XZOA 1F2TA 2GNOA 1BS1A 3NHAA 2WICA 5GJVC 3WYFA 3QBVA 3RDPA 3EIEA 1HV8A 1R5BA 3U7EB 4ZKEA 4XVQA 1ZC3A 2AHOA 3RS7A 4DB4A 2GBLA 4TLAA 3O47A 3DKPA 1P2TA 3KKPA 4QGAA 4DLYA 5FI1B 4JLKA 4MGIR 5KNCA 1G291 2QU8A 5EXTA 1IY1A 4OQMA 5JI3E 2DWOA 2G1KA 2QAGA 4IDNA 3ZD6A 4DDVA 3SYLA 2Q3HA 1CR1A 4DC9A 1S4QA 2VEDA 2AWNA 2R6GA 2GTPA 3K09C 2ZJ8A 3KJIA 3N2IA 2RGEA 3RS3A 3MG9A 2P65A 1E2FA 3QPWA 4DLRA 3MGCA 4QKQA 1W36C 4GP7A 1ZUIA 4ILEA 4OHYA 4KU4A 1IQPA 2E1RA 4BLOA 3EPLA 3AV0B 1II0A 2WMNB 4OQFA 1IY0A 1OXTA 2YOFA 3ZDQA 3T34A 3FKSD 2KSQA 1D5CA 1Q1ZA 2PH1A 4BFZA 1XMJA 1CRQA 1KDPA 4BUJA 2PZFA 1KI7A 5D3QA 1NLZA 3TUJC 1AIPA 4ARZB 2OBMA 2G83A 1OJLA 2KB0A 2AK3A 2QTFA 2RGCA 3PXGA 1FQKA 3U2QA 1G8PA 4OK6A 1CIPA 4HDCA 3NBYC 5FTJA 3ASZA 3TVTA 2IC5A 3K1JA 1N0UA 3GJ5A 2VHUA 4MQBA 1A1VA 5HTKA 4HAVA 4G5RA 2GCPA 5HR5A 3VR5A 4BECA 2HYDA 3EAQA 1RW4A 4H1VA 1L7VC 3NIBA 3B82A 4NE2A 1J8MF 3WMEA 4IOLA 3UG6A 2B92A 1W4RA 2CXXA 2ZIAA 3AVOA 1V5WA 3P4YA 4OKSA 3ZIAD 4ZIRA 2IWHA 2VTKA 1GNPA 2ZU0C 2IYLD 3AP2A 2KI5A 1TTTA 3IEUA 4QHYA 3HU1A 3OIYA 2JEOA 3B2EA 4GRAA 3VHLB 3EZFA 3PQCA 3GLGA 1N2CE 2R2AA 4CDGA 1DBSA 4LHYA 1G8HA 1M34E 3ND8A 4CW7A 4LV5B 3K8YA 4Q4HB 3BERA 3SYNA 2H18A 3THXA 1XU4A 1OB5A 4JJKA 3E2IA 1A7JA 3SNHA 2RGXA 4OQXA 2FWRA 1CR4A 2JLZA 1VG9B 3I1FA 1W0KA 2IYZA 3IPXA 3K0CC 2NTYC 4E09A 1B23P 2O8DB 3GFOA 3V4FA 4V0MA 2CLCX 2QTHA 2FZ4A 3ZVMA 1KJYA 1VKJA 1XMSA 1G19A 3GP8A 3KTAB 4PHFA 1AM4D 2O8EA 2FA9A 3ASYA 2V3CC 2XB2A 1FP6A 4KSBA 2JLSA 3AKDA 2ORWA 2ZJOA 5F2EA 4LC0A 2VHCA 5GJBA 3CNLA 2JDID 1XB2A 2GJ9A 3U61B 2EQBA 2WJJA 1RJ9A 1OKKA 3CR7A 3EA0A 3LLMA 1CKEA 3RRYA 3LH5A 4DLUA 3UIEA 4ZDIA 2H16A 5EE1A 1OXXK 1EX6A 4XVUA 5K8TA 1P9RA 1Q57A 3GLHA 4AYWA 1F2TB 1HT1E 2AXPA 2CCJA 2V7QD 3Q85A 4KLZA 3IILA 3CR8A 2CL6X 2ZRFA 2FF7A 1GL7A 3H2YA 3IPYA 4P32A 3L8YA 3FMIA 4C0JA 3VNVA 3GLFE 3TQFA 1P2SA 3AUYA 2VP0A 5FI0B 2PX0A 1QHHB 2VP5A 3REFA 2VQSA 3WRXC 2ZUBA 5FTMA 3U7FB 2KBFA 4PHTA 2GJAA 2OM2A 1CXZA 4D80A 2AFIE 1Z6YA 1SXJC 4KFRA 1Z83A 4BEBA 1C1YA 1GWNA 3CO5A 1AZSC 2J9RA 2RGAA 4BPBA 4NDZA 3AM1A 1AQYA 5CK5A 1BH2A 3M0EA 1EFRD 3DZ8A 1CJUC 3LY5A 1KGDA 1OPXA 2FU5C 3MDBC 1OF1A 1YU9A 2DFLA 2YWGA 3O8BA 4HI0E 5E4FA 4CRWB 2IWRA 1RKBA 4HZIA 4IDOA 1DO0A 1S2MA 3L0PA 1RIFA 3EWSA 3FVQA 3ADDA 1NBMA 1LW7A 4TMXA 4B47A 4I4LA 4LBWA 4QGFA 2ZJBA 4X8OA 4Q9KA 5TV2A 1F2UB 4JL8A 2XGJA 2FPLA 1HY3A 1N25A 2QMUA 5FH9A 1XTKA 4DT1A 2XXAA 2X19A 1MR3F 1EFTA 2OBNA 1G7SA 4TN1A 3I8SA 4M1YA 3B6EA 4TLDA 3B1YA 3MWYW 5HPYB 5DYGA 1FX0A 1CJVC 1N6RA 1XCMA 1MH1A 1A2KC 2KWIA 5DH9A 1E96A 2OLJA 2ZYVX 1ZNYA 1E2GA 3QVUA 4ZI3A 4UXHA 1VIAA 3D31A 4DXAA 1OLOA 5CM9C 5P21A 4A1FA 3VFDA 1A5TA 4HEJA 1II8A 4LJ8A 1PLJA 4ZIRB 1G21E 5AWFC 1GL9B 1I2MA 1DS6A 5FUXA 3OIWA 4WXRA 4IFBA 3W6NA 1YZQA 1E79A 2ZRAA 1NIJA 3SJCA 2WSSA 4PAQA 1E1RA 1G41A 2PEYA 1OHHD 2RHMA 5EXPA 4XTCS 3EC1A 4DCUA 3GLGB 3LFUA 4Q48A 4LBVA 3LA6A 2ZVPX 3AKEA 2ZVQX 3THXB 4Q7JB 4N0DA 1GOTA 1PUJA 2I1VB 3LBHA 4A15A 1YKSA 1ZC4A 4UXIA 4XVRA 5FOVA 1AQUA 4GMDA 3GJXC 3QKRA 1G8YA 5L3SA 2ECKA 5H1YA 3T61A 4HYYA 2KJQA 4XJXA 5H68A 3VR6A 1KO1A 1ZM3A 3QF4A 2C9OA 3MRSA 1KNQA 4BZPA 4MA4A 2ZR7A 3THYA 2QY9A 1UEJA 4DUGD 5H8WA 2O8EB 1IXSB 3AF0A 4XD7A 1IXZA 1J90A 3WY9A 1JR3E 4XSGA 2CDNA 4C0SA 3B85A 3OF5A 4Q7MB 1JNYA 4EDHA 2HT6A 5FBVB 2P6NA 1RRCA 1S3GA 2ZREA 4OI0A 4W5WA 3BGWA 3CWQA 4GOXA 4OHVA 4M9ZA 3I8XA 1FZQA 1UKEA 1KTVA 3GD7A 1RJ9B 1IN7A 1V43A 2ONKA 5E95A 4W5JA 3CPHA 5DLQC 4ASUD 1OH6A 2O8CB 3AGPA 1E2PA 2ZS9A 5DNYB 2CL7X 1JR3D 2ZJ5A 3L0OA 3U5ZB 2ONJA 2A5YB 4IVPA 5CDFA 5TXGA 4D25A 3RSLA 3GLHB 4NCIA 3QXSA 4MRNA 1JPNA 5JHGB 3FEHA 4G5OA 3T1QA 3QXXA 1ZNXA 4URZR 2VH5R 2WTUA 5IT5A 5FL7D 2JASA 3KXIA 2CEAA 4ZDKA 2Z4SA 3VNUA 1U99A 2KE5A 3PEWA 2D2FA 1G5RA 1J2JA 1GITA 1XZQA 4ABYA 5JWOA 4A2WA 5DN6D 1WE2A 8OHMA 4PC3A 2I4IA 2IXEA 3OEHD 3SBEA 4TT3D 4Q9LA 4FCWA 3KKQA 5JSZB 2X2FA 3PFIA 4HLUC 1UKYA 4IKEA 5F98A 4HLDA 1R6BX 5JRJA 4UNSA 2GWHA 5EE0A 1R5NA 1SVSA 2C98A 3VHXA 4FMBB 5E7IA 1S9DA 2HCBA 5TB5A 4DDWA 1TMKA 2OCAA 4F91B 3AUXA 2OILA 2HDNB 1UBFA 2QPOA 4A9AA 1CJKC 5JWHA 4TTRA 3ND9A 1MABA 1KK3A 2IYQA 1JALA 2GEVA 5B2ZA 5KYKA 2DB3A 1OFTA 3N70A 4IOMA 4HUQB 4DT1B 3U60B 4RD4A 4ZPXA 2XXAB 2ZQ5A 4P33A 5IRCD 2EFGA 3RYTC 1W46A 2VP9A 2XOKA 1N0VC 2IA5A 4RKFA 1VHTA 4JYCA 3LVRE 4YLGA 2GDJA 2FG5A 3BIFA 2G0TA 3QXCA 2J46A 5LPNA 5UKDA 2C5LA 2ZRHA 3NBZC 1Z47A 2HYIC 3AVUA 1G8FA 3W8RA 5HE9A 3VU9B 2BJWA 4U5XA 1VIYA 3O8RA 1GILA 4WIAA 4CEIB 3QEOA 3WHKA 3NVAA 1MRSA 3TH5A 1EFUA 2F3TA 4AY2A 5J4VA 1CJTC 2QN6A 5DHAA 3JUEA 3K09A 1YR7A 3SHFA 4BLTA 1GTVA 4RKEA 1G17A 5E7JA 2V6JA 1MO5A 2HCJB 2H92A 3TIFA 2H8KA 1MKYA 2ZANA 3RNLA 1G7TA 3I62A 3F5FA 3VR2A 3DHWC 1MO3A 3AEZA 1G20E 4LOAA 4PZZA 5AJXA 2WSMA 3A36A 4DLWA 1PUIA 2QPAA 3REGA 2GRJA 2IS4A 3QKRB 3FDIA 3QKSA 1D9XA 3NEYA 4MRSA 5L3SB 1GKIA 1ZINA 1G1MA 3BFVA 3QKUA 4A0HA 2JLRA 1UEIA 3CWZA 4V02A 3QF4B 1W7AA 1IM2A 4HZUA 2WIAA 3GLGE 4NYIQ 3ZZTA 2IF2A 4B3FX 3THYB 2AX4A 4QL3A 3T1OA 4KHZA 1Z0AA 3BWDD 2CRRA 1AS0A 5JBQA 4JLPA 4O25A 3SEAA 1T8UA 4LJ7A 3P1JA 2IYRA 2IW3A 4DLZA 4DVGA 1C4OA 2EWWA 4PHHA 1AGRA 4M0LA 4MUAA 3QE0A 2OV2A 5CLLA 3W5IA 1N0WA 1Q3HA 4DCNA 1OIWA 1XWIA 4HAZA 2OAP1 1KOFA 2DHRA 4V0ME 4QBGB 3I72A 3TQCA 4PXAA 1OYWA 1C9KA 2VYFA 2C8VA 1LVGA 2J59A 4A0FA 3CNNA 4Q4LA 4XTRA 2WJIA 4QNRA 5CYPA 2GVDC 3TK1A 821PA 5SZHB 2QMHA 4IXMA 1NIPA 1W0KD 5BYKA 5IHPA 1T4GA 1QZXA 2GJ8A 2VSFA 3C7KA 2H7VA 4BQSA 3AVVA 5KDLA 1N6OA 2HJVA 5C4GB 2O52A 2YOHA 4W7SA 2R6DA 3FMOB 2WJHA 4DEXA 1J8YF 2F1HA 3BB4A 3D8BA 3RWMB 1S1MA 4NCNA 4LWZA 1KDRA 2W0MA 1ESMA 3K0CA 2XTMA 3TR0A 1TU3A 4MYTA 4BLQA 4FMCB 2YYZA 1OE0A 1E99A 1ZD9A 2ZSAA 4AWXA 4PC6A 3I5XA 4CEHB 1X6VA 2ZI6A 1OKKD 4BFXA 1U8YA 2GF0A 2Q3MA 1CRPA 3CLVA 3QBTA 4A6XA 2HJGA 4KYIB 4AYTA 1ZCAA 2C96A 4E07A 1AJEA 1PV4A 2J45A 2IUTA 5HE8A 2AN9A 2WAXA 2FFAA 2QT0A 3U7HB 3NBFA 2OFXA 2JLUA 2NO9A 2RKOA 1MABB 3SBDA 4PPNA 4JBWA 3KKNA 5A5GA 4RY2A 2OBLA 3A6PC 5LD2C 4A2PA 4QOSA 1AS2A 2IYTA 1ZMXA 2QMEA 1OT3A 2DFTA 4QG7A 4ZO4A 2JJ2A 1Z8FA 2FSHA 4L16A 3ADCA 3TAUA 2WWYA 2FEOA 4MYCA 1Z0FA 2C9YA 2CVHA 3RWOA 1SZPA 3X2SA 1OV4A 2UZIR 2ODEA 4PC1A 3WBKA 3LQQA 4QC2A 4ZDWA 1NBME 2C95A 4LPSA 4TTPA 2QEQA 3SE0A 1CLUA 2ZEJA 4Q1DA 2RCNA 3N2EA 4BFTA 5K8IA 3AVTA 2DR3A 1Z29A 2QROA 3HPQA 5FBWB 2BEKA 4PO1A 1SXJA 2BBSA 3KQLA 4B6EA 4PAMA 5LB2A 3LX5A 1W36B 4BGDA 1GKUB 5AJVB 1HT2E 1OFHA 4LBZA 4ZCMA 1NBMD 1GUAA 3VKHA 1Q0UA 3U3KA 3W9YA 4I1UA 1Z6GA 2NO6A 4HB3A 1QHYA 4B3DA 3G5UA 3SN6A 4EAQA 1HQCA 4I1VA 4B33A 1DPFA 2NO1A 4HDQB 5JECA 3V4RA 2QAJA 1ZCBA 2V8OA 2TMKA 1P72A 1FMLA 3QKSB 1DARA 1W2HA 3IIMA 4JVLA 4JYBA 1XD2A 2QRNA 4HZUB 2O0JA 2QL6A 4IDQA 1X1SA 1XEWX 1XEWY 2F9LA 1R0ZA 3RRMA 3EPKA 3B1WA 4JZKA 2A5GA 3UWOA 4DUGA 4NYIR 1CULC 4UKDA 1G6HA 1TQ2A 5AUPB 1OH5A 1OFUX 3MCAA 1NY6A 3BRWD 4IVQA 1A4RA 1OXVA 1VTKA 3A8TA 3PEYA 1KI9A 1E79D 2GXUA 3FE2A 3CONA 1NKTA 3EZ2A 3TBKA 2YKGA 2WSSD 1E1RD 4MGYR 3T9KA 1G18A 4QBFA 1UM8A 1XEXA 1HTWA 2W2VA 4OHXA 4FMDB 1M74A 1HE1C 1DTSA 4X8HA 1KDTA 4ZDJA 1S9HA 4DSTA 1Q44A 1XTSA 1GZSA 3ZZUA 3ECCA 4Q18A 2HF9A 2NQ2C 2PLRA 2J0QA 4K8OA 2YVUA 5FR2A 5F9HA 3TRFA 2D06A 2L0XA 1BMFA 3PR1A 2WWIA 3B78A 4RD2A 4RZXA 1G16A 4YXWA 1N5JA 1VCMA 4M8NE 1H8EA 5B30A 3X1XA 3BOSA 1E6CA 5CYOA 1X86B 4RD0A 2ZJAA 4A6PA 1P62B 4XD7D 5G53C 2G1JA 2Q0HA 4JLMA 1N3BA 2ZJYA 5AJYA 3DDCA 3RRZA 5CDFE 2WJYA 3GJ8A 5KNDA 3IHWA 4KVAA 4M1KA 2AL7A 4M1TA 4UNNA 1XPOA 3E1SA 5HKKA 4TYYA 1XRJA 5CK4A 4PSAA 3ZYCA 1RYHA 1W4CA 2OT3B 4KFUA 1G4AE 1P61B 2RB4A 4B75A 2VO1A 1KJWA 2FPKA 4D26A 1CU1A 4EUNA 3HR7A 3K0SA 3L43A 3BJIC 4AYXA 1A82A 2JIZA 2WKPA 4RSGA 3H4MA 4TLEA 5EZ6B 3ICEA 1JJ7A 1SVOA 4L4UA 4Q66C 4A82A 1U0JA 1Y3AA 2A30A 4CF7A 4WVFA 1CR0A 1XP8A 2ZJ2A 1QHHA 3EZ6A 1N5LA 4FN5A 3PITA 5KDOA 4S2EA 4YC7A 3W5JA 4NPHA 1VCOA 4G3XA 1NN3A 4RFSB 2NPIA 1BYUA 3QENA 5JFGA 5KSZA 1WB9A 3SQWA 2A9KA 3TLXA 2ASEA 3PV0A 4BFSA 4AG5A 1G8GA 2P5TB 5FUYA 3P26A 1HURA 4OHZA 2XB4A 2ZRIA 1BYIA 1NVVQ 1KO8A 3HYTA 2OG2A 2VBCA 1UPTA 3LX8A 2QSYA 2VP2A 1SXJB 2C04A 3DZDA 4XOIA 1SHKA 1T91A 3F3YA 3FMPB 2AKAB 4JBXA 1COWA 1Z0IA 2VLIA 2DWQA 2PCJA 3JVUA 4X8MA 1P5ZB 1U98A 2ZSBA 1YE8A 1F2UA 1XXHA 4D4KA 2J7KA 4EIWA 1XJQA 1ANKA 1JQLB 3CF6R 4HB4A 3GMTA 1YRAA 2QM8A 1OIVA 1ZD8A 1U94A 1LFDB 4PQFA 3SJBA 1T8TA 1VPLA 1Z06A 3GJ7A 1X8JA 3VR4A 4MDEA 2XOKD 1XD2B 2QTVB
chains in the Genus database with same CATH superfamily
4PIMA 1GGHA 4Y2SA 2HC9A 3N8GA 1I14A 3GCGA 4O2BB 1OZAA 1EDZA 1FU7A 4HRNA 2N75A 1V87A 4DNPA 2X9VA 2CHVA 5AM2A 3RVRA 4GP9A 5EPOA 1U8XX 3BH0A 2HRDA 1YU6A 5HM6A 2QUAA 3WLJA 2FJUA 1QJ4A 1W5AA 3OP1A 5AVUA 2VPXA 2XUOA 4C0EA 1T2DA 1E9SA 3D59A 2DYSE 2IHUA 5IT0A 1P1BA 4D45A 1FS5A 4EW1A 3RUAA 4PLGA 2BEWB 5DHFA 2X41A 5BWMA 3AR9A 5BN3A 5TY0A 4UBNA 2JATA 1E0SA 1ZGGA 5G0UA 4ZOLF 2V1XA 3K9LA 3AEYA 4LZWA 3O4HA 2PT5A 2G7ZA 3T7LA 4QQNA 4XIYA 2GPAA 3SQVA 3B3AA 1WESA 3NP9A 4NBUA 2JGNA 2OD7A 3EODA 1H2ZA 4HUQA 3GFRA 3RABA 3PE4A 4X97A 3AIMA 4CFSA 5F5NA 3MHTA 4MVTA 4PX3A 4HFGA 4OL0A 4YXFA 2VCEA 3R3ZA 2NP6A 1SXJD 1QV9A 3ECAA 1U0OC 2XZLA 2JNWA 3AFNA 2OESA 4ZCPA 1J0BA 2ZUWA 3OEEA 3KDEC 1QGUB 4U3JB 2LKCA 1FJGB 3H0CA 4WN9B 3CYFA 3EVAA 2YYYA 9LDTA 3F6BX 3MTJA 1OZGA 2OYSA 3OHPA 3EWAA 2KLHA 1YGYA 5IAGA 5BT8A 2BKUA 1U5BA 3W06A 2R751 1I3LA 4LF6B 4EA6A 2XOXA 1PJ3A 2Y66A 2YH2A 1E98A 3HJNA 3DEAA 1JFSA 4TUUA 3IIKA 3IOBA 4H4EA 4JBGA 4MI9A 2NM0A 5FA6A 3W2HA 1H8ED 3DE4X 3Q15A 5EN5D 4D3SA 1K1EA 5BVGA 4PH4B 4P7KA 2EEPA 1NZNA 4JBIA 4YRZA 5K0LA 3O8QA 1UAGA 3G2TA 1DX4A 1K3FA 4QT4A 4JEHA 5E1OA 2PVPA 5TABA 3ULEG 3B6ZA 2F43A 4MCJA 1MB9A 4YC9A 4GOKA 4P0TA 4TXLA 2EJVA 3VMFA 1KO5A 1L3CA 3FTXA 1NUTA 2FX3A 3GJ0A 6ABPA 3JQPA 3RKSA 4LA4A 1XO1A 4JLOA 1C9DB 1W34A 3DYBA 3JQ6A 3GZTB 4G0XA 3H6KA 4HBDA 2XAUA 1QQ7A 2C3UA 2W2XA 3VH4A 3OU2A 3Q1DA 3M6IA 2Z1MA 3ZN3A 1NR7A 4WLNA 1KSFX 4AZ0B 3O93A 3KZNA 5DBGA 1PEKE 1S2NA 5A5EA 3SZ7A 4LZLA 3L18A 2VGXA 2NYJA 1S2IA 2FN7A 4BBPA 1N9AA 3A3YA 1Q2ZA 3PFCA 5HBGA 2H2FA 2RR4A 1H0KA 2O6HA 3D6NB 2BGJA 3PNKA 4ZU3A 1S2LA 4WNDA 2I1JA 1URPA 3A1SA 4HX2A 1DDGA 2HLDD 1MO4A 4I55F 1VZ2A 3GMIA 4PX9A 4N4AA 4E6HA 3CLHA 1RWPA 5LJIA 1I24A 5EVJA 3EBPA 2IDJA 5L3QB 4RQUA 1YJ8A 5I01A 3RIHA 1ZGAA 1CEQA 3TUZC 4JHXA 3IP7A 2BBWA 1YMUA 3A9UA 3S70A 2BSAA 2Y69E 2GYYA 4HX5A 2TECE 1WXDA 3T3EA 3PREA 2P57A 3AEQB 2CNKA 4LJSA 1ND6A 3QRWA 5LB4A 2JCXA 2B21A 2WHXA 4K5QA 4FC8A 4JKYA 3LW7A 4EPVA 1I4OA 4LN1A 3WJAA 2G5TA 5CH5A 2C7RA 1LLUA 1YB6A 3UJDA 2G4CA 4CCWA 2ECFA 2HFJA 2FFRA 3I2GA 5LDDC 5IDVA 5JZOA 3DL2A 4OMDA 4OJNA 3FH8A 4LY0A 4CF4A 5DU2A 5D84A 2E87A 1EFPA 2ZE6A 5CURA 1C30A 4X1YA 4IDCA 4XJSA 1YAHA 2WQ7A 3RUPA 3SXPA 2DPGA 2OCYC 4QDOA 4CDMA 1TU4A 1BMTA 3F5QA 4QXAA 2PDAA 3WP1B 4XYBA 3HJBA 4YMTA 2HO4A 4BKRA 1BCSB 3OU7A 2BBOA 1OXKB 4U1RA 4LJLA 2XS8A 1QVRA 1I3NA 4QDJA 1S1CA 1NY5A 4G1UC 1TQ6A 2IV7A 3G5TA 1JU4A 2JHFA 3PC2A 5GVSA 2VPWA 1K92A 5JZSA 2DU8A 4FO9A 4UATA 1L5WA 2FW7A 3AUUA 4FXOA 2YJZA 3I61A 4F6RA 5BN4A 2GSWA 3E5MA 1EJ0A 3V1TC 1Q2XA 2XV1A 4G23A 4AY3A 5E6RA 2EDCA 2NTNA 1E5DA 5J4KA 3TDKA 3LGSA 1N4RA 3ZZNA 1C29B 3LSTA 4MV6A 1XFAA 4LYEA 1B8OA 3KTOA 4LJYA 4RF5A 2Q5OA 4UAUA 4FR2A 5B77A 1TPYA 1R0YA 3WLOA 1L5KA 4F2WA 2FI1A 4JLBA 1YE3A 3H2ZA 3WYAA 1T0PA 4I8XA 3C3JA 4UP5A 5HCIA 3SICE 2X1LA 3V8NA 4ZOLB 3LZDA 4F52B 3GUVA 2QR5A 4KV9A 4LYGA 4JB8A 5KSYA 3OTOB 3ESXA 1OBCA 4FOPA 1BROA 3R20A 4L95C 4MUEA 4D41A 5CECB 2CHZA 2RHLA 4EQFA 5IM4A 2H3EA 1PZMA 1BRTA 1VE6A 2VSYA 2FPGB 3ZIMA 2ZRCA 1FZTA 4JVNA 1ZN2A 2PLWA 1H6AA 2AUTA 3LKVA 2QP3A 2WQZA 1E5QA 3O9MA 3C5KA 1NVUQ 4N2SA 3TNFA 4O3MA 5G0SA 3GHYA 5CHEE 4YIHA 4HXFB 1DTWA 3LZ6A 1IOVA 3BL6A 1X1BA 4ENPA 1U6JA 1J49A 3QG1A 2F64A 3NOVA 1FXWF 5EUBA 1H0HA 5DKAA 3VVMA 2I33A 3VO8A 5HFAA 1M2KA 3F1KA 3DPUA 1QFXA 3QXHA 2J9ZB 5EYPF 5LXTF 3WMWA 4EHBA 4DVJA 2PKEA 1BE8A 1KMQA 1EK5A 1ULTA 1X4UA 2YY5A 2CE7A 3OD5A 4AXHA 4BE9A 5HI7A 4Z8YA 1SQ5A 2OWDA 2NYUA 3TQRA 2PKQP 1I1NA 5JHBA 2CWWA 3RRNA 4FIDA 3LWZA 4H9DA 4JGGA 2P7HA 1EX1A 4O1HA 4PRLA 1U4NA 1YB5A 1WG8A 4MGKR 3QKTA 4PNPA 1QP7A 1ZKMA 3BZUA 3LWDA 4DM4A 2HSEA 4QRHA 3I34X 2YWHA 2HSDA 4X90A 3S68A 4TLBA 1KETA 5B2EA 2ZZNA 2WP8J 4X9XA 4XQ9A 4KN8A 1LKZA 2AWOA 2W00A 1ZVVA 2XCOA 3PGLA 4TN5A 2IP2A 4E7OA 2J32A 4YAJA 1XVAA 5HIAA 4GA0A 1U04A 1K8XB 5PNTA 1SKQA 1QTRA 3K5PA 1NKVA 3PI7A 3V7UA 4D8TA 3R0ZA 4B3RB 3DHYA 5KC8A 1Q6YA 3OA2A 1U8AA 4Z7JA 4QM7A 1H1LA 1Q1BA 1YRHA 3EN0A 1Z5GA 5TVGA 5L45A 2HU8A 2B7CA 3MQ2A 2JZNA 3O9VA 2VG8A 1HETA 1U63A 1D6MA 3ELBA 5AW4A 1X7WA 1WEHA 1R2QA 5C46F 4ZYUA 3VVCA 1LCIA 3Q8KA 1RAIA 3GRAA 3R0IA 4CLHA 1M34A 2BP7B 2W90A 4R1QA 2HCTA 2YWJA 3KXKA 2I54A 3S40A 4IPTA 3X1ZA 5ENDA 5GM2A 5U1PA 3LCUA 4LQ4A 1DC8A 3RC3A 3D4LA 4V0KA 3LJUX 5C3UA 5DNUA 4CKWA 3HWWA 5IKXA 3PUXA 4ZDTA 3ZGQA 4NY1A 4PONA 1C3OA 2CLOB 4OHBA 2KM1A 2FXVA 3S3TA 2L43A 1YQXA 2BFPA 3A25A 3G8BA 1PJZA 3WGMA 3CW2A 5F2NA 2JAQA 2Q2NA 2EXUA 5H5JA 4Y1EA 3GLIE 1AXGA 2IBMA 3OZ7A 3RUDA 1RYFA 2EF1A 3HCEA 5K0ZA 2B35A 3GPCA 1VJ5A 2DBYA 4GFDA 4MV7A 4G86A 3STYA 4G36A 5CVVA 1YUBA 1XUOA 4QOHA 4GXNA 3VISA 1KFJB 3NIWA 4G8JA 1G3RA 3TQIA 3JYQA 3OMXA 3LX4A 1OBFO 1IN6A 4KNVA 1FDOA 4YV0A 4LRSB 1WOMA 2MTBA 4LY6A 3I2JA 1NJFA 2WXQA 1G21A 3DZCA 2P4UA 4O0MA 1EG2A 3UAYA 1HQYE 3H2BA 1NRWA 4GDFA 1T2UA 2I3AA 2J3EA 2XXJA 1EZZA 5HA5A 2WBLC 2Z2ZA 1NP7A 4BHWA 4KVFA 5M7EA 1NSTA 2AKEA 4M0MA 4BMZA 3FZYA 1Z26A 1S89A 4QUIA 3EUAA 3WB0A 3LLVA 3IR7A 2FZCA 1NDQA 4M9SA 2X6RA 4S1PA 2I0FA 4Z4IA 4GXTA 2WXJA 1Z15A 4MVJA 1FXSA 5GQSA 2J4FA 3TXYA 2JK0A 3BMNA 3VTAA 3GLFB 2HK9A 4BV3A 4FMDF 1AKEA 4AJJA 2D7JA 3O3NB 3KAJA 1F17A 2V97A 4QSHA 4JKIA 2WICA 3L41A 4Q9AA 3D8SA 4R6XA 1NHGA 1SUCA 3IP6A 3DKPA 5BPPA 4YVOA 3OKPA 1JDBC 2G1KA 3KJZA 3LRTA 5E2AA 1Q91A 3KJIA 1F9AA 1E2FA 1W36C 3MWGA 4GP7A 4WBXC 2Z30A 3AXTA 4GR5A 4BLOA 5MHTA 3N9OA 1D5CA 1Q1ZA 5CLJA 3UKOA 5B5SA 4RPGA 1AIPA 2CUNA 2O2EA 1NQXA 5FXMA 3UT5A 1ZOIA 2G82A 4UOEA 1A9XA 2HN9A 3K1JA 1H2YA 3VDQA 2HYDA 3GDFA 3MUNA 1L7VC 1L4KA 4NE2A 3IKVA 4IOLA 4BV8A 2B92A 2ZVJA 1W4RA 2C5GA 3CH6A 3GC6A 1ZGHA 3PJFA 4ZHSA 3IPLA 4BTLA 4CV2A 1G8HA 5LMZA 2W4IA 4JBNA 2DUMA 3D02A 4EKYA 1KP3A 2XRZA 1YCDA 3CHYA 4IGFA 1Y48E 3LFTA 2AXEA 2F6JA 1WHTA 2VHCA 2JDID 1WUTA 1BQ4A 1IY9A 3CR7A 5JAMA 5J2UB 3N0WA 5K8TA 1ZD4A 4KLZA 1F1JA 4UUNA 3JQ7A 3QMPA 1RI5A 1J21A 4AMBA 4W6ZA 3G7NA 1R4MB 1RQLA 3S7BA 3V2IA 1S63A 4D80A 4N3CA 1KOGA 4JP8A 2HQOA 4H3VA 4P36A 3D9HA 5EYPB 3M0EA 1OREA 3EVFA 3K2QA 1P3DA 3T94A 1P5FA 3KAKA 3BJRA 2Z6UA 3L0PA 3ETDA 1PKEA 5F4BA 4TXPA 1PT8A 4F1SA 3F2VA 1Q7TA 4N7JA 2O1SA 3G9XA 4MSUA 5TJ9A 4R31A 5T4HA 1JCSA 1S0PA 1CJVC 4JJGA 1NVAA 1BTOA 2OLJA 4MS1B 2GRLA 3D31A 4II2A 3HVEA 3RTBA 2V6BA 3DMPA 1II8A 3JALA 1NBEA 3RFUA 5B7NA 1OHHD 4DCUA 2PMWB 2EBWA 4HGNA 3QYPA 3KV5A 4NESA 1AZLA 1GOTA 2QM0A 2QK4A 3STUA 3AMVA 4BKPA 3P0HA 3QFHA 1N57A 2BTOA 2YFHA 4EYEA 1PSZA 4AS3A 2QY9A 1UEJA 2EBFX 3WQRA 3QTBA 4Q7MB 4PRZA 4OFWA 5A0VA 3GD7A 2ADOA 2ONKA 4UUCA 5IBRA 4FMPA 2CFTA 3AQIA 1QDLB 3E5NA 4I5DA 3KV1A 3JSXA 2R84A 3E03A 5B1HA 4KACA 4H27A 3E9ZA 3FNIA 3PEWA 4OLAA 1DLJA 4A2WA 5A4MS 1SO8A 5E6UB 1NJ1A 4Q9LA 4RENA 1L5OA 4EG8A 4JU9A 3HHEA 2YZ7A 4HLUC 1R6BX 1B16A 1Y8RB 4XQCA 2GEVA 3UMGA 3BMCA 5A7DB 4HUQB 1E7UA 4OJTA 3RYTC 4BQQA 1EIWA 4RWEA 2VP9A 2XOKA 1N0VC 2R03A 1SC6A 4G0MA 1KERA 2BUGA 4N6GA 4XGRA 5LPNA 2DETA 1ZR4A 3SE7A 3KUKA 1TGYA 3HDGA 1UDCA 4ACLA 2BI4A 3BK2A 2NVBA 2YN4A 1M73E 4GE0A 4U8VD 2MWMA 3GT3A 1JLHA 1WW2A 4YT4A 2ZANA 2Q1TA 3HR4A 3PNOA 3E84A 3K5WA 4F0JA 1IEQA 2IONA 1LFAA 2JLRA 3PZ4A 1E3WB 3VR5D 4ZI5A 2RE8A 3CHMA 4YIKA 1RXEA 3THYB 4NBVA 3BWDD 3MMXA 1T8UA 3VGPA 1GUFA 4PHHA 3JYNA 3FTCA 1BNCA 4UM5A 2PZIA 2DHRA 4QBGB 5DHPA 2VYFA 4YAGA 4R8VA 3CNNA 4JDPA 4YROA 2OEVA 1F62A 1TC1A 2QMHA 5DNCA 1Z7YA 4DSAA 2F67A 2H7VA 3T4PA 2XYVA 1E3TA 2BFCB 2OP1A 2VN8A 5FRDA 2X2PA 3AUJB 3NZEA 2KBXA 2DJ5A 3K20A 3QVMA 2OAEA 3ELYA 1PK8A 5EMMA 1EWTA 3SBDA 1DJPA 3JZDA 1Z4JA 3A6PC 2XGGA 3COVA 4QXRA 2ARKA 4MQMA 2QZSA 3WIOA 2C7VA 4LWQA 3SNXA 2PRZA 3BQMB 1SXJA 4B6EA 5I48A 3A04A 2FPOA 4DC0A 1PZXA 3VKHA 4TV9F 4KMRA 2R4TA 2PX6A 4B3DA 4KYVA 2O2DA 1IULA 4M7CA 2I87A 1PWHA 4ZVTA 5ELLA 1W2HA 5K0CA 4HZUB 5FI3A 3CV3A 3MKQA 5IU6A 3BRWD 7MDHA 3RUCA 3W5AA 1ZZGA 4NF2A 1KI9A 5DWVA 2NXEA 3UMBA 4JZYA 4A27A 1E1RD 4FONA 4MGYR 4MW4A 4RK5A 1UM9B 1YDEA 4FMDB 2INGX 3LU1A 3NOOA 2PLAA 2HF9A 1Y33E 3JQCA 2HAEA 2NO5A 3OEWA 1L1FA 4ROTA 3DQZA 1T8PA 5HJ5A 3C6XA 1H8EA 2XCIA 3PNYA 4A6PA 2ZJYA 1RYMA 4G0WA 1MB0A 4ZGWA 1GN9A 1XRJA 3RAGA 2PUDA 3ZYCA 1QGED 4CMEC 4JXKA 2RB4A 2Y92A 2VO1A 2QN3A 3F7OA 1Q0RA 4M76B 3ZY3A 1SHJA 4NLLA 5BV7A 2BEWA 2J85A 4LMBA 4D9CA 4O5AA 3DE1X 4I0WB 1ZWLA 4YRFA 3MTBA 4NPHA 1EYZA 3M7KA 3A28A 2P69A 5FUYA 4BO6A 1NC1A 4OKNA 3ZYMA 3DE6X 5LQJA 1E64A 2AKAB 1Z0IA 2FTKE 2PZJA 4F1JA 1YE8A 3L04A 4YT2A 2ATEA 2JGIA 2VSNA 4Z4FA 1LFDB 1T8TA 1V2HE 2H31A 1BAPA 2QTVB 5LQAA 1P4AA 3ZV6A 1KKLA 4KE6A 2WJPA 1WRBA 4L0QA 3AZPA 2KGIA 4NU5A 4I14A 2FWIA 4I7DA 2CXPA 5EIHA 2Y0BG 3D4NA 3L8HA 3TSCA 2ATIA 1CY2A 1QGUA 2CUTA 2L69A 3T7JA 4U3JA 2ABWA 3OZUA 4WN9A 5K6TA 3KWMA 4I9UA 2GPWA 5DM1A 1Z7GA 2PUFA 1C30B 4D92A 1U0EA 2AOUB 2PR7A 3ER9A 3CZ9A 5KTPA 3QXJA 4TQUS 3K6SB 3LNCA 3PGVA 1YIDA 1KYZA 4FDVA 3C6ZA 4FJ2A 5E8RA 2D74A 1SAYA 4MEBA 5LZ7A 3RS9A 3I42A 2IQ5A 2AHRA 1PL7A 3BU8A 4GRDA 1U11A 4URVR 2HCRA 1HM5A 5CDGA 4COOA 3L5OA 1T6NA 1Z3IX 3HXTA 1UWVA 3WBFA 2ETVA 4F6RB 3QJYA 4JLAA 4LRZA 4US2R 1ZUWA 4DV5B 3FUDA 2GKOA 4EFNA 1CR6A 4GP6A 2XADA 1LDMA 4R98A 4J8SA 5E6RB 3HN6A 3MJFA 4R1NA 4GXRA 3IV9A 3C6MA 3DTTA 5K9ZA 4S05A 1XTUA 3G8DA 4MV9A 1ENYA 5B6PA 3ZDAA 2VP6A 1WPRA 1GNLA 1T9DA 3ZI4A 2Y1LE 1GLVA 1YFZA 3GPLA 1Z07A 1MF7A 4R40A 4EO4A 2R47A 4FHCA 3LQRA 4FOLA 3A6EA 4TXRA 1NYRA 3UNXA 4ZQIA 1SNYA 4AS2A 3KBBA 3M89A 2Q0SA 4G8LA 3N6RA 5LP6F 3CRQA 1V9SA 1J8QA 1MO6A 3DONA 2V9ZA 4OB6A 1RRFA 1DAFA 1DIOB 3KJQA 4MW5A 3TGOA 4YCAA 2QAGC 5FBKA 4AWBA 3VPSA 4B31A 3CEPB 4FFVA 3TZHA 3DVLA 1D6JA 3U1VA 3BGIA 4D9NA 5JPCA 4FHGA 3JQ9A 4MKRA 4P81A 2KXPC 1X8KA 1DTWB 2VSOA 2DH6A 1FS4A 3EUFA 1DQNA 3QFCA 1XZKA 4J7AA 5LVAA 4YAOA 1NI4A 4C7BA 2W2PA 4PX5A 3HV0A 3VPAA 1Y8AA 1NW5A 3RLFA 4BESA 2FQXA 3AEQA 2WXOA 3A58B 1DOAA 3WWOA 5AI5A 4M4SA 1HYEA 1FB5A 4LE1A 1DP4A 4ATZD 2AQKA 5KSOA 2E21A 3UMVA 4F4CA 2C7PA 3FGNA 4CKYA 5L3RA 1QB7A 5DISB 2I6HA 4JKOA 2WIFA 5FL3A 5JNVA 1GVHA 4JB3A 2JJMA 1QYDA 3DVSX 4DLAA 3OFND 4EHMA 3QIVA 1YRQA 1Y34E 3ORSA 1MBMA 2Z6VA 3G3EA 4ITVA 1E20A 1M67A 1C2YA 4B2PA 3K7EA 4RZ2A 2EGGA 3MT7A 4A5OA 5AICA 3E1GA 1B89A 5DM60 3G2PA 2P2NA 3CN9A 1UJBA 4KZPA 1QQTA 1VRCA 1EGAA 2XW6A 4ZQFA 2C4WA 1EFHA 4K1LA 3NBXX 1QHGA 1JHDA 3PFFA 1JIKA 2PWZA 4KPYA 5BV1A 2I78A 3BZBA 3IUJA 1HOTA 4NOMA 4CF6A 4WD3A 5KTSA 3JQRA 1FP4A 4GTQA 4TV9B 2YYSA 4KXQA 3MRTA 1MB2A 2A35A 1RXUA 2UUBB 1XTVA 5EJIA 5I3LA 4C6TA 3NP7A 3OQMA 3HC7A 1IM8A 2B5WA 3CEJA 4KRYA 2J08A 1ONSA 2FSSA 1N1DA 1W9HA 1H1LB 2XMPA 1G3IA 5J9FA 3NOCD 2RHOA 1U1IA 3H83A 4MP8A 2Z09A 3NVMB 5IAEA 3OOHA 1NLFA 1MYOA 2D2EA 4IHKA 5CCMA 1NBOA 1UFQA 3KD7A 3RE1A 2J49A 3KE9A 3OPMA 2Q2WA 4BV9A 2JJ8A 4JN6B 4WZBB 5JMPA 4IXDA 3SQOA 2EERA 1GGMA 3L7IA 2O3TA 2B0JA 2OYCA 5M2QA 1SXPA 5IKMA 1GIAA 3KQUA 4YLYA 3BFKA 4MI6A 3O83A 5KQLA 4ZOLA 3TTTA 1CV2A 4JLVA 1JH8A 4KWTA 2EXXA 2BFWA 5JD5A 1RZ3A 1C3OB 5F23A 1TT5B 1UJ6A 3PUVA 3IOCA 4AZVA 1SKYE 3PQEA 2QDKA 3ZW3A 4HBGA 2A7QA 3O4GA 4NCJA 5AHOA 1T3ZA 2CGEA 3IGFA 3O82A 1HDGO 5EESA 2FPGA 1HR0B 3VR1A 2RI7A 3QB2A 2MR6A 4I08A 2OA0A 2P91A 5JNSA 5AUOB 1YOVA 4EYOA 4CI0B 4U7WA 2F0YA 5AN8A 3WRYA 4EG6A 2PBFA 2X7XA 4HUJA 3OETA 4KQ2A 2JKVA 3VBCA 1CQZA 1G60A 5MF6A 2XNHA 3U31A 2ECPA 2MSEB 5TLSA 1G21B 3C16C 1FVHA 1EA7A 3SBTB 4JEUA 3BSFA 4E4YA 4MH0R 3FVWA 4MMXB 2PXXA 2Y67A 1HBJA 1PRYA 5EINA 1IHOA 1CUZA 4D9FA 2V3VA 3RKVA 2BCJQ 2H2IA 3GAAA 4LQCA 2PWBA 4Z7OB 5A3VA 1IFXA 1RHJA 1TAQA 1PHRA 4RHUA 3O4ZA 1AGPA 3O1JC 1QCCA 4EATA 2VQ2A 1X7XB 1XGKA 1ZIPA 5KVCA 3OBIA 4ANUA 3L92A 3N9MA 1KFBB 3UWMA 2GILA 1EQUA 4GVXA 4OQNA 1AXRA 4R51A 5EKTA 2WAAA 4NMMA 1P80A 3WO1A 3OLZA 5BRAA 4JK3A 4N54A 3L8GA 1WZIA 4YAWA 1TK3A 4PR0A 1OGJA 2A5JA 4LEIA 4N5HX 1LF8A 2ZATA 1EXDA 3EE6A 2XB9A 3ZHEA 4FHKA 4OO3A 3NG1A 4WUVA 3WGTA 4NZMA 3RTDA 1Q3KA 2WD9A 4IIUA 4QYTA 2EKDA 4JL5A 2Y4NA 3GFBA 4ZV4A 3ORFA 1B3BA 5GJCA 2Q5QA 5FWXB 4DABA 3R1IA 3K16A 4DRYA 2GZ3A 4QNNA 4HDAA 4HDRA 4R8MA 3TLKA 2C1XA 1JQEA 1E3SA 1XNHA 4KGZA 1AV6A 3EB5A 4C07A 5JHHB 3N3BC 4IO0A 4UNQA 2FW0A 4GLFA 1T0HB 4OI4A 2HYED 5ICCA 4PGGA 4AY4A 3G13A 5B3AA 1E0JA 3M34A 2DHCA 4Y0VA 2PIAA 1E59A 1IWOA 1DC4A 1E1CA 5F78A 3FUKA 5F52A 1YA6A 2AB0A 4I55A 1QHNA 5CDHA 4GZMA 1OX4A 2A9FA 1Y1PA 1NDHA 4G56A 3C3PA 3NBKA 4RM2A 1O5TA 4UQXA 3WHIA 4Z7NB 5BQOA 4LVNA 3DXKG 5DYWA 4HB2A 3WLAA 3U9TA 3TWRA 3TSAA 2H85A 2HBQA 1MQ8B 2X4GA 5TBNA 4JVMA 3ETGA 2RJOA 2EFEB 4OHPA 3U7QB 3E61A 4Z4GA 4F96A 2A9QA 2HWKA 1QSGA 1D1TA 3IMKA 3WSVA 2XEXA 3FVVA 3TIGA 1A5ZA 4HOYA 3TLBA 4NRDA 1UK9A 3UGQA 1VP9A 5A4AA 5AAOA 3IE2A 4WZZA 4PE5B 3I5YA 2WU1A 1MRZA 3HLTA 1UP7A 4Q0MA 3A4VA 3OI7A 3UMFA 5C1BA 1RZRD 3L6EA 5F3RA 1JSRA 5HS0A 3P96A 5F5LA 2FN8A 2OOEA 2I6QA 1WE9A 1ZISA 1DXYA 3K05A 1N8NA 1Q17A 4UQLA 5EIBE 3GDWA 1ZBDA 2Q3DA 2RBKA 1A50B 3OICA 1CNEA 3QIAA 4FYKA 3H5IA 3NM5A 1R0SA 2BHRA 2JG3A 1II8B 1W88A 3HUTA 3GFQA 2CMGA 2DF8A 5HOEA 2HK6A 5AH0A 3QVXA 3O9ZA 4BFRA 1R64A 1IYGA 1E5XA 3ZE0B 1ZSNA 3IAM6 4CE6A 3LL4A 4H6XA 4YDOA 5D0OD 4RVCA 2N3ZA 4K46A 5BYAA 1TT7A 1ZA2A 1ACLA 1HF8A 1KY3A 2JDIA 2GI4A 2XZTG 3OZIA 3T3HA 1CSEE 1WEVA 2HF2A 4WKGA 5DE3A 2LAIA 1HYGA 2CXNA 2XT9A 3QX3A 4QO8A 1DMSA 1US8B 4QRIA 4ZVOA 3P0RA 3W5DA 3GLFA 3LYAA 1VCNA 2GKSA 2IE8A 2IUEA 1VG1A 1H8HD 5DLEA 3FYHA 5EP2A 2AFIA 1HYJA 2ETXA 2D0DA 5KTRA 3TJPA 1SZAA 1PYGA 4J0CA 4WPGA 1D8DA 3BPSA 3V1YA 1P4GA 1JZQA 2A84A 4B71A 2H4JA 1GSIA 3R76A 1XTBA 1E8XA 5J40A 4N6OA 1OHHA 5MGNA 4FE4A 3MS2A 5EKQD 4XD2A 5EJEA 3CTPA 3IQFA 5EXEA 3BB1A 3L9TA 5A05A 5KOHA 2J87A 5BQ3A 4Z0RA 4PZAA 4DLOA 3E8XA 4BFUA 4UMEA 2MNYA 1FMCA 5LR6A 3NDJA 3RPEA 2QUJA 2C7BA 3WJ2A 2DECA 1CW2B 1LNSA 1JPJA 3LBNA 2WPVA 3B48A 2JEZA 2DRIA 4I9NA 2XTJA 4DIOA 5CERB 1WEWA 4FZVA 3WIDA 1Q1QA 1R5OA 3KD3A 5KNCH 5ICEA 4JOQA 1QF6A 2WSIA 3E4DA 2Y0DA 3ZH2A 1BN6A 4BRWA 2JA1A 4GZ6A 1VKNA 1KLXA 2JFPA 2GAAA 3FDFA 1I1OA 3EK2A 4B4VA 3S6JA 1LK0A 2DQKA 4NXMB 1UXJA 4FWTA 1EVIA 5FLYA 9LDBA 5BSEA 2B5OA 2ZAGA 3IHLA 2XZOA 3OQNA 1JWLA 4FLHA 2ZGVA 4PR3A 1TTQB 1Z5NA 4TLLB 1CQXA 3OPNA 3V42A 2GTHA 1B15A 1SKMA 5DF1A 3CNHA 4HVCA 1FXWA 2H7XA 1R4MA 4MP6A 3USZA 1FNBA 3K09C 4DA8A 3VYVA 2UYQA 5EYPA 4JU8A 4CV1A 4CN8A 3RSQA 2QJRA 3ZDQA 3FKSD 2VH2A 4K3VA 1QTNA 3G02A 4BTAA 1EVJA 1FTYA 2OBMA 2G83A 5CBKA 4FC7A 3M9WA 1I0LA 5LKUA 3KG2A 3ZXSA 3VR5A 2XOYA 4H1VA 4M0DA 4MS1A 4DIMA 4QDUA 2HWYA 3MKQB 3AVOA 4OKSA 3SOWA 2VTKA 2XA2A 3WLQA 3F67A 3N76A 2OHOA 1ZD2P 3C3KA 3K8YA 3SYNA 1P7WA 3OX1A 3E2IA 4OQXA 2DULA 2FWRA 2FO7A 4ZT5A 1FRZA 1B23P 3JXJA 4CF5A 3JTEA 1QONA 3EG9B 3CKCA 4UFPA 3W5BA 1XMSA 4DN6A 3RVSA 1O08A 4YMHA 3PWZA 4E7PA 4RJIA 2HRQA 3CNLA 3NHKA 2IJGX 2F3UA 4EZBA 4X7MA 4DLUA 2M6RA 2PS1A 3MT9A 4RZIA 3FWKA 1B2RA 1P44A 1PT7A 3KEQA 4GX0A 4D3YA 5FZSA 3IPYA 3SO8A 4KMOA 3L8YA 4INZA 2B9VA 3TQFA 1EIZA 1M6WA 1JDZA 2JFUA 3FETA 5E6UA 3MMSA 1Z83A 4MUJA 3UB2A 1OBVA 3WGUA 1K8YB 4S1VA 3LY5A 1KGDA 3IV6A 2QRPA 1H6OA 2I2OA 1Y8RA 4LJKA 3BXHA 3ADDA 2BEDA 4FGZA 5KSWB 1UUFA 4MW9A 1Q7CA 1Y3HA 3CHPA 1SBCA 3GDHA 3LZCA 1KQPA 1TC2A 3EHQA 3LUJA 4DEVA 1IVYA 3OLCX 4RJJA 4QGSA 4LSZA 4KWHA 2J33A 5P21A 4GTPA 1PT6A 3BRWA 1GL9B 4U2EA 1DKQA 4IJVA 3ILYA 5TQ0B 1E1RA 1G41A 2RHMA 3EC1A 2XVAA 3U09A 4NNOA 5ENSD 2GBPA 2FO1E 5HUQA 2I1VB 4MWZA 1AQUA 3P9KA 1ZITA 4DV6B 1W9MA 1E3WA 4GMRA 1KNQA 3SOXA 5DGHA 3TTYA 3ZUGA 3THYA 5H8WA 2O8EB 2VJBA 2E6SA 1N54A 2Z1NA 1JNYA 3MTEA 4P83A 2NNLD 2VC2B 5KI6A 4KRXA 4ERXA 1VA4A 2O48X 3FCAA 1BD4A 4KR3A 3G5MA 5E2IA 3T9BA 3LXUX 3MSCA 5IT5A 2BFCA 4UWFA 3C97A 2OCDA 1W96A 2PSFA 3P9RA 1Y6ZA 5L3ZA 2BPOA 2BSQA 1JE0A 1PDVA 1RE1A 4KXLA 2PZKA 4LKOA 5ECWA 1P0IA 3S5UA 4QASA 3WL3A 4HLDA 4I4CA 4L7VA 2Z56A 3NT5A 3KSZO 4UU8A 4JR1A 4GPEA 5B2ZA 3B51X 2XXAB 2ZQ5A 4X62B 1TZCA 2NSZA 1SELA 1TZJA 3KQVA 2C9DA 2FG5A 2HR1A 5HIIA 3HGMA 5DHAA 3ICCA 1WAMA 2QZAA 5E7JA 4L8LA 2BN4A 4EHKA 2I65A 4F2PA 1YJXA 1N87A 4LOAA 4PS0A 2QPAA 3ASHA 1IVNA 1ZINA 3FTUA 1UEIA 3VU3A 4HZUA 4HVTA 1MJGM 2WIAA 1PWZA 2EG5A 4BO3A 5LUAA 3RWBA 5LQMA 2P30A 3P1JA 4HRYA 3HKEB 1UM9A 2IZ0A 3C8DA 2OAP1 4MCHA 5F7XA 4PXAA 5JY1A 1E2UA 5BXOA 3CCFA 4PGMA 2RJ3A 1YDWA 3WHPA 4BQSA 4PGHA 1H3FA 3R4VA 1X5BA 3T5VA 3D8BA 2FAXA 2G9QA 3B20A 4GNFA 3G17A 5TQVA 2Z9DA 1L5QA 1AY0A 4LCEA 3QBTA 2J45A 2IUTA 1Y8QB 4HQKA 5LDGA 4J4BA 1MC5A 3FYTA 3KKNA 1OT3A 3E82A 3DCIA 1XLVA 2FEOA 5HHTA 1NI4B 2WA2A 4EY5A 1NBME 4TTPA 2V5FA 3FKJA 4NOJA 5IXYA 4BFTA 3DZIA 5AJVB 4A55A 5JBIA 5BV2P 1VMKA 5SVYA 3QNKA 3NHJA 4B33A 3AC0A 5FUBA 4ADSG 1X81A 1ZAYA 2Y6UA 4JVLA 4JYBA 1PP4A 4L72A 2QTVA 2Q3CA 2VDMB 2F9LA 4OYLA 1R0ZA 4H4CA 2IY8A 1B1AA 4GLLA 5AUPB 3C43A 4J7CA 4G9GA 3EZ2A 3UUGA 1UM8A 5JO0A 1AUXA 5A23A 3O90A 1O1TA 4XR9A 4BNFA 4RGVA 1ULZA 5G55A 3CJRA 2IH5A 5ED0A 2DVMA 5EJFA 1FTGA 4KXVA 3ZU3A 1PDWA 2JHAA 1N3BA 1JIUA 2HSJA 3OM0A 5A7HA 4UNNA 2AOUA 2L5UA 4RIFA 4FTWA 4PSAA 2EJUA 1JEAA 3JYSA 4B75A 1W3BA 1WLYA 3K6SA 4MV0A 2ROQA 5GGXA 3G2QA 3H4MA 1OTYA 4KWEA 3SQLA 4A82A 1NXVA 3GA0A 1FP4B 4WVFA 2ZJ2A 1YDHA 3LPNA 1RM5A 2V58A 2RDMA 4BSZB 3TB6A 4BMPB 1GR0A 2DHQA 5KSZA 2Q0XA 4C6TB 3PZ3A 2EL9A 1QG6A 3P26A 4V2IA 1UOQA 1UPTA 4ENWA 2BRUA 4MHOA 3PUKA 2BDEA 3L9WA 4KB5A 4BGEA 5D1NA 2ZJFA 2VLIA 1Y5NA 1K08A 4P35A 3GZ4A 1DEAA 1XJQA 4TWRA 3UYLA 1D9SA 3IVXA 2RFLA 3P2JA 3MB5A 4IC2A 4PQFA 2Q4OA 1RPJA 2Y6VA 5KS2A 1UT5A 3W2EA 1Q11A 3RV4A 3OFNA 3QU2A 4P2BA 4PO8A 2IIBA 2ZT6A 2F3PA 5EJ5A 1EQAA 1Y98A 1XTJA 1M1NB 4MITA 1DBQA 3OLQA 2VHJA 3ROXA 2Z9BA 1LBQA 3AH8A 4ZI7F 1G38A 3IUPA 4GI5A 4WBSA 2IVZA 4NONA 1XAHA 3D3QA 4GECA 3CKMA 1A8UA 5EMKA 4QFDA 1M6HA 1QLJA 4JA7A 2UZGA 1Z6UA 2AOWA 4MGZR 2IXBA 3BXOA 5IS2A 1UKZA 4G89A 4U39A 2X22A 3FPAA 4QU8A 3HO8A 4X45A 1GGEA 3HKCB 1JYFA 1J0DA 1LBHA 1ACJA 3CUEF 1ADCA 3PTAA 3PZ2A 5JCOC 2BEUA 3EUEA 3ZHQA 4I6JA 2ZXFA 2B1JA 4ZYLA 1I10A 2IHTA 1CB7A 1KWGA 1A7KA 2GRPB 2BHNA 4MLDA 4GI7A 3H0KA 4JGIA 2PMEA 5IKOA 3OY7A 3CRRA 1X7GA 1YOVB 1Q0SA 4CHTA 5CIWA 3OTQA 2B6NA 5C81A 5J43A 3N9NA 2C57A 3SI5A 4GA2A 1RI3A 3P9XA 2RC6A 4WXPA 4KPFC 2GVZC 1NR5A 5SY6A 5BXYA