3LVRE

The crystal structure of asap3 in complex with arf6 in transition state soaked with calcium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
476
structure length
419
Chain Sequence
DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
total genus 120
structure length 419
sequence length 476
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01412 ArfGap Putative GTPase activating protein for Arf
E PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.950 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE02
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3lvrE03
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3lvrE01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lvrE04
3BOSA 4URUR 2V1UA 1N5KA 5CDFA 3IIMA 3CNNA 2PBRA 4B2PA 1ZM2A 4HLUA 1F60A 2QEQA 2R8RA 4IJMA 2QP9X 3AKYA 1Q0UA 3W8RA 2VHCA 2A5JA 2NO7A 4P4UA 2ANBA 4NKRA 1JXMA 4BLRA 2O8EA 1R5OA 2VF7A 4TYYA 1E98A 1RRFA 2CBZA 2H92A 3E2IA 4AD8A 1LFDB 3K0FA 3TR0A 2ZSDA 3B1YA 4IDPA 3FHTA 3WP1B 4A8JC 1XJQA 5FBLB 4HI0E 3BFKA 4QG7A 4DT1B 1VKJA 4G1UC 3PENA 3BB4A 4JLDA 4B33A 4D81A 3QF4A 1ZINA 4JSYA 3AM1A 4V0KA 1DTSA 1J8YF 1ZP6A 4QM6A 2XJ9A 1D9ZA 3GLFB 1AS3A 4BFXA 1KSGA 4DLRA 2C5LA 1L8QA 2JLSA 4KFTA 2D4HA 3MFYA 4FCWA 4RFSB 2YC2C 2ORIA 4C0LA 1TQ6A 3VKGA 1F5NA 2WOJA 1DAKA 1JR3D 2QY9A 4LJ5A 3Q72A 3T34A 3RANA 2WICA 3TBKA 1W36B 4X8HA 1FZQA 1W36C 3E5HA 1DG3A 1UJ2A 3RSLA 3LDAA 4A1FA 2BCJQ 3K0AB 3RWMB 2JLZA 2HEIA 2XB4A 2DYKA 4A8JA 1GL7A 4M9ZA 3QI2A 5AJWA 1E1QA 4A4DA 2IX3A 3QEJA 4HAVA 2JCSA 4HZIA 3CONA 2FGJA 2FJUA 2GCPA 4OQMA 1GNQA 3FMOB 3U3MA 1N25A 1HEIA 1F6BA 1KK2A 2VQSA 5CIWA 3PQCA 4P0TA 2RGNA 3LFUA 5J5CA 1N2CE 3KJHA 4QRHA 3P4YA 1US8B 3MG9A 1RE0A 5CJPA 3LLUA 1G7SA 1PLKA 3ZVMA 2D3WA 1KIMA 1A5TA 3IO5A 3BH7A 5FOUA 2LKDA 4C0JA 1TADA 2CJWA 4MKIA 2BMEA 4LDJA 3S1AA 3U44A 4A92A 2WSSD 1A7JA 3NDPA 4AWXA 3EPLA 3BERA 4P32A 4FD2A 2FFHA 4CDGA 3VNUA 1RC8A 2ZS8A 3MWYW 4B34A 5BN3A 2IS4A 4TTPA 4EPVA 1TF2A 1XTJA 1SZPA 2CVHA 4Q4JB 2OEPA 5TDHA 2VP6A 4IOKA 4N0DA 1QHSA 4H1VA 3IBGA 2WZQA 4R2IA 1R0XA 4F1PA 1OSNA 3V4FA 1OH7A 2ZRAA 3VHLB 2ZRHA 4UJ5A 1D6JA 1X8LA 3CF0A 3IO3A 4PQYA 4JVLA 4TLCA 3SUBA 2QZ4A 4Q1AA 5J4YA 2VP9A 4QJ5A 3UMFA 1XTRA 4B3GA 1NVWQ 4YMTA 4DWJA 2BOVA 3K0CC 5FL3A 3EC2A 3KUDA 2A5DA 1EESA 3VR3A 3NHBA 5L3RA 4M1OA 3DZ8A 1Z0IA 5FL7D 2XZOA 1D2NA 2QPAA 1A2KC 5E95A 3U4QA 3NBZC 1GVNB 2FZ4A 2WKRA 5SZKB 4HDQB 1LY1A 2HYDA 2O8DA 1GL6A 4BLTA 2Z83A 2VP5A 1P9WA 2D2EA 3I4LA 4XSGA 5BQ5A 2YYZA 1TPZA 2ZRDA 2ZYUX 2C9CA 4B71A 2DFTA 2GNOA 2OO7A 2WPDA 1YZKA 5A0FA 1G5RA 2ZRNA 2ZR9A 2OAQ1 5JJLA 1DO0A 2ASEA 1LV7A 1IXSB 2VL7A 3LW7A 3X1YA 1GRQA 4Q4AA 3BC1A 3THWA 2RGBA 3FWYA 3GLHE 1SQ5A 1FQKA 2PJZA 1N6KA 3N2EA 2ZAOA 4X8MA 4QGHA 2MSCB 4AURA 1P9RA 2IYXA 4HLUC 2GEVA 1VTKA 2IF2A 4ESVA 2F43B 2FWRA 1VDZA 1IONA 1XMSA 2AK3A 3K9GA 4QGFA 2CDNA 3WYGA 2G77B 3AVWA 2E1RA 1C9KA 4WBSA 3SZRA 1KI6A 4AI6A 2Q6TA 1Q1EA 4Q4AB 3THWB 5KPDA 2C9OA 2ODEA 3RWOA 1U8YA 5FOXA 5TB5A 1RPZA 4PQFA 2QP3A 3WHKA 2WIAA 1G291 1D9XA 1MRNA 4ABYA 1VYUA 5SZJA 2ONJA 4KBFA 3RC3A 1E2LA 1QHGA 2ZXUA 4ZCMA 4OHWA 5DYGA 4RD4A 3A4LA 3QENA 2DBYA 3QPUA 2GCOA 3W5IA 3CH4B 4ZDJA 3CZPA 1K6MA 4TQAA 1HYQA 4ASUD 1T8TA 1E4VA 2R6GA 1YQTA 2OFOA 4HLQB 4B44A 1S0UA 3GJ3A 4RZXA 4MGIR 3V9PA 3AP2A 1ODFA 4M9QA 4NU0A 4LJ4A 3ZH9B 1L2TA 4IXMA 2NPIA 5J40A 2ZJOA 3C5CA 1ZUHA 1SHKA 3KFVA 1Z28A 4R7ZA 5FUXA 4BASA 3UG7A 4D4JA 2OE2A 1E96A 1X8JA 3K8YA 4WW0A 4P4SA 1KY3A 3SEAA 1AQUA 3PUXA 4FMCB 2AL7A 2VHJA 1PJRA 4JT4A 1DAFA 2BBSA 3CX7A 4Q1CA 1COWA 4QBFA 2J3EA 3QQ5A 5JSZB 1G6HA 2NTYC 4E09A 3MJHA 4YXWA 2ZJYA 1AK2A 3WHLA 1OYYA 4QHYA 3BGWA 1CBUA 5KNCA 3T12A 1G41A 3B60A 5IT5A 1CJVC 2QQ0A 1ZAKA 5AJVB 4DB4A 2W2TA 4M4SA 4A2WA 4Q7MB 5BN5A 3QXHA 4ZIRA 1S3SA 4PZLA 4C2TA 1OHHD 1Q3HA 2CRWA 3A1UA 3K9HA 2VSFA 2WSMA 1W0KD 3H84A 3OIYA 1VCNA 2BEJA 1NBME 4IRUB 3TUZC 4PC2A 4UKDA 3L0OA 1FNMA 1TMKA 2D7CA 4URXR 5KSOA 3EPKA 2NMVA 4FI3C 1I2MA 4M1YA 2AX4A 5A5GA 1HUQA 4JJZA 4AYWA 3HPQA 5SZHB 4IVPA 1OT3A 4HATA 1GKYA 1F2UA 4LPKA 1EFHA 1G21E 4MRVA 4NHOA 4URVR 4DUGA 3TGPA 2NO9A 2VPPA 3TJZA 1AZTA 1TNDA 2R6AA 3TUJC 3X2SA 4MGKR 4QGGA 2W00A 1MO6A 1A1VA 4PC3A 5AJXA 5L3QB 2VBCA 1JXOA 4NH0A 4YONB 1E1QD 4ACAA 3IDQA 1RKBA 1U99A 3TW8B 3B13B 2GCNA 4EKDA 3WYFA 3QIAA 1XD8A 3U7EB 1BMFD 3MWJA 3GLFE 4RZ2A 3IUYA 3OE7A 1GTVA 2VP2A 4ZCLA 1VMAA 3EZ6A 5K8UA 4FMDF 1P7CA 4EPRA 4D82A 4TLAA 4W7SA 2DY1A 2O8EB 1SVSA 1LNZA 2D7DA 1Z06A 3T5DA 1E1RD 4ERNA 1JPJA 1WF3A 3PUVA 1XB2A 4GP6A 1SVIA 5HE9A 2IWHA 5J4KA 5KHOC 4FN5A 3AVVA 2WIBA 4XWAA 1BYUA 4XSHA 1YU9A 3SS8A 5KYKA 3GLGA 1OH5A 2WJGA 1E2KA 1F2TA 5EE9A 4PANA 3H2YA 4KHZA 2OZEA 2Q0HA 3GLFA 4TYQA 3A4MA 3FDIA 1JALA 4Z1MA 3W90A 3RS5A 1W0JD 3BIFA 4RD0A 2CHGA 1EK0A 5HZKA 3FMFA 4G0NA 4P4TA 2OLJA 3SFZA 5EZ6B 4LJ9A 5CIQA 2DWPA 4TWZA 4PHGA 1ESNA 1NIJA 4IVQA 3HPRA 4H1UA 4IOJA 2AR7A 4JZKA 1GILA 2WPDD 3UIEA 4RVCA 4LBWA 3NH9A 3NC0C 1NVUQ 5FL7A 2QN6A 1JQLB 1J8MF 4HAYA 1IY0A 2DWQA 1SXJE 5CLLA 4LBVA 4HDOB 1XEWX 2UVQA 5EUQB 4Q1FA 1ZW6A 3BFVA 3OEHA 4IOMA 5ANRB 2BJWA 2F9MA 1KKMA 3VAAA 4TZ6A 1VG9B 2WJVA 3KFXA 2DFNA 3A58B 2YZ2A 4TL8A 1OXTA 2VHUA 1J70A 5FR2A 4MYCA 4NPHA 2PH1A 4CEJB 3H4MA 1WBDA 1WP9A 4CEIB 2PMDA 2C2HA 1DARA 1X1SA 2PMKA 4TL9A 3TAUA 1NLZA 2A78A 2B0OE 4DRZA 3MMPA 3NHAA 3CRQA 1E9FA 3I73A 1XXHB 2YOFA 2Q3HA 1G7RA 1EXMA 1GP2A 2ZUDA 1AKEA 1G18A 2IYZA 3AGQA 4NCNA 4RD3A 4MYHA 1KMHA 1KDOA 4BLQA 4NCHA 1T3SA 2Z43A 2WWHA 2JLWA 1G3UA 2GZDA 1FPMA 3QKSA 3KQKA 2GAAA 4JVNA 4TLDA 1KOFA 3GCGA 4EPWA 3EX7C 1UM8A 1Z6GA 2RGNC 2X8AA 4JKYA 1E9DA 2CCJA 4B75A 1EX6A 1JR3A 2NIPA 2BVNA 2OESA 2ZE6A 3NBYC 4O2RA 1G3MA 4HAUA 3SHFA 5FPYA 1QHIA 4I1SA 4LYHA 2QSZA 1UBEA 3Q9LA 1D2EA 2PEZA 4JJKA 5KSPA 2FG5A 2MSDB 1NRJB 1U8AA 3JZAA 1W47A 4G5GA 1PVOA 4Q4LA 1RJ9B 2ZI5A 1R5BA 5B64A 3GD7A 2O8FB 1D5CA 1L4YA 2ZI9A 5IDVA 2J0UA 4D4MA 1P3JA 2EYQA 5KSYA 2ERYA 2I4IA 4Q9KA 3AP1A 2QROA 3GJ8A 1KO8A 1ZNXA 2WVJA 3NIBA 2HCBA 4M1TA 1MR3F 1S8FA 2VIIA 1KK1A 5JEDA 2IYRA 4D0NA 1PLJA 5FPHA 2O8CA 2ZRGA 4NE2A 5FI0B 5G53C 1HE1C 4OBEA 3BAFA 2ZETA 1N6OA 3H1TA 1OE0A 1XCGB 3QG1A 1CULC 1E2NA 4A2QA 3FKSA 1LS6A 1M2OB 3LY5A 1M1YE 4R9UC 421PA 3L2OB 3W6NA 5JRJA 3I61A 2H17A 4CF7A 1RW4A 3VMFA 3U3JA 1U94A 2FSGA 4JS0A 5D3MB 2XX3A 3CIOA 2IC5A 4Q9HA 2MMGA 1NIPA 1UADA 2IHBA 2REXB 4O3MA 2IUTA 3QKSB 4WA7A 1W0KA 4D6PA 1G4UR 3IQXA 1XPRA 1E2FA 3ZZUA 1NBMD 1AGPA 4EFMA 4PPQA 4Q4JA 4PHHA 2FSFA 3QKRB 1CLUA 4KBGA 4PO9A 1DAGA 3B1WA 2MMCA 1FX0A 1U0HC 4GZMA 4EJSC 3RS4A 1OXVA 2G3YA 5JZVA 3IBYA 2F1IA 2GJ8A 1I4LD 2XZPA 3OIWA 3W3ZB 4B2IA 5KPJA 1XZPA 2I1VB 2P3SA 2OUKA 5D3QA 3K70D 2VEDA 2BBOA 3IEUA 4IXNA 1H8HA 2AWNA 2UZIR 4KI0A 1P73A 5JBQA 5DIFA 3FPAA 1JEDA 2KWIA 3CF2A 1FMLA 1TQ4A 4PO8A 1EFUA 3PV0A 4C0QC 1QHYA 3KKOA 1TU4A 2FPLA 3THYB 4Q9IA 1E2HA 2ZR0A 3EZ7A 5FBRB 2XITA 1YRAA 5KDLA 4URZR 2ZREA 1A4RA 2AN9A 3DMNA 1XRJA 2V8OA 1M34E 3LXXA 4M22A 4W9MC 1WDTA 4V0ME 5FPSA 1NVVQ 3CRRA 4AYXA 4TYWA 3TNFA 4Z8YA 3L0IB 5EP4A 5EE1A 1M74A 2HXSA 2YWGA 4A0RA 4LPSA 5CB6A 1Z6TA 4R2HA 1N6NA 4QHSA 3VR2A 4L15A 3DM5A 3CF6R 2GEUA 3GP8A 1CJMA 3ECCA 2J0QA 2PT5A 3G5UA 2ZSBA 3BH6A 2HLDD 2G0NA 4C0HA 4IEEA 3LX5A 1OFHA 2Q3MA 2DWOA 3SBDA 1CR4A 2WWGA 3ZVLA 1YHNA 3ZD6A 3U4QB 3AUYA 2GWHA 4JL6A 3KL4A 1ZUIA 2FU5C 1OKKD 1RZ3A 3ND9A 4F91B 2FSIA 1T3HA 3WNCA 4IDHA 4POAA 1N0VC 2ZI4A 1XXHA 1GSIA 1S1MA 2ORWA 1TQ2A 4DLZA 3MWLA 1ZD8A 2QUZA 2YV5A 1QHNA 2XTZA 4HEJA 3WMEA 1E0KA 3WXMA 4DSNA 4F92B 3O8BA 3R9IA 2Q21A 3T5GA 3L43A 4OJKA 3CB4A 1R10A 3EA0A 3CWQA 2F1JA 1J90A 2PCLA 3SOPA 4EQ6A 4RY2A 3GEHA 2JJ2D 5H70A 2QL6A 1VCIA 2NO0A 4F4JA 5BN4A 4I1OA 4MKFA 5KOYA 5L3QA 1AZSC 3JVVA 1W46A 5UKDA 3GLGE 3A1SA 2NO1A 1BKDR 2HV8A 1LVGA 5KUTA 4FINA 4NDZA 2GBLC 5FUWA 3SDZA 1IAQA 3C7KA 4P31A 3Q85A 2R6FA 2IS2A 2XZLA 4FIDA 2BHRA 3GLHA 2ZAMA 1Z63A 2BCGY 2IYTA 3DWDA 2ZJ8A 1CJTC 1DELA 1DG1G 2JGNA 2OBLA 3TW4A 3I92A 1XFAA 4RD1A 3RABA 1L7VC 4B3BA 1UAAA 4I81A 5AJYA 2J41A 4LSGA 1XD9A 2CJWB 2KBFA 3CR7A 3EZFA 3CX6A 3OHMA 4EPTA 4P33A 1P2TA 2OFXA 3KJIA 2YVUA 1S3GA 3CRW1 4FWIB 5E7JA 1U2RA 1KDPA 3ASZA 3DPUA 1G8HA 4OHXA 2C95A 3EG5A 1BIFA 1WXQA 4HDCA 3ZGXA 1MH1A 2QAGA 1P72A 2Q9AA 5HCIA 3QBTA 2OV2A 2FFBA 2JDIA 4EFNA 3T06B 1J7KA 2K5UA 1N3BA 4JYCA 1YR9A 1S2MA 2VRWA 5DGXA 2ZJZA 3ZQ6A 4BECA 2WTUA 2DHRA 1Z08A 3UG6A 4K46A 3U2QA 4KYIB 4DLWA 1XEFA 2Z4SA 4RKFA 2V3CC 3ZIAA 1R6BX 3AVXA 3IPXA 5FR1A 3W9YA 4DVGA 1PUIA 4GP7A 4ZO4A 1DBSA 4KU4A 2ANCA 4TT3D 2F7SA 3HJNA 3HR7A 3QEOA 4ZKEA 2QMEA 3LD9A 3A4NA 5K8LA 5EJEA 3DVLA 1MOZA 1ZU5A 2GZAA 4C4PA 1ZVQA 3PITA 3QKUA 5E7IA 5JFGA 4TTRA 3OEEA 3E1SA 5AUNB 4JBWA 5H68A 5JECA 1M8PA 5IHPA 4HAXA 4B35A 4WXRA 2V54A 2NPFA 4TN1A 4OKSA 4TZ0A 4AY2A 3JZMA 4HB0A 4ZPXA 4TTQA 2QSYA 5JWHA 3W8NA 3B2EA 3RDPA 3U7HB 2H16A 1UFQA 3RAPR 4QFMA 5JWOA 4US2R 3EWSA 4Q02A 2DFLA 3PCRB 3ZZTA 3B8HA 4URYR 1NN5A 2G1JA 1E2GA 2I1QA 2RGEA 4J0QA 821PA 3SYKA 5FPKA 4L4UA 2CK3A 2IS1A 1A82A 1Z0KA 2CLDX 3DL0A 4NZYA 5TY0A 4LY6A 2SHKA 2A7QA 3Q5DA 4YDSA 1Z5ZA 2FEOA 3W5JA 4DSUA 5FI1B 3UWOA 2FZLA 5SZIA 1KAOA 4U00A 1E94E 3V00A 3HU1A 1XMIA 1IY1A 2Z6VA 5J47A 4AKHA 2JJ2A 2VHQA 4DDTA 1OB2A 4GSYA 4JVMA 2ZI3A 4A8JB 3HR8A 2EYUA 2XXAB 1UPTA 1HQYE 2QTHA 1P9NA 4JLJA 4PAMA 4TMZA 3SBEA 2CLCX 4A15A 4B3DA 4QL3A 3LH5A 1P2VA 4MRRA 2QE7D 3LRPA 2ZRLA 1LTQA 2W58A 5AJZA 4DT1A 1GOTA 3MCAA 1G1MA 1WRBA 3K53A 3K1JA 4OHZA 3IILA 4PZYA 5TV2A 1TTTA 4JLAA 1JR6A 4FXPA 3RRZA 3AVQA 2XSZA 4MITA 2QU8A 1YZNA 1KY2A 1ZMXA 3PVSA 3N2IA 4V0NA 1XJCA 2Q3FA 1SULA 4GFDA 4ILEA 4QHTA 5F98A 3Q3JB 4TQ9A 4YMWA 4C30A 2GETA 4BEJA 3QVVA 4XH9B 1W44A 4AYTA 4IDNA 3CO5A 5CYOA 2GXSA 2VP4A 1E2JA 3T61A 1KNQA 3QVUA 3VQTA 2ZVQX 1M7BA 1QRAA 1XBTA 2WMOB 3RVBA 4NBSA 3ZVNA 3BRWD 2QMUA 3D7MA 4CEHB 4JIMA 3ZQJA 1R8SA 1SVLA 2ZR7A 4CZ2A 2WAXA 5GJWC 5BYKA 1T0HB 2EQBA 1P61B 2JLXA 2WWFA 3EPJA 5F9HA 4PAQA 4M1SA 4PTLA 2QMHA 2J45A 1E0JA 2ZRKA 2BC9A 3B9QA 1XEWY 3TRFA 2F43A 2NG1A 3CPHA 4TLEA 1XCMA 2GTPA 4IDQA 4IW3B 2X1VA 5A4JA 4ZI3A 1R8QA 3WYAA 4JBYA 1EGAA 4IVRA 4KCGA 4PHTA 4DKXA 3VKHA 4CEJA 4LK2A 2ZE8A 2BIFA 4LJAA 3F8TA 4N3NA 4Q1EA 1C4OA 4ZI2A 2OXRA 3RYTC 1CRPA 3LBNA 2GJAA 3THYA 1BMFA 3PUWA 4OI2A 3I8SA 5KO2A 2V6IA 3D31A 3P20A 5G40A 3TVDA 4OI4A 1Q22A 3AKDA 4RD2A 2ZI7A 2B7CA 1Q1ZA 2YJTD 5J4LA 2ZPTX 4LJ8A 2C99A 2P6RA 1KO1A 4LX0A 5CYPA 4DCSA 2PJRA 1QZXA 3QJYA 2XTNA 1KMQA 3FKSD 2ZE5A 4GI7A 1T6NA 3TQCA 4B76A 1KI6B 1W2GA 4G5OA 4DEXA 2OSBA 2REBA 3LVRE 4GOJA 2C04A 1Q20A 1KI4A 1X1RA 2R2AA 5E3HA 2BKEA 4LHYA 4Q9JA 2ZRMA 1ZCAA 3T1QA 1ZC3A 1FP6A 3RS3A 3N70A 2J0VA 2ODWA 4KO8A 2GBLA 1E9EA 2QGNA 3K09A 1DAMA 3PIRA 1R0ZA 3VKWA 1E2IA 1UF9A 4UNSA 3VU9A 4YLGA 1E99A 4O0MA 2HYIC 2R6CA 3FEHA 1EX7A 4OYHA 4TQUS 4LGMA 3DMDA 1AS2A 3LJUX 2OBMA 4WOPA 3UATA 4ARZA 5EXXA 3RRYA 2IYQA 3DZDA 6Q21A 1Z3IX 3AVPA 4TLBA 3C16C 4B74A 4TT3A 1FQJA 2ZJ2A 4JSTA 3LBIA 1GZSA 2JA1A 2AXNA 4QOSA 1FTSA 1ZD1A 5JHHB 1FW6A 2V4ZA 1N6PA 3VX3A 4DUGD 3MJRA 121PA 1MV5A 1SKYE 3NH6A 3L0SA 1ONBA 3EZ9A 2IEZA 1IN6A 4V03A 5J4HA 1OIXA 4WXPA 1CIPA 1QG2A 1CS4C 2ZEJA 3BFXA 2FFAA 1HV8A 2GDJA 4LJYA 4CIDA 3U6BA 1K5GA 3ZYCA 4RZ3A 4NCJA 2GXQA 2X19A 1Z29A 2RH5A 2EFGA 2WSSA 2IL1A 1Q21A 2O52A 3AF2A 2CRRA 1N6IA 2WJYA 4B47A 1TL7C 1AIPA 3KB2A 3GLHB 5KNDA 3BB1A 1II8A 2GXAA 3RHFA 1MABA 4KAXA 4X8LA 2CL7X 1AGRA 4XTCS 5F2EA 1W2HA 2HF8A 1TUIA 2CHQA 1XP8A 2ZS9A 2H1LA 3A37A 4UQOA 1W4AA 2VTKA 3SYNA 2VH5R 4XVRA 1E3MA 2BEKA 4MGZR 2I3BA 2ATXA 2RHMA 1ZM7A 3R7WB 2WWYA 3GLIA 4BRWA 3C15C 2QQEA 1QDEA 5BXQC 5CK5A 4DXAA 2QTVB 1CJUC 5FTLA 4R98A 4F7WA 2P5SA 2ZS7A 5CM8B 4JLMA 2FFQA 3SU8A 4GMDA 3LWNA 1XU4A 2IYWA 3A1TA 4ON9A 5TARA 3AF3A 4BRUA 2GHIA 2IS6A 3WRXC 4WVFA 1YZGA 2O0KA 2KJQA 2ZVPX 5JRZA 4KSBA 2YOGA 3QKTA 3CM0A 3T1VA 4K81B 1G8GA 5KTYA 3QF7A 1FL9A 3RRNA 1GL9B 3DO6A 2ZJBA 2ZJ5A 2DR3A 3WBJA 3EAQA 1YZUA 2XTMA 3IHLA 3PJRA 3DEFA 4V0MA 8OHMA 1G19A 3KUCA 3T9KA 3NBFA 5KDDA 1ESMA 3ICQB 1WQ1R 1CR0A 1LF0A 2CVFA 1JPNA 4EPXA 3DHWC 4GL2A 4MDFA 1TUEA 2W83A 2CXXA 2AHOA 1Z47A 4BWYA 3QPWA 1GKUB 3GJ5A 4GMXA 1CF4A 2UKDA 3SYLA 2CCKA 2YOHA 3O8CA 4OI1A 3KX2A 3MUFA 2A9KA 5HKKA 3AVTA 1JEEA 1GITA 4MKGA 1JNYA 2A2ZA 2NZ8A 2FPKA 4M53A 1MABB 5EE5B 4C0SA 4LBYA 4UXIA 4Q7LA 3BE4A 5CITA 1G4AE 4CW7A 2JLVA 2DFKB 1KHTA 3CW2A 2QPOA 3I32A 1U8ZA 4FMDB 2HLDA 2ZRJA 1MO3A 1KO4A 3P4XA 1KSFX 1CJKC 3I1FA 1CR1A 3QXJA 1Q57A 3UMRA 1T0JB 4UXJA 2FPMA 4QJ4A 5E7MA 2AD5A 2IHYA 3M1IA 2VO1A 4GNKA 4PSKA 1JJVA 2PL3A 3WNBA 5FOWA 1PZNA 1ZC4A 3NVAA 4OQLA 3HYTA 4QBIA 3PEUA 4UJ3A 3U3RA 3L8YA 3EC1A 1XXHE 4MQBA 4OQFA 2V9PA 4PQRA 1JAHA 1KNXA 5DISB 2QBYB 3K70C 3NTUA 4B6FA 3RS0A 2B92A 1W5SA 1V43A 1XD2A 1ZNZA 4BLSA 3SFVA 1KZGB 1IQPA 1N0UA 2WBLC 4XD7D 4L8GA 4XJXA 2EFHB 4CT4B 4C0BA 2AFHE 1OJLA 2ZRBA 2YWFA 3AVUA 1R2QA 1S9DA 3FMPB 4DLXA 1G7TA 4TL6A 1X3SA 4QNMA 2LWIA 4HUTA 4DDUA 4FWTA 4LZZA 2BMDA 1XTKA 2GVZC 3SR0A 1ELOA 2EW1A 2W2VA 1LS1A 1NL3A 2GESA 3KKQA 4DB2A 2WJHA 3KTAB 4GRAA 3OIVA 3WMFA 4MRPA 4BLOA 1JJ7A 3CX8A 4DDWA 2V1XA 2R6DA 3SC3A 1NN0A 3U5ZB 4HSEA 1G3RA 4JLVA 4BGDA 1VCMA 1G20E 3BWDD 2XXAA 2G9NA 1VIAA 2OCBA 5AUQA 3P26A 3BB3A 5HKKD 3MGCA 1II9A 2VYFA 1COWD 3OZXA 1ANKA 3EXAA 5C4GB 2GEDA 2XGJA 2XNDA 5FTNA 4W5WA 4JT2A 4NTZA 3U7FB 1PUJA 2O8FA 2NOAA 4US0R 4AKGA 4PSVA 1RRPA 1NY6A 3ETLA 1NSTA 1U0JA 3BH0A 1D2MA 1TU3A 5KU1A 2A5FA 4PO1A 5FTMA 4KITB 4BFSA 3CR8A 1NLFA 1R5NA 4KXFB 4D4LA 1AKYA 3LQQA 1YKSA 3PEVA 4BFUA 5AUOB 4KLZA 3N5CA 2IYLD 3G0HA 3U7GA 2GJSA 3AVYA 4M1MA 2H8KA 1E32A 3PG5A 1E9RA 3K0AA 1Q12A 2OCYC 4PC7A 3E70C 3FFBA 1GDDA 2ZIAA 5IK2D 1YRBA 3MRSA 2IQJA 3O8DA 4G5QA 2JLYA 1XD2B 3AV0B 3I5XA 3RSOA 2W2XA 3U61B 5DNYB 1BH2A 3JUEA 2FN4A 3ONWA 5EE0A 3W6OA 4IFEA 2Q9BA 4FCVA 4E07A 5J4VA 1R4AA 2WM9B 3OAAA 4JLKA 2GK7A 1XX6A 4JLPA 1UDWA 221PA 2PZEA 3QUSA 1GRNA 5L8VA 1T5IA 4QXAA 4WAUA 1W48A 1BO6A 5GVRA 2PX0A 1PLLA 1BYIA 1AJEA 1P4SA 4KJZA 3TE6A 1ZRHA 2QT0A 3CRMA 3EIQA 3I72A 1GFIA 4OQXA 5FFMA 1UBGA 5JI2E 3B1XA 4B32A 1E0AA 2PLRA 3KB1A 3NC1C 5CK4A 4XVQA 2QTFA 4LUCA 1IOZA 1NJGA 4OHYA 1SXJD 2F9LA 3AH8A 4EJSA 1Q1QA 4WZAE 4C7OB 5DN6D 5FH9A 4AC9A 2FOLA 4F4CA 2GZHA 2LCFA 3B82A 4GPTA 2WV9A 2HT6A 3T1OA 4I99A 4Q66C 3SJCA 4L9SA 3D8BA 3F0TA 2QRNA 4PPFA 3CPEA 3AB3A 3CNLA 4NL4H 4OK5A 4RFVA 1ZU4A 4Q01A 3QBVA 5LDDC 2QM8A 3B9PA 5H1YA 4LC0A 4EQ6B 5HTKA 1GM5A 3NWJA 2X77A 2XOKA 2QAJA 3U6KA 4FW9A 2XJ4A 1OF1A 2OG2A 2ERXA 5EE3A 4TYNA 1AQYA 3QXCA 1P75A 2YWEA 2XEXA 4EDHA 4F93B 2JEOA 1ZM3A 4RCZA 2QPTA 2YC4C 1II8B 3LBHA 3WP0A 3P1JA 1H8EA 4RFSA 4JMPA 3C14C 4ZDWA 2EWWA 3JVUA 5BYJA 1OXXK 1ZBDA 4PX9A 1CTQA 1Z6YA 4TSFD 4A0HA 1KAGA 4M8NE 2J9RA 3FM8C 2RGXA 2QENA 1P2UA 1TF7A 2RGGA 4TSFA 2Z5FA 3TSOA 3RC8A 3WY9A 2V6JA 2W6ID 3BS4A 2FE4A 2J1LA 3OIUA 1OFIA 2ZUCA 3H86A 2P65A 1H8ED 1VG0B 2EVWX 4RZUA 3EWAA 3FOZA 1KGDA 4GZLA 1T8UA 2N42A 3D6TB 1P6XA 4HUQA 4BQSA 1UKYA 2VLIA 2FNAA 3OESA 4S2EA 1G9XA 2GRJA 4QC2A 1W36D 2ZYWX 2JAQA 1EFRA 1E2QA 2RAPA 4QM7A 3QKRA 1XPOA 1G8FA 1K8RA 4G5RA 4S35A 1NN3A 5DSZA 3GJ7A 3HYRA 2QNRA 4HAWA 2GKSA 1YR7A 1W4RA 4P4SB 3PFIA 2V55B 1P60A 2QAGB 1K5DA 2WJIA 2IXFA 2F3TA 1T9HA 3R9XA 3CBQA 1E69A 5HE8A 4DDVA 2A5GA 1IN7A 3KKMA 5DI9A 3SJZA 3SJBA 4DIDA 1G8PA 4MUAA 3V4RA 1DPFA 1UBFA 5HR5A 2ZSEA 5LPNA 1E79D 1NSFA 3ADBA 1QHHB 1ZCBA 4KFRA 5FUYA 2AKAB 1D8TA 4D0LB 1MRSA 4G01B 4D0GA 3GJ0A 4PXAA 4LI0A 1DEKA 1YE8A 1UEJA 1W1WA 5TMPA 2E9SA 2GCOB 3ZLJA 1P2SA 3X1WA 5FUVA 2ZANA 1UKZA 4GOXA 3TMKA 1XPUA 1RFLA 3K0FB 3P27A 1KDTA 5FBVB 1NMYA 5CM9C 4Q9LA 1EFTA 4PAOA 1Y3AA 4CVNA 1V5WA 5JCZA 4NYMR 5IRCD 1E9BA 2V7QD 5JHGB 1IXZA 2G88A 2W0SA 4HB2A 2WJJA 4NYMQ 4RKEA 3SQWA 4TMVA 3ND8A 2W6JA 4N1AA 2ODNA 1TX4B 1KSHA 3KQUA 2IBMA 4XWKA 2D74A 3VNVA 3NEJA 1KI8A 4Q1DA 2VSOA 1OIWA 2XNDD 2ZROA 2PZFA 4KVGA 4PFSA 1NG1A 5JJKA 1ZJ6A 3CNOA 3A36A 3THXB 3AF0A 3VR1A 2QAGC 1KO5A 5DHAA 1B0UA 5EP3A 1ZM9A 4QNRA 2F1RA 1DAEA 3MWKA 1RVDA 1Z6AA 4II7A 1WE2A 4LHZA 2XNSA 4OQNA 2G0TA 4GT1A 3WRYC 2CNWA 4IFBA 4BFZA 2IYYA 3DDCA 1Z2CA 2UZ3A 1NY5A 2CHVA 4XTRA 1KMHB 3KXIA 1CR2A 2GF9A 2OBNA 1GRRA 1N5LA 1MO4A 2C78A 4YMVA 3L0PA 3AQ4A 3DM9B 1OFUX 1G3QA 4Z54A 4LHWA 2FA9A 1E9AA 1G6OA 1X8KA 4D80A 1XCPA 4E22A 4Y0VA 3NXSA 2ZUBA 3OFNA 2ZRIA 5DHFA 5LB4A 1ZUNB 3K0SA 3U3OA 2HT1A 3AF4A 3HU3A 1R7RA 3Q8XB 1IXRC 2CCGA 1FUKA 2EFEB 4OL0A 1UDXA 1M6NA 3CUEF 4LV5B 3IQWA 5EXSA 2Y8EA 5BWMA 3MSXA 1KI2A 5JI3E 1KZ7B 3GFPA 1SVOA 1FTNA 5JCPA 3SNHA 2G6BA 2IXGA 2MSEB 2ZE7A 2R44A 2WKQA 1T5LA 3TQFA 1KI3A 5G3ZA 2C98A 2GAOA 5JS8A 2IWRA 4DZZA 4Q18A 1GIAA 1DVRA 1G16A 3FTQA 2J0SA 3KJGA 2D62A 2KBEA 2WWIA 5LD2C 4PC1A 4DLUA 1RIFA 1YJ5A 2B21A 1SVWA 1TEVA 4NYJQ 1GWNA 4TMWA 3R8CA 4HLDA 3L82B 3ZS9A 3IEVA 3O8RA 1XTIA 3J81k 2OHFA 4IHQA 4YMSA 1NKSA 1WB9A 5IF9A 1J2JA 3KXLA 3UMSA 1BOFA 4A0FA 3A6PC 1KI1A 3AEZA 3BJIC 2DCUA 5DH9A 1U90A 2J5XA 3FB4A 3M4YA 4HUQB 2O8BA 4QGAA 1S1CA 4U02A 1NVXQ 2IXEA 4Q7KA 5DLQC 2GJKA 3Q7PA 4TMKA 3GLGB 3I3SR 1MKYA 3CLVA 4KV9A 5KDOA 2B8TA 4W5HA 1E2PA 1RYHA 1US8A 1IJFA 1NBMA 3EZ2A 4M9SA 5AWFC 3ZDQA 3AUXA 3LXRA 1OKKA 3TUIC 2QGZA 2J7KA 1QVRA 4LC1A 4DBLC 3PEYA 2O8BB 4EAQA 3ZVRA 2JLRA 1CU1A 3DOEA 2ZSAA 2BM0A 1KJZA 2GXUA 1W0JA 2LKCA 1AN0A 2Q9CA 4D4KA 1GKIA 4LJ6A 2IT1A 4MKHA 5LBIA 5HZHA 1C1YA 1QHHA 4ASUA 5GVSA 3GFOA 2W6JD 3FHOA 4NYIQ 3TR5A 3VU9B 5DO9A 2V7QA 2H18A 1N0WA 2JASA 3GJ6A 4NYJR 1YZTA 4Q4HA 5DI3B 1JBKA 1N6HA 2C96A 3OEED 4AIIA 3MLEA 1WBBA 4O2LA 5FPTA 1XNJA 1CKEA 1OV4A 2CLSA 3KZ1E 1E9CA 2IW3A 4JVSB 4KLNA 4BZQA 1SXJB 3TVTA 2C8VA 4Q03A 5DYIA 3OEHD 4DLTA 3QG5A 2OAP1 1ZNYA 2HJGA 1Z0DA 1E2MA 2ZI6A 2XB2A 3B1ZA 3NKVA 3VR4A 1DS6A 4Q7JB 4CEIA 3W3AA 2J0UB 3GMTA 1HT2E 2BBWA 3LV8A 3WNDA 5L3SB 2Z4RA 3HU2A 5BW8A 4U7DA 2AWOA 1TEXA 1YVDA 3CKLA 4JLOA 3QE0A 5KNBA 2W0MA 3LLMA 1R0YA 1QG4A 1E9SA 1YZQA 2J46A 3MD0A 3O47A 4DJTA 3U44B 2GILA 2KSQA 3R8FA 3CH5A 2X2FA 5EP2A 5ELXA 3A8TA 2A5YB 5L3SA 4D25A 2AD1A 4US1R 4JYBA 2IA5A 3EPHA 5F3WB 2KI5A 1E79A 1FP7A 2KB0A 1TQDA 2JJ8A 1NF3A 4G3XA 3LO5A 5P21A 2OWAA 4TL7A 3WMGA 1OXUA 3TLXA 5EUMA 3Q5EA 2GA8A 1T4GA 4KSCA 4V0LA 1EG7A 1NVVR 2WAYA 3SN6A 2JDID 5GADl 4BZPA 3SQXA 2CK3D 5FTKA 2P67A 4DEYA 4OJQA 3B85A 2OFWA 3R7WA 3QXSA 3GLIB 2BWJA 1AA9A 5EZ5A 1G3IA 3IPYA 2HCJB 1ETUA 2FSHA 3KTAA 3GEEA 1OFTA 5EXTA 1QF9A 4LRWA 5FBWB 1W5TA 2HUPA 5FBQB 1XDBA 3AP3A 4MYTA 4PC6A 5JJIA 1E1RA 3T35A 1Z07A 3M6AA 4DSTA 2ZRCA 4KVAA 1U81A 1OW3B 3AKCA 521PA 4ZDIA 5C18A 4BEBA 2IUSA 2O8DB 2D06A 1KJWA 1J99A 2CE7A 1M7HA 3F3YA 1IM2A 5C4MA 4BFTA 2D2FA 1XEXB 4ARZB 4TMTA 1Q1BA 2O8CB 4Z51A 2BJVA 1NMZA 2ECKA 3FE2A 1KK0A 4Q48A 4ZV4A 4G5SA 2O0JA 4NCKA 3G82C 2BM1A 4DHEA 2WHXA 1R0WA 3GPLA 2XOKD 3UWKA 3GFTA 1CXZA 2JJ1A 5DN6A 2ZU0C 5AR1A 2QM7A 2QMOA 4MRSA 1I4TD 3ICEA 4EUNA 4L16A 2AK2A 3VTKA 1O3YA 4ESHA 4EJSB 1PV4A 1Z2AA 4YDHB 3NDBB 2OILA 4EPYA 3LNCA 721PA 5G3YA 4IEIA 4KFUA 1XTSA 1OYWA 3L8ZA 2QA5A 2FF7A 4DIEA 2OLKA 3KJEA 5JSZA 5JLJA 4NONA 3GJ4A 4JKIA 2BBTA 4TMXA 2PT7A 4DLYA 4GBMA 3A1WA 4EFLA 2PX3A 1Q44A 3B7GA 4XOIA 2B8WA 3ZS8A 1XJ0A 2YHSA 4KODA 3ADDA 5B30A 1EFCA 5B57C 3U3KA 3REGA 4A82A 2HF9A 2ZYTX 1ZIOA 2H7VA 3DKPA 4I4LA 2F3RA 1UBCA 1IN4A 4RD6A 1NP6A 3K9LA 2WOOA 1OB5A 2JATA 3KQNA 1U9IC 3W34A 3FFAA 3ZJYA 2N46A 1DOAA 1I4DD 3IGFA 4M0LA 2RGDA 2WKPA 2N1BA 3REFA 1TF5A 1E2DA 4AG5A 4NMMA 2JIZD 1NI3A 4KFSA 3K0EA 1FOEB 2FGKA 4M2LA 5FOVA 1SGWA 3QNUA 1L4UA 1XF9A 1RRGA 4HZUB 4IKEA 4LYAA 1OH6A 1SXJA 2ODBA 4XIGS 3KQHA 1XWIA 5EQTA 2C03A 1JECA 2F1HA 4HYYA 4LV8B 3TK1A 1G64A 2JIZA 2P6NA 4UNNA 1W4CA 2GK6A 4A36A 4NCIA 3TSZA 4B2LA 2QRZA 3UANA 3BXZA 4B73A 4O25A 4C0AC 3KQLA 2H5EA 1M7GA 1OPXA 3BD9A 4YXWD 1SKQA 1KJYA 1OHHA 4Q00A 1VPLA 1YR6A 3AF1A 4DLSA 1W4BA 1P62B 2J87A 4IDOA 1JR3E 2PCJA 3IKJA 2FEMA 4FMCF 1G8YA 2JLUA 2QP4A 1E0SA 1Z8FA 3QXXA 4QBGB 1QVAA 4BFWA 2BMJA 2J7PA 1VG1A 3DKVA 1NMXA 2ZSFA 2VA8A 2CMKA 1WMSA 3B78A 3GEIA 2OCAA 1FNNA 2FV8A 3MDBC 3THOA 4V02A 4Y0AA 1XMVA 3S1AB 2OXCA 3LA6A 3ASYA 3OAAD 4OK3A 3VX4A 1F2TB 1NG9A 1SHZA 1VYVA 2G1KA 2PEYA 1IY2A 4KYUA 2GF0A 2EFCB 4BFYA 4XD7A 3B1VA 4LCBA 4XVUA 1JI0A 3EW9A 1GNPA 2RKOA 2X2EA 5H8WA 3UKDA 1DE0A 1YZLA 2R62A 2WWXA 4OK6A 1KSJA 1VCOA 4L5BA 2HXYA 4R71A 1U0LA 1AS0A 2ATVA 2VF8A 3EIHA 3RNLA 4B3FX 3SJAA 1IHUA 5G41A 1KI9A 5M04A 4ITRC 1OLOA 3K70B 4LYFA 2QI9C 4LOAA 2E87A 2ZU6A 5GJBA 3FKQA 4N0EA 2RCNA 1NN1A 1F3OA 1HURA 4PR0A 5KSZA 3QF4B 1DO2A 4DC9A 2FX3A 1LB1B 2IK8A 1IN5A 4YMUA 3EASA 4CEHA 1E2EA 1KYIA 3HDTA 4C2UA 4DLVA 4MGYR 3FHCB 3HP1A 1CP2A 4K8OA 4W5JA 3T15A 4YQFA 1SVKA 1Z83A 4Q19A 2OM2A 1S96A 1QBKC 2BKUA 3WBKA 1G7CA 5CLQA 2A30A 4C7OA 4LYJA 1MO5A 5FTJA 3EARA 3NBXX 3T1TA 3X1XA 4LWZA 3OFND 1FUUA 2QBYA 5CB8A 3FMIA 3X1DA 5HCNA 2L0XA 3M0EA 4LJ7A 3VHXA 4DCVA 2XSZD 4HB4A 3RS2A 1MT0A 5TVKA 4Q5IA 4LV6A 4PZZA 2VSXA 5D3MA 1NNEA 5FOSA 3R9WA 1P5ZB 1X6VA 2F6RA 4LBZA 1S9HA 4Q4HB 4A6PA 4ZKDA 3UPUA 4URWR 3LX8A 2WWWA 3K0CA 3ZD7A 4RSGA 4JLNA 3D3QA 3CZQA 2P57A 1NKTA 2O5VA 4F38A 5JS7A 4OHVA 2RGAA 1IN8A 2A3RA 1Z0FA 3OE7D 3X1ZA 4B43A 5JWRA 4UNQA 1FX0B 3AVOA 3FGNA 3TH5A 4ZCIA 4H9GA 2YINC 4GDFA 1EFRD 2FDCA 1ZYUA 4A6XA 3ZZ0A 2QT1A 2DPXA 4I1VA 4YC7A 5AUPB 1DCQA 1G5TA 1WCV1 2OCPA 5JEEA 1GAJA 1QHXA 3LVQE 1UKVY 3SI7A 1VYTA 2ZQ5A 1JQJC 1EWRA 3C8UA 2CL6X 5EP1A 4QKQA 5DI3A 2IEYA 2AFIE 2NZJA 1BS1A 1KO7A 4MDEA 4BLPA 3AKEA 3OF5A 1RJ9A 4D2IA 1EWQA 1G5PA 2GVDC 1KI7A 2ZM5A 1XTQA 3NEYA 4UNPA 3B5JA 4DSOA 1FMJA 5B2ZA 1IBRA 3Q7QA 4C3ZA 2CL0X 2REOA 2Z0MA 3HWSA 4X8OA 2JJ1D 3LAWA 2C77A 5C46F 1XEXA 3VR6A 1CRQA 4Z1MD 3K9NA 4M1KA 1I2DA 1Z0AA 4P3YA 5CDFE 3KKNA 3PR1A 4FCTA 3TKLA 3ZIAD 5TXGA 4JBXA 4L9WA 3I5YA 1IJEA 2NGRA 1SVMA 4JLBA 4ZDKA 2PLFA 2BDTA 3QPVA 1N5JA 3EA5A 1NLYA 3C5HA 2OT3B 4Q21A 1Z6XA 1KDRA 2EWVA 1SKYB 4MUBA 4JL8A 1LF5A 2IYSA 1ZIPA 1KKLA 1W7AA 2P6UA 4B3XA 1GNRA 2HJVA 1II0A 1T91A 5K8IA 3P32A 1WA5A 4V0OA 4BFVA 4PSAA 4HLCA 2WMNB 4CT5A 1U98A 4GOKA 3R20A 3ADKA 1KTVA 4CRWB 4WIAA 2XAUA 1XMJA 2YKGA 3IHWA 5CJ2A 2EU8A 2DB3A 3MAAC 2W6IA 1CEEA 2HDNB 4I1UA 4XWOA 4M9XA 5L3VA 3KDSE 3IIKA 2O0HA 3C41J 4U5XA 1OXSC 1TAGA 3RS7A 1JAIA 1O87A 1UEIA 2R9VA 1SXJC 1GUAA 4B6EA 2NO6A 1UKEA 4RJLA 1ZNWA 4BE7B 5GJVC 3FVQA 3QY0A 4AKIA 1OH8A 2QORA 4C0KA 4CGZA 3TIFA 1F48A 1Z0JA 4Q47A 5AK0A 2FMXA 4NYIR 4UXHA 2R65A 3NG1A 5C1BA 1N5IA 2ZTSA 2YWHA 1DADA 1VHLA 3QOFA 2CE2X 2IYUA 1N6RA 4MRNA 4A0GA 3LW8A 1NJFA 2IUUA 5K8TA 5FOTA 2ZITA 4B3CA 1RRCA 1HT1E 4A2PA 4E03A 5DE3A 3A1VA 1A2BA 4BZXA 3I8XA 3CPJB 4MA4A 4IOLA 4BPBA 3BBPA 3I62A 1HA3A 1VECA 3K09C 2H57A 2ZJAA 4AK9A 4E5UA 1DAIA 4WZ6A 4QFVA 2J7PD 1W49A 2CEAA 3QSYA 3UK6A 4B48A 1KK3A 1ZM4A 2RB4A 1VIYA 2BMFA 4HAZA 2P2LA 3IIJA 4D26A 2QG6A 3SHWA 4UNRA 3PEWA 3GJXC 2RMKA 4WZBE 1H8HD 3GQBA 1G17A 3VFDA 2BV3A 3VR5A 2VP0A 3U60B 1HE8B 1HQCA 2J59A 2P0EA 4LHXA 5IK2A 3ADCA 1HH4A 2ZRFA 2KE5A 4M1WA 1Q3TA 2YNMA 2GJ9A 1N6LA 4MH0R 3BK7A 3AGPA 5F9FA 2IYVA 5GJCA 3UXMA 3BORA 2VHTA 4EIWA 3LQRA 4HZUA 3PUZA 4QBHA 2IF0A 4DCTA 5B58C 3CWZA 2RHDA 2RGCA 4FMBB 3PUYA 2EFDB 1X86B 4PPGA 4M21A 4Z8XA 4CYMA 2CNWD 4ZIRB 4Q1BA 4MYUA 5LD2B 3KXKA 1B23P 1VHTA 3TAHA 4AKEA 5JMTA 1T3LA 4PPNA 2AXPA 3B6EA 1HY3A 1ZD9A 1OIVA 2B7BA 5EXPA 4HB3A 3SE0A 1Y63A 4JL5A 1HTWA 3F5FA 4ACBA 5C2JB 1DAHA 2ZRPA 4TYPA 5E4FA 2F55A 5HPYB 1XZQA 2P5TB 2TMKA 3RRMA 1GG2A 2JLQA 1RYFA 3EIEA 4QJ3A 3THXA 2ONKA 4NP6A 1F2UB 2ZYVX 2FH5B 4AG6A 5LB2A 1JB1A 3DOFA 3KKPA 1U9IA 1E4YA 3TSWA 2ORVA 4BUJA 3CRVA 3FYHA 2G83A 4C9BA 4DCNA 1Z22A 1S4QA 4A9AA 2NQ2C 3C4JA 1H65A 2AKYA 1YR8A 3GLIE 4F4IA 1LW7A 621PA 2QE7A 1AM4D 3RLFA 3PXGA 1E6CA 2B6HA 3W6PA 4DCUA 2PZGA 4LHVA 1VG8A 4RCYA 2C9YA 4OI0A 4PHFA 3H0KA 1FFHA
chains in the Genus database with same CATH superfamily
1TZCA 1N5KA 4MARA 1GPH1 1XVTA 2BR3A 2PBRA 3EJNA 2FUCA 4HLUA 4K3VA 1F60A 3G23A 5DRTA 5EUBA 4IJMA 4X1KB 4AZ3A 4RA9A 4J4BA 3DZGA 1EBFA 5A4DA 2VF7A 3PFFA 1E98A 3OQVA 2I2CA 2H92A 4DRXE 1LFDB 4PR3A 1M5RA 3CX3A 2RCYA 1E1CA 2ZSDA 2FSSA 3B1YA 2Q5QA 4IIHA 4U0UA 4BBJA 4M7RA 5FBLB 4MWDA 2PQNA 2D6FA 3R74A 3RWBA 3BFKA 1QAQA 3TOXA 3AS8A 4QG7A 1EK2A 1IBSA 3BB4A 3FIJA 3PQ8A 5EYPB 2DJAA 3DO8A 5CHEE 4O63O 4RMJA 1QGED 1ZINA 1LDKC 2Q2NA 1EGHA 4JSYA 5C3MA 2VI5A 3ISTA 1MB4A 1DTSA 3UHOA 1BXKA 1UKAA 4QM6A 2XJ9A 3WLFA 3R0JA 4YBSA 1JIXA 5AK5A 1RYBA 2PXAA 4DLRA 4KFTA 4FCWA 4GU5A 3CF4A 2IX9A 1M0EA 1TQ6A 3B5IA 1YE5A 1L7AA 4MI1A 1AWCB 1KEEB 3Q72A 5LZ5A 3TBKA 2BRUC 3VAZA 4CTJA 1W36C 1FZQA 2QF7A 1FLAA 1DG3A 5H3CA 3W5SA 3RODA 4PSUA 2NXJA 4AXHA 3DLAA 3F49S 4BMOB 3HDGA 2PQ6A 4CE6A 5ICGA 4A1OA 5CLIA 3EPPA 1L4NA 4L73A 2HEIA 5J43A 2XB4A 2DYKA 2HX1A 4M9ZA 3V32A 2QZJA 2YFHA 1NQWA 2N47A 1S8NA 5ADWA 4HSGA 2FGJA 2FJUA 2GCPA 4GHWA 4M9RA 2QRUA 4OQMA 1Y8QB 3J80A 4LTMA 5BWLA 1VJ0A 3X2FA 1F6BA 1Q17A 5CIWA 4X6YA 2QTCA 2AE2A 1ULAA 1BCSB 4O4IB 1SOVA 2CMGA 3L18A 3WG7E 3H5IA 1F8YA 3LFUA 5EUCA 5CBKA 2Z6QA 4PW0A 4P34A 2Y1FA 1XTPA 5EKUA 1DNPA 3QYAA 3ZBPA 1UOOA 2P79A 3L7BA 1WLYA 2G5CA 2H4FA 1G7SA 3MNFA 3ZVMA 2XIJA 2AH5A 1A5TA 1U7PA 4PRKA 3BH7A 3NVDA 5FOUA 2LKDA 3OZTA 4C0JA 1QIFA 2V6BA 1TADA 3F98A 3N75A 2VR1A 3U44A 1ISGA 3ADPA 3WMRA 3NDPA 4AWXA 4Z4IA 3BERA 4BB5A 3R7LA 1RC8A 3HJFA 2C0QA 2WF8A 1FTYA 4LF7B 2IS4A 2HU8A 2CN1A 5E6SB 4TXRA 5FDFA 3OLWA 1QU2A 4ZO6A 5A5FA 5KEIA 3QITA 1JQBA 1INZA 4TTPA 4TWJA 5DSXA 5HMLA 4X97A 3ZV4A 4EPVA 2CVHA 3KC2A 3KQQA 4QO8A 2I8AA 1OWOA 3IQIX 4Q4JB 5TDHA 4IOKA 3MN1A 5AK3A 1SC9A 4H1VA 3IBGA 1NBOA 3GGOA 1IEQA 5HUJA 1WDKA 4MEJA 1XDWA 3V4FA 3A2LA 1Z4PX 2J9QA 1EVYA 4MDHA 4NLLA 2ZRHA 4MVJP 4HBGA 1D6JA 3BQNB 3CF0A 1P5FA 4YRAA 4R8KA 4JVLA 2J08A 4Q1AA 4TLCA 5HJEA 1SFRA 4YCAA 2CB9A 2VP9A 2GRAA 4D92A 1KDZA 1XTRA 5JD5A 5KNHD 1E5XA 1I3OA 4XYBA 3FPSA 1V3UA 4DWJA 2I7CA 3HEAA 3FNIA 1X9HA 5EILA 5AITA 3OG9A 3PEUB 2A5DA 1LZKA 1O9BA 1ISPA 1UBTS 2IKQA 3K96A 3DCYA 3DZ8A 3NHBA 4RZQA 5H02A 4AAYA 1MB3A 4M9UA 2EIHA 1QDUA 3D8TA 2XMZA 1VSUA 2BELA 4JI6B 4LKOA 3NBZC 3SQVA 4M3NA 1YDHA 2X22A 3MINA 4JN6B 3V43A 3JWJA 3T5XA 4RDHA 3QFCA 1PJSA 2FUIA 4RJ2A 4BLTA 5BUZA 2DWCA 2VP5A 5KVVA 1P9WA 2D2EA 3CE6A 5T4YA 3I4LA 2IEIA 4ZAGA 2YYZA 1TPZA 3LUPA 3PXXA 2C9CA 4AFNA 2WPDA 2XD4A 1YZKA 2A7XA 4OHCA 2A58A 3BWMA 5IW8A 5CCEA 4DR3B 1J8DA 1PC2A 1WD7A 3PH0C 1RI1A 5IBPA 3VA7A 1S8OA 1C2TA 3CVOA 4JD5A 4MVJA 3ZXIA 2AMVA 1IXSB 2VRCA 2VZ9A 2FR8A 1GRQA 3JTMA 3BC1A 3GLHE 1OGYA 2YY5A 3G8CA 3M9WA 3PK0A 5F5LA 4X8MA 3V1UA 1AA6A 1VIMA 1PFQA 4GC9A 4EW6A 5CDSA 1F1BA 4HLUC 3ZXXA 2AI1A 3ONDA 5AQ1A 1T36B 2BEWB 1T3ZA 5BXYA 2FWRA 1VDZA 5EVCA 3K9GA 1K6EA 1O95D 2WYVA 3ET5A 4CV0A 4EATA 1DL5A 2E1RA 4I9NA 1GW6A 1VIVA 2WXPA 1YB7A 1Z4OA 3F4KA 4TS3A 4ZYYA 1Z7BA 2V7PA 3HWX1 4GI2A 1J8VA 1RWOA 1WU7A 1PT8A 4FX5A 5DTRA 1M67A 2JJMA 2BHTA 2ODEA 4B8AA 4A8TA 5FOXA 1RPZA 1TVMA 4ML3A 4PQFA 1KYYA 4Y18A 5ALLA 3RIGA 3WHKA 1G291 3PB3A 4DR1B 1OCCE 4C4RA 1O95A 4HAOA 4KBFA 3RC3A 3ZTTA 2WMYA 1E2LA 3VH4A 4FTWA 1SD5A 4X60A 1A8UA 4F3TA 1D8DA 2I67A 2AR0A 3DFFA 2ZXUA 1CVLA 2FQ1A 1GQRA 1AURA 2D0PB 2YX1A 1M2GA 1NYTA 1VFPA 1BE0A 4RD4A 4JUDX 4R1PA 1N33B 3LBAA 4UI9J 2J3MA 1OLXA 3JUIA 3TTVA 3QPUA 2GCOA 3W5IA 2ONDA 3LC7O 4RHEA 2LPMA 4WDRA 4ZDJA 1ZAYA 4IXWA 1T1JA 1JHAA 2FFJA 1K6MA 3E9ZA 5CERB 4TQAA 1DTWB 4KGDA 2MNYA 2BFCA 1E4VA 5AW3A 1YQTA 2YQLA 4U7GA 1TNZA 5C11A 1DAOA 3KCNA 4QLAA 5C8YF 2OZKA 1P0QA 4B44A 1D1PA 1S0UA 2J9XB 1WDMA 1GXSA 3A1NA 3GJ3A 3ASDA 3L40A 3KKEA 3SS9X 2JIBA 1ODFA 4DGQA 4DMUB 4BUCA 4TWRA 2C2LA 1J07A 4QGSA 4YV2A 4FPXA 5H1UA 1SIBE 3DMFA 4IRXA 1L2TA 3CWCA 3WIVA 4H7JA 3ML8A 1RR6A 1UZNA 1AG9A 4OIMA 4D9GA 4DILA 5B3LA 3KFVA 1Z28A 1BVYF 5JUWA 2MD8C 3G85A 3H8SA 2OXEA 4YB8A 4GRIA 4DKJA 4GD3Q 2HOQA 2B83A 3FU5A 1W1IA 2OE2A 3KDAA 3AFNA 2VZLA 4JROA 4P4SA 3WL5A 4AO7A 2E6RA 1KY3A 1C0KA 1AQUA 2PRKA 3PUXA 5LWQA 3BXHA 2JW5A 1PJRA 4OUDA 3WB9A 2NSHA 2FN7A 4XEHA 3AB8A 4BTLA 1GGKA 3CY6A 1WZ2A 2VJYA 2J3EA 3G13A 3JCZA 5SVIB 3QQ5A 4G4IA 1G6HA 4AF8A 3IVMA 3MJHA 2WD7B 1GPJA 3G8YA 4YXWA 4MZDA 1A0OA 4G09A 2ZJYA 3DV9A 3WHLA 1OYYA 4NJEA 4D45A 5EFOA 2HQBA 3BGWA 2A9JA 2AEMA 2XR1A 4XDZA 5CP8A 5IT5A 3NIDB 1CJVC 1V1RB 3RRUA 1KJNA 3B3JA 1WEOA 4M4SA 1Y3DE 5BN5A 1KJQA 1F1JA 3EXHC 1U3WA 4XCXA 4YJ2F 2XRYA 1YVPA 3RUHA 3WWPA 1WV0A 3H84A 1C30B 1PJQA 3QY9A 4N5LA 3FHEA 1N8TA 2Z8YA 1G3NB 1V71A 3VDNB 5IANA 1TN6A 4NESA 4K9PA 3TUZC 4CN8A 1EFLA 1GLNA 1U7HA 3EEBA 1GZDA 3H2SA 3L7DA 4GLFA 4PC2A 4URXR 3EPKA 2CG2A 3CRZA 2X0FA 3THRA 1EWYA 1SG9A 4M1YA 4S05A 3SDSA 2DVMA 2AX4A 2WU8A 2GK4A 3H9JA 1OX5A 1SK8A 2WMNA 3O2JA 4IVPA 4RA6A 5SZHB 2ORYA 3W4IA 3AJDA 3TL5A 1PQ4A 3LU1A 4X6LA 5BPPA 1GA6A 3TJZA 4WZ3B 3ESYA 3TRIA 2V5FA 2KZTA 1AZTA 1YQUA 1UQTA 4IHJB 4N8EA 3GVPA 5HRYA 3GNSA 4MGKR 4U0JA 5C2YA 2IV2X 3GUYA 4IEFB 4IJVA 3R6TA 4OHBA 4PC3A 4UUNA 5L3QB 1JXOA 3K1TA 4MP3A 5AI6A 3D8NA 4AXBA 3IDQA 1UJ4A 3EGIA 1VSTA 4XI9A 2XOYA 1X7XA 2WSYB 4MJ7A 4RXTA 4WKBA 3N0TA 1Z35A 3NAGA 1IE3A 3NOGD 2BF4A 2PZIA 2ZB2A 4QSMA 5KBAA 4URFA 1YONA 2F3QA 3ENWA 1CZHA 2BDUA 5K8TA 1SG6A 2VP2A 1RKUA 3EZ6A 5K8UA 1WUTA 2R7MA 2MYOA 1U2PA 3GH3A 3GQBB 4NI5A 4OQ4A 4XQEA 4EPRA 1IBCA 1LNSA 1ESDA 2HHJA 3QVLA 4U2CA 5IS2A 2WFZA 4E5MA 2FW6A 1E1RD 3ZU5A 3O48A 4OJMX 4ERNA 4JSRA 4UQLA 4EYGA 3RE1A 4CLEA 2APJA 3TAXA 5SVYA 2I2BA 2J4CA 1MEOA 3C3CA 2FK7A 1OBFO 4XWAA 1RP1A 5A4MS 5FNVF 4MV7A 2II6A 5EKTA 3GLGA 3T8KA 2JJQA 3F2IA 3HCDA 3HRIA 1E2KA 3CSFA 3P96A 5EE9A 3R8XA 1EEXB 3FUIA 3VO2A 2BFMA 4PUCA 3H2YA 3A9VA 3CZMA 3INNA 4PANA 2X9LA 4C4XA 3Q98A 1J5PA 4U2BA 1Z5UA 3T3HA 3Q7AA 3A4MA 3FVTA 1JALA 3MK31 5C80A 5J3XA 5KYNA 3B8EA 2I1LA 4Z3OA 1W0JD 4XRRA 5JYEA 1C41A 1EK0A 1TO2E 3UF0A 5FEMA 5FXMA 1AF7A 1Z6ZA 3O2QB 2OOKA 3D1LA 1GUFA 2K2QB 3G7NA 1FNBA 3BVPA 4GXRA 1WB4A 4PRYA 3TL2A 4MDYA 2XUFA 3QVWA 4YDEA 1RXCA 1BU5A 3NS7A 3PZ2A 1ESNA 3VGPA 3ESBA 3FF4A 5GWXA 5HF9A 2HNAA 3AI3A 5DHPA 5LQUA 4EJ2A 1M6EX 1NDUA 2CVOA 4J6FA 1JWFA 3EIUA 3D43A 4CL8A 3TG5A 3D5QA 2X23A 1JQLB 2QN6A 1O1TA 4WUYA 1IY0A 2DWQA 5CLLA 2POCA 2VT6A 1KFJB 1FFXB 4LBVA 5I7OA 1CJBA 3P0EA 4Q3AA 4LXQA 1ZW6A 5ANRB 2BJWA 5C8YB 4P7GA 1TXGA 1WR8A 2WJVA 5GM2A 2DFNA 4P3PA 4Z7OB 3ZPXA 3EGEA 4N5MA 2YZ2A 2IO2C 2VUSA 4QZVA 2P30A 3FTVA 1WM5A 5KC8A 1TKAA 2ZIXB 5IYZF 1UP6A 5KX5B 4ZHQF 3LM8A 4HADA 1TK3A 4NPHA 1P1BA 1SBIA 3QH4A 4EZBA 1TAUA 2P40A 3PHIA 4L50A 1WBDA 1G5IA 1ZLYA 3U7IA 2QRHA 3OF3A 3K5IA 3QFHA 2LAUA 2O06A 1EP3B 3TAUA 5K4HA 2B0OE 2H59A 4QFBA 4W7IA 1G0NA 3MMPA 4DIKA 4YAGA 4I1PA 3CRQA 2PYDA 4AIFA 2Y68A 3I73A 2XPZA 2YOFA 4C43A 1O54A 1TJ3A 2ZUEA 1U3VA 3HB0A 3VRHA 1NYLA 1NQTA 3TIGA 4LRSB 1VL0A 2DPHA 2HF7A 4R40A 4MYHA 5DGCA 3ANYB 3TW6A 3H7HA 3NAMA 3E0QA 4KBQA 3FX2A 1PHRA 1K5HA 1T9GR 1FPMA 3GV0A 3JQAB 2YZMA 4WOKA 2NC9A 3NIFB 3QKSA 4N03A 4RE6A 4B87A 4JEMA 1XT6A 1G9SA 1JOCA 1N5MA 2HQSA 5JROA 2QK4A 2AOXA 2WIJA 2C8KA 3N8KA 4EPWA 1RLJA 3AXSA 1UM8A 3EX7C 4UTVA 3FDFA 1GKKA 1C5KA 2PU7A 4BKPA 4HQ0A 4J0JA 1L8OA 1UBHS 1JHPA 4JKYA 3E23A 1K97A 2H4JA 2Y1DA 3CKYA 2NIPA 2BVNA 3KUXA 5IX8A 5JXJA 3LDZA 4KO1S 2RD0A 1HC7A 3OMLA 1C9YA 3SHFA 2SKEA 2JGLA 1H9CA 4LK3A 2AS0A 3Q9UA 2QU7A 4KUEA 1UBEA 2D13A 2LRHA 2W2LA 2VZ8A 4ANVA 3K2IA 2R47A 4HFJA 2BF0X 4JJKA 4QIHA 3MYVA 2FG5A 3I9JA 4TRNA 2ZJ4A 1MDBA 3IVCA 2Z2XA 4AB1A 4RULA 1R5BA 2FW8A 1K89A 2ZI9A 5IDWA 2J0UA 1P3JA 1J0AA 1X7GA 2EYQA 3WLOA 4R54A 3AP1A 1ISSA 3GJ8A 3Q7EA 5IM4A 2VSQA 4IJKA 4NZ9A 3OTWA 2VIIA 1S8FA 5CM2Z 2J09A 3HNRA 2CUNA 3CUSA 1KK1A 3Q15C 4JS0A 4UOEA 5A3RA 4GZ6A 5TGZA 1UC5B 1QE3A 1QOQB 3DMGA 1P91A 3MMXA 3QVTA 4IJWA 2OVFA 1JW9B 1KF0A 1PLJA 2OMKA 4ZU6X 4ZT2A 4NE2A 1Q0TA 3PLAE 2O8CA 4ALIA 1C9JA 3G8BA 1UXGA 4H59A 1Q0ZA 1SQGA 1E2NA 5K20A 4F7DA 4HDNB 4TX1A 4JDUA 4QWWA 1RJGA 1E8XA 4NV3A 1BN6A 2A57A 4E5YA 3W6NA 1SKAA 2HPHA 4H7HA 4V1CI 3KLBA 2FSGA 1KOJA 3QB2A 1M83A 1NBWB 3EU9A 2JMIA 2H63A 2IPOA 2YJNA 3GVHA 2IC5A 3OM9A 3ZCQA 2PA3A 2J6BA 1E2BA 4MUMA 1NIPA 4YDYA 1QS0A 2HFJA 3NHUA 2YSMA 1NA5A 4O3MA 4WA7A 2Q6KA 4WZBB 5F5XA 5COAA 1XPRA 1I2ZA 4CT4A 1NT2A 3IUBA 1NBMD 2CV0A 4Q4JA 3LL7A 3RKSA 2IKSA 2JGKA 2K1JA 3ZJ4A 1DAGA 2BFFB 3IMEA 1OTXA 3B1WA 4JI3B 4OP2A 2QFCA 4Z68A 5FEYA 1U0HC 1VHWA 3RRFA 4HQFA 5AJUA 4EJSC 3E5NA 3IBYA 4C6TA 1I4LD 5IKPA 4KNYA 5KPJA 3TG8A 1FCJA 3A3NA 1DQYA 2P3SA 2R84A 2PKRA 1YRYE 3QELB 2VEDA 1K68A 2ZCVA 4OHRA 5GZ1A 2UZIR 4QPDA 1MAHA 1P73A 2P4SA 4GYOA 3FPAA 4WH0A 5DIFA 1JEDA 3OE4A 5C1DA 3HVHA 3OE5A 5BN5B 4D0SA 4FI3F 3PVZA 1RHKA 2FPLA 4BAUA 1E2HA 2PXXA 1H4SA 2HWKA 2UUCB 1YRAA 1HL7A 3TQSA 1MB9A 4TTVA 4URZR 1CUZA 1HQKA 4WEQA 2FLVA 1XRJA 2X0JA 3QX7A 2IDZA 2AN6A 3NQ41 5H9WA 1PR3A 1LLCA 1U2GA 1WILA 3TG4A 3LXXA 4M22A 4AMGA 3SM9A 2ATCA 3V9AA 5K0GA 5LLDA 4N3AA 1ABFA 2L19A 2C0LA 3DSVA 4L95C 1LJ8A 3OA0A 2YT5A 2B6CA 2SKCA 4AYXA 3UK0A 5DBKA 4BQEA 3SIRA 3ITDA 1FUYB 2PQ0A 2VTDA 3L0IB 2WW8A 3LS2A 4E3WA 4YCCA 3N9LA 1MAUA 5GZ3A 1N11A 3NM4A 3JAWB 1U7ZA 1P8AA 3QRWA 2W22A 4WNFA 4CV2A 3G89A 1Y81A 3TCKA 2P77A 3HL4A 3RSGA 3FWPA 4NCAA 3UTCA 1LRLA 4L15A 1W35A 5KJLA 2OO3A 3HCRA 3N87A 3I6IA 4AY6A 4J29A 5D84A 1VMKA 4X1IB 3IP5A 2LV9A 1JKFA 4OVUA 3BDAA 4XZ3A 3BD8A 2CDAA 4ZPJA 3UYKA 1UMCB 2HLDD 1O1YA 4GE3A 3B3AA 1KMMA 3U09A 1CR4A 4DN6A 3U4QB 5F9MA 1DIOB 3PDIB 4JQOA 3O3MB 4OOEA 4YUWA 1T3HA 2R8PA 4L2IA 3WNCA 3K71B 2BFNA 2ORWA 1NI1A 4IPTA 4DLZA 3B5EA 4PZDA 5E9QA 5CEDB 4B7YC 4JZYA 3PRJA 4OU5A 4FMPA 5MDHA 2DECA 2PLNA 4IYPA 2CSYA 1QHNA 2XCIA 2XKAA 2YV5A 5AXAA 5CA0A 1A4UA 3WMEA 4DSNA 3UAGA 2IELA 3AETA 4HWOA 4ZAZA 2BHSA 3LCVB 1R10A 1O97C 2XE4A 5IM5A 4CZ2D 3KZCA 4MR8A 1BG6A 2WI8A 1GN8A 2JJ2D 1L3BA 3GEHA 3L7JA 4AO6A 3VSDA 5K3FB 2NO0A 2F9FA 1GPUA 5D85A 4F4JA 4C0MA 1XCJA 3IOMA 1IJKA 2H1SA 4FYKA 5KOYA 3VUEA 2G7ZA 4I55B 4ARUA 5UKDA 3GLGE 5IVHA 3P2OA 1QC5B 3TPZA 5E0OA 5JQWA 3RTGA 2XT0A 3W2IA 2B4YA 2RBGA 1XTZA 3CLTD 4RSYA 4QX6A 3QTBA 3RUIA 4FINA 4NICA 4E5NA 5CVTA 3DQPA 1UOEA 3TWUA 3ND6A 4FYYA 1IAQA 5EZYA 4DQ0A 1R8JA 5D6OA 4KQXA 1CZRA 2WSIA 4HTFA 4YEDA 4WNCA 5E1BA 5K0SA 2XZLA 2IS2A 4ARAA 2ZAMA 5ALGA 2O3UA 1DZIA 3ZZ1A 5KINB 1ZJ4A 4URKA 1J2TA 2A33A 2ZJ8A 5LWHA 3QLUA 2WAOA 5F4ZA 3RK0A 2JCVA 1DG1G 2JGNA 3TW4A 1Y82A 5DTJA 3RABA 3W2TA 3CVXA 2IGTA 1L7VC 2V7EA 3I58A 3KU1A 3O4HA 1GZ6A 1G21A 3NALA 4N18A 4OAQA 3A28A 1Z18A 4UTZA 2PO7A 4LWOA 1XD9A 2F3SA 4DK5A 1VHDA 3I0NA 4M0MA 3KUKA 2KBFA 2B2XA 4QQFA 1OFUA 2NN3C 3KOUA 4WT7A 4Y2HA 4N2QA 3SF4A 5SVXA 2IIVA 1D1QA 1P2TA 3I5UA 5ILQA 4XGNA 5KU7A 5EINA 5CLFA 2QW8A 3CG0A 1U2RA 3DPUA 3TKYA 5IZCA 1GR1A 3N9OA 1Q0QA 5T8KC 5H7PA 1QMPA 3QZUA 4HDCA 3MTEA 2QAGA 4OLAA 1P72A 4WKCA 1Q83A 2CYCA 1GTJ1 3R1IA 3QXGA 2QTRA 4RK1A 3R7AA 4P84A 3GUVA 3IQHX 2ZT7A 3QBTA 4HQKA 3U13A 2BZ1A 3H2BA 2CFOA 3SG0A 3GELA 1J7KA 4CM4B 1N3BA 5LP0A 5G0FA 1U1EA 1U11A 1MFPA 1V7ZA 2AJBA 4JYCA 1VPWA 3NEAA 2ZJZA 2AFIA 1K3TA 1KJ8A 3ZQ6A 4MWBA 2G4VA 4GYJA 4DLWA 1KWKA 4K05A 2CXUA 3OI7A 2X8WA 2V3CC 5FUMA 3ANSA 1UANA 1TPYA 3AVXA 4YX9A 5FR1A 3W9YA 4GP7A 3IPCA 1T43A 1RCUA 2AI3A 1X1AA 1U6GB 3HR7A 4ZT5A 3M7IA 2QMEA 2XGGA 4EI7A 1X7WB 1RVV1 4MUKA 2PM7A 5EJEA 2KM4A 3DVLA 3TI7A 1N95A 2UYOA 1I13A 3QKUA 2PX5A 4FZRA 1Z5VA 3VYSB 4E6PA 3E1SA 1E90A 1C4XA 1I14A 2VAWA 5FEUA 4EHIA 3R76A 4YJFB 1P3Y1 4L7QA 4LYYA 5EX3A 4TZ0A 3GPDG 3JZMA 1JU4A 2AMJA 4TTQA 5CH3A 3JCKC 3HCNA 3W8NA 1I1NA 3L8MA 3ZY2A 4CF5A 2NTNA 4GNDA 4C2BA 1ELRA 4YROA 2YHAA 3RDPA 1ZCFA 1YDEA 1PAQA 3M4ZA 5LCXA 3EMBA 5CTAA 1XQ6A 3RAPR 1FSFA 2O3SA 4US2R 3TOCA 5TEWA 3PS6A 1IHYA 3PCRB 2Q1WA 4A3TA 3DOUA 3LX6A 3ZZTA 5C1PA 5C1BA 4UZFA 1SAYA 5FX2A 2NSZA 3R3WA 3M63A 2H1VA 2ODTX 2PUTA 2WTBA 1I6KA 4Z4GA 4HVBA 3GCWA 3JQPA 1O6BA 3F8SA 1GFWA 4ZO8A 2FQXA 2WZBA 5T6MA 3V31A 5CBNA 1SUWA 3Q5DA 2FN8A 4NK4A 1Z5ZA 2FEOA 4WHMA 2VG8A 5T4HA 4DSUA 1C3XA 3TECE 1VOTA 2WD9A 4UP5A 5SZIA 2IBSA 2AKEA 3PDNA 3DKRA 4C5CA 1P8JA 2I33A 4FP7A 1EK5A 4Z0TA 4X1IA 1E94E 4GPD1 3IVXA 3V00A 1RQGA 1IZZA 1XMIA 4NPCA 2FRDA 1MV8A 4M1QA 4NXNB 2JFBA 1IHBA 1FT1A 3VKFA 1D09A 4ZGGA 3QVJA 1AY0A 2J6HA 2PSHA 4GSYA 4HNAB 2ZI3A 4A8JB 3ZDAA 4Y6OA 2BF7A 3B9RA 2EYUA 3HR8A 5EMHA 2DFDA 5JG7A 2R8BA 5JE8A 4LF8B 4Y9TA 1VLHA 3R24A 3ZE2B 4ID9A 2C8LA 5KWJA 1SOMA 3KEFA 3Q1DA 4JLJA 2QS9A 2G0AA 4LDZA 3ZIMA 4Q3DA 4YRRA 3B3FA 4C04A 2GCEA 5AJZA 2W58A 2P91A 3MCAA 5AQBA 2HC9A 4OKIA 4UUAA 2PUGA 3K53A 3KZOA 4OHZA 2AN3A 3IILA 3CSTA 3NDBB 2WTEA 3CKMA 1HG1A 5T6BA 3RRZA 2C0PA 4XIFA 1S5PA 4AP6A 4MITA 5FWXB 3JWIA 2QU8A 2OHOA 1J0DA 5B2FA 5IU6A 1MIOA 2ST1A 2ZYRA 3ENKA 3ILVA 3NWBA 3ETHA 1ZMXA 3MJSA 2QXUA 1U2ZA 2XVAA 4QQKA 1Z5OA 4OHMA 4Z7QB 5B58T 3F5QA 1SULA 2UZGA 3CA8A 3Q3JB 1BS2A 4KIWA 3BCRA 3AO0B 3HH8A 4I9HA 1FFDA 1S4MA 4L02A 2EZTA 3QVVA 1Y3IA 3EDRA 4OVKA 5JCJD 1MIOB 3CO5A 5JA4D 2XD9A 5G4KB 5ANLA 1E2JA 4M86A 3T61A 5DNUA 3FTCA 3PNTB 1M7BA 2IHZA 4X1YB 3LRXA 5KS2A 2HM7A 3CEJA 4Z7NB 1JKMA 3OOWA 1AZLA 2Z1DA 1V8OA 1Z8HA 3IEPA 4JIMA 4WMLA 4CEHB 4DUYB 2ZR7A 4MS4A 4ZOCA 3CHPA 1PR5A 2I78A 3DDZX 5DWDA 1NFIE 2EQBA 4MUIA 2JLXA 3MIZA 3FBWA 5AQ7A 4NJEB 4PTYA 1OXMA 4PAQA 3PEVB 1K63A 4PTLA 4FC7A 4O5OA 2RJNA 1YVEI 2QMHA 3NHZA 3EISA 3WDKA 2BC9A 4X64B 3E33A 3QAQA 1T26A 4K88A 1BKSB 3EBLA 1N0IA 5DN9A 1FDWA 3LPZA 1NVBA 4ZOLB 3CPHA 4LSWA 4TLEA 1IWPB 3VNRA 3DG9A 2XVYA 4J0HA 1OLUA 2GZ2A 3F73A 5A4JA 4ZI3A 4YFYA 3QKWA 4A6EA 3EQ7A 2E4YA 1UBJS 3PNKA 4DKXA 3VKHA 2IRWA 1HL3A 3N39C 2OOSA 2R7AA 3K32A 1E2UA 4DZTA 4F2GA 4LOJA 3UJ9A 4ZI2A 3RHZA 4KMOA 2OXRA 4RE5A 4DUZB 3ETCA 1D2GA 1YZVA 2I66A 2H54A 2GJAA 5JNVA 4JV5B 1CRPA 2QRJA 3DR3A 2DUMA 3PTLA 2GH1A 3D31A 3P20A 4FOSA 3JYHA 1QZZA 4AN1A 4DIUA 3DPSA 1CP3A 4FK5A 1HETA 4OI4A 4LE0A 4UBJA 4ERXA 5CURA 3AKDA 1NF8A 5KWDA 1T8SA 2YJTD 5TE9A 4KKXB 5JLAA 3JS5A 2I6UA 2PO5A 3FYUC 3H99A 2JD1A 3W0LB 4E14A 3X44A 1V6CA 1OT5A 3LT0A 4CL2A 2IPNA 5KYXB 2P6RA 1QQ5A 2YRXA 4TKUB 4DCSA 1QZXA 1XAGA 4DF3A 2JFXA 2XTNA 4C6TB 4Z4QA 4XQ9A 5BT8A 2PS0A 4OQYA 2XUGA 2EIJE 3KJFA 1MHTA 4P83A 1X7WA 3TQCA 3WX0A 4B76A 1H93A 2JF0A 2DPMA 2NT3A 2OSBA 2REBA 1Q20A 1E6EA 1ISHA 2ZBVA 2G71A 4R9RA 4A1GA 1X1RA 3VV2A 1CDZA 3UIOC 1A5ZA 1WSDA 2QD1A 4YJFA 2BEUB 2JVKA 2CEKA 2NWQA 4AP2A 2VPZA 3UCEA 3T1QA 4PGHA 1ZC3A 4HQNA 3N70A 4KN8A 1K92A 3DVRX 2J0VA 4B7XA 2O1SA 3EB9A 5FYDA 3COJA 2O2GA 1AV6A 1DAMA 1RAFA 2W6PA 1O8BA 4KXNA 1CQXA 3VKWA 1P2FA 1GTMA 3NGXA 3ZYQA 1AHIA 3FYCA 4EJ0A 2L0BA 1K2FA 2IYPA 4YLGA 4NE9A 1A88A 4FJ2A 4O0MA 3WMXA 2HYIC 4DA8A 2O4UX 3AJ9A 1LDYA 4LCEA 4B8CB 2HK7A 1Y33E 2Q07A 1ETHA 4MUJA 4Z9YA 4BNIA 4OYHA 4TQUS 3GRYA 2A92A 4WY2A 3KJXA 5CJJA 1N2JA 3U1TA 1SY7A 1NNI1 5EXXA 2Z9BA 2IP4A 1PU2A 1IZ8A 1RM5A 5AP9A 2GVNA 2OKGA 4H7KA 3WKAA 1J0XO 2D2IA 1FQJA 1HT3A 2DU8A 1T2VA 3IAS1 4AZVA 1ZZEA 2QUKA 4JSTA 1EZ1A 3OA2A 1GZSA 3CNHA 4NCXA 4XB6B 4CL0A 3PX7A 2AXNA 1ZD1A 2AQKA 1EP2B 3GZJA 4EM6A 4C20A 1N6PA 5BQOA 3CVWA 2YRWA 4NMHA 1J2EA 1D7AA 1T6BY 1ONBA 2WVIA 1ECGA 2NSLA 4I19A 3NTQA 5J4HA 4V03A 1EHIA 1EINA 2C0CA 3KOOA 1K7CA 3QYPA 1D2AA 5EYAF 2OBYA 3D1VA 1K88A 2O2XA 4G81A 4MV6A 3ZHEA 2PNJA 3WK7A 3U6BA 3IXQA 3OT1B 2W2QA 4RZ3A 1CY8A 3ZW3A 1O5IA 1Y7PA 4N7JA 4A5SA 4RPHA 3TLGB 2RH5A 8LDHA 5LC1A 1XYYA 5JHBA 1VZ3A 2Q27A 2ZUWA 3OQHA 2C2KA 2VGEA 1Q21A 4B47A 1TL7C 1AIPA 4OAPA 3U7RA 2WAMA 3GLHB 2Z2YA 2PVCA 5AVTA 4J2TA 1BE6A 2W37A 3MEQA 1F62A 4KAXA 3WDSA 3EU5A 1W88A 2YHEA 4MP6A 4MIEA 2HF8A 2FVYA 5F2EA 1JSLA 3SZUA 2CHQA 5KYUA 5ALHA 2FG7C 2JEYA 1XHFA 4GBED 2CNBA 4N82A 1RZRA 2VH5R 2FLKA 3O8QB 3OZDA 3C3MA 3BGIA 4U2KA 2I3GA 5AKXA 3H5NA 2X9QA 3PRKE 3WGVA 1Q16A 5EKQD 2QE6A 2I3BA 4X45A 2RHMA 4X20A 1JWAB 5AI0A 5BWNA 3GLIA 3SVZA 5FTPA 1AX9A 2LGLA 1QLJA 1XYGA 4UCQA 2VJFB 3SGLA 4J1TA 4RH1A 4ND6A 2QQEA 1YBAA 3EFOA 4FKMA 3IKTA 2JAHA 1FDOA 2QRVA 1BXGA 2OORC 1WAMA 4LZLA 1FFGA 3CLUD 2BZ0A 4JLMA 4D9KA 1SIOA 4L4RA 1EUQA 1CEQA 4CEMA 4NJMB 4F3KA 3JXIA 4ZALA 3EGVA 3UMYA 3JQ9A 4FHDA 4OGCA 2WNSA 1ABEA 2OCKA 4R5MA 1MX3A 5IARA 5G0TA 3L4EA 4WVFA 5JJBA 3PDIA 3EB5A 2ZSIA 3ZOKA 1D8EA 2XDQB 4X65B 4WWNA 5JRZA 3K6RA 3LVBA 5TMDA 1U04A 2ADOA 3QKTA 3T1VA 5CAEB 5D3ZA 3OQMA 1ZN7A 1FL9A 1V45E 5HX7A 3B7PA 4G89A 5DKFA 1GL9B 3GVXA 1SURA 2ZJBA 3UHJA 3WBJA 5A4AA 1T5SA 4CQMB 4O4IA 4FEGA 3GA5A 1G19A 3T9KA 1Z73A 3TW0A 3NBFA 5AW9A 1Z37A 1WQ1R 4Q93A 3Q47B 2CVFA 1JPNA 2YWJA 4FOPA 2VOJA 3KQWA 3LYLA 5CBPB 2VOEA 4GL2A 1W9HA 4MDFA 1ZA1A 2W83A 1U0EA 1W30A 3HSSA 4O08A 3CISA 1E3DA 2R25B 3C43A 3WLAA 4HNTA 2VQDA 3N2ZB 4AUMA 5CBOA 3ILHA 4J03A 1GKUB 1XVUA 2YVQA 4GMXA 5BUSA 4RLFA 3SYLA 2XCLA 2F17A 2NM0A 1P2BA 4RTMA 2QTBA 4V1CA 2C7RA 1QC5A 2A2ZA 4QO7A 1JDUA 1EI9A 3SF0A 2FPKA 1TO1E 4M7WA 1G2OA 4N01A 4BV8A 4BE4A 1PQYA 4LBYA 4KR9A 4UXIA 5LP1A 1H3FA 1G4AE 4W9NC 1C4KA 3D7KA 3I32A 4CW7A 3CVVA 2QPOA 3A2NA 1U8ZA 1TIBA 2HLDA 3HN2A 4ER3A 3SYTA 2G67A 2BRUA 3H5LA 3N76A 1N2EA 4G8LA 1Q74A 3MCXA 4UWHA 2IYFA 3IX7A 1KO4A 1UIMA 5FQ4A 1KSFX 3KP1A 4WLFA 1EXNA 3MS7A 3EOBI 2IV7A 1NXTA 2FPMA 2WHPA 2C4UA 1NRXA 4QJ4A 2MDTA 3S2AA 1BD8A 1UT6A 4C7KA 3TQIA 3HBMA 4F21A 1WVGA 2CKLA 2QUHA 4A63B 1KP9A 4RV5A 2WJ3A 3E61A 3O95A 3PEUA 4LE1A 4EBFA 2HMSA 5JMWA 2I7TA 1TR4A 2FX5A 2XA1A 2RC6A 1GZVA 3LIIA 3TD9A 4AS3A 1NJ8A 4FJ1A 1CWUA 1PZXA 4DCVA 1BOOA 4CLOA 5JR3A 1V43A 1XD2A 4YACA 4XD7D 1OWNA 3Q12A 3T9BA 9GPBA 1E96B 1EVZA 4XJXA 2W9XA 2EFHB 4WERA 4FOLA 4EG3A 1QHEA 3IVAA 3N5KA 2YQ4A 3C4VA 3OC6A 3IURA 3FUXA 1C7JA 2PL5A 4PCVA 2MUMA 1NQVA 3FMPB 1G7TA 5EPOA 2VF4X 3SQNA 3VPFA 3WZ2A 4DRXB 2ISSD 5JI3E 3DYIA 1I1HA 4C4YA 1FFWA 4HUTA 2LWIA 2CLHB 3DEYX 3QE3A 4DDUA 1PVVA 4FWTA 2JRJA 4D9BA 2BMDA 2RIPA 1X7YB 4MEBA 5IC4A 1PZEA 3ZHRA 1KQFA 2EIXA 2P5YA 5ITSA 3TBFA 2XP0A 1WW8A 3KTAB 4AP4A 4MPDA 3IEKA 1IAVA 5HQJA 1SPBS 1JJ7A 4WXYB 1OI3A 2PAFA 2V1XA 2R6DA 2Q7FA 4KYOB 1NN0A 1XZEA 2PA0A 3E48A 3SC3A 2M6LA 3GNTA 1G20E 5CEJA 4BU1A 3MZLB 1VE1A 2J30A 2VP7A 4FHKA 4TXMA 1F4PA 3HM9A 4H2DA 1QOPB 3JX9A 4PYLA 1JZTA 3P26A 3MGCA 5FF9A 1COWD