2KWNA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing acetylation at lysine 16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwnA00
2LRIC 3O33A 1WEVA 4QF2A 4LJNA 3I2DA 4R7EA 2YYRA 4LKAA 3L1XA 4IC3A 4CCGX 2JMIA 2VJFB 2YUCA 3LQHA 4YC9A 3T6RA 3FL2A 2BAYA 2ECTA 3VK6A 1ZBDB 5TDRA 2YQMA 4V3LC 2YREA 4YBSA 2PUYA 5B8DA 4AYCA 3MHHA 2VJEA 4LLBA 4GNEA 2M6MA 4AUQB 2CKLB 2K16A 1DVPA 2L5UA 3L11A 1IYMA 2ECWA 1WESA 2Y1MA 3T7LA 4S3OC 3O34A 2CSZA 1WEOA 2Y1NA 4N3WA 2LGLA 3RPGB 5KH7A 2KIZA 3HCUA 4GNFA 2MNZA 5DINA 5FEYA 1WILA 3KNVA 2LV9A 2ECNA 2LQ6A 2VP7A 2PNXA 2C2LA 5TDWA 2I50A 2M85A 4FO9A 4YABA 5I3LA 1X4UA 3IHPA 2CSYA 5B79A 4FJCA 2AN6A 4XI1A 3PHDA 2E6SA 4BHWA 3RPGC 2LGKA 3LQJA 4IC2A 3GV4A 2XEUA 5TRBA 2OXQC 2KYUA 4WZ2A 2Y43A 4L7XA 1WFKA 2KREA 2F42A 4LK9A 4GB0A 1WEWA 2JMDA 1VFYA 5B78A 4I7CA 1JOCA 2KR4A 2YURA 5LKZA 5DKAA 3KQIA 4YAXA 1JM7B 2L75A 4A49A 2KWOA 4S3OB 2H0DB 1WEPA 2LXPC 3NG2A 4YATA 1FP0A 2NAAA 4A4BA 3RTRB 1WGMA 1E4UA 2IDAA 3O70A 4FK5A 5EYAF 3O7AA 4I7DA 5H1UA 5AIUA 3KV6A 3PUQA 1CHCA 4B7YC 1Z2QA 5C13A 1Z60A 3ZNIA 3M99A 3LQIA 2K1JA 2EODA 4L58A 5B76A 3DPLR 3U5OA 4W4UA 2LGGA 2EGPA 1Z6UA 5LCWB 2YQLA 3HCSA 3M63A 4MSXA 5D1LB 2VJFA 2KE1A 4Q6FA 3N9OA 4N4FA 4C9ZA 2YSMA 1WIMA 5B77A 2MNYA 3N9NA 2MA5A 3N9PA 5TBNA 3GL6A 5D1KB 2JMJA 3KV5A 4B86C 2FSAA 2KWJA 1K2FA 2YHNA 1MM2A 4YBTA 3HTKC 2FUIA 1LDJB 1F62A 2YT5A 3U5MA 2MA6A 4TKPB 3ZYQA 3QZVA 1HYIA 2RI7A 4LADB 5JG6A 3DQVR 2LGVA 2G6QA 4YBMA 2L80A 3ASLA 2K4DA 5LKXA 3EB6A 2ECIA 2ECJA 1X4IA 3N9LA 2HDPA 3L1ZB 2KGGA 5G05B 2YW8A 4FIPA 4AYCB 2YHOA 3EB5A 4BBQA 2QICA 2E6RA 5FB1A 2VJEB 5LKTA 3M62A 5G04B 2VNFA 4GNDA 3O36A 1WEMA 5G0FA 1WEQA 2G45A 5AITA 2MD7B 5TABA 4O64A 4YADA 4GNGA 4R8PK 2RSDA 3ZVYA 4NN2A 2KFTA 4UP5A 1WEEA 2ZETC 4QF3A 5C11A 2MUMA 1T1HA 5B75A 3HCTA 3O37A 2C2VS 4UI9B 5LKUA 1X4JA 4R2YA 4ZQLA 3ZPVE 2M1RA 2M3HA 3ZPV1 2EA6A 1WE9A 1FBVA 2MIQA 2G43A 1BORA 1JM7A 4WA6A 3SOUA 2ECVA 3ZVZB 5FERA 2H0DA 1HYJA 1MM3A 1U6GB 5KH9A 5H1TA 2K17A 2F6NA 2VPGA 2LN0A 4PPEA 3MHSA 1RMDA 2KWNA 5J3XA 3SHBA 2F6JA 4WZ0A 2CT2A 1VYXA 5D1MB 2L0BA 4I7BA 1LDKC 4WZ3B 3ZTGA 2KWKA 4F52B 2XB1A 2VPBA 5H1VA 2MD8C 4A4CA 1N87A 2HYED 4X3GA 2ECGA 2DX8A 2CKLA 3C5KA 3U5PA 1VD4A 1WENA 3C6WA 4ZUXU 5FB0A 4AVXA 2YU4A 3N9QA 3N9MA 2QIZA 2D8SA 2FUUA 5H9MA 2VPEA 2L43A 2YSJA 1WEUA 4A0CD 3SOWA 2VPDA 2KGIA 4AP4A 5KH3A 3U5NA 3PURA 3LRQA 2LXHC 4ZDTA 4MVTA 4PTBA 4V3KC 2MT5A 4CA1A 2QJ0A 3O35A 1G25A 4P5OB 3SOXA 2KU3A 2UZGA 3V43A 2LDRA 2JRJA 1XWHA 1V87A 4UP0A
chains in the Genus database with same CATH superfamily
2LRIC 3O33A 1WEVA 4QF2A 4LJNA 2EGMA 3I2DA 4R7EA 2RR4A 2YYRA 4LKAA 3L1XA 4IC3A 4CCGX 2JMIA 2VJFB 2YUCA 3LQHA 4YC9A 3T6RA 3FL2A 2BAYA 2ECTA 3VK6A 1ZBDB 5TDRA 2YQMA 3LVRE 4V3LC 2YREA 4YBSA 2PUYA 5B8DA 4AYCA 3MHHA 4OGEA 2VJEA 4LLBA 4GNEA 2M6MA 4AUQB 2CKLB 2K16A 1DVPA 2L5UA 3L11A 1IYMA 2ECWA 1WESA 2Y1MA 3T7LA 4S3OC 3O34A 2D8UA 2CSZA 1WEOA 2Y1NA 4N3WA 2LGLA 3E2DA 3RPGB 5KH7A 2KIZA 2JM3A 3HCUA 4GNFA 2MNZA 5DINA 5FEYA 3FANA 3M7KA 1WILA 3KNVA 2LV9A 2ECNA 2LQ6A 2VP7A 2PNXA 2C2LA 5TDWA 3LDYA 2I50A 2XOZA 2M85A 4FO9A 4YABA 5I3LA 1X4UA 3IHPA 2CSYA 5B79A 4FJCA 2AN6A 3FJUB 4XI1A 3PHDA 2E6SA 4BHWA 3RPGC 2LGKA 3LQJA 4IC2A 3GV4A 2XEUA 5TRBA 2OXQC 2KYUA 4WZ2A 2Y43A 4L7XA 1WFKA 2KREA 2E61A 2F42A 4LK9A 4GB0A 1WEWA 2JMDA 3H7HA 1VFYA 5B78A 2FD4A 4I7CA 1JOCA 2KR4A 2YURA 5LKZA 5DKAA 3KQIA 4YAXA 2CRWA 1JM7B 2L75A 3O47A 4A49A 2KWOA 4S3OB 2H0DB 1WEPA 2LXPC 2L7PA 3NG2A 4YATA 1FP0A 2XP0A 2NAAA 4A4BA 3RTRB 1WGMA 1E4UA 2IDAA 3O70A 4FK5A 5EYAF 3O7AA 4I7DA 5H1UA 5AIUA 2YVRA 3KV6A 5SVIB 3PUQA 1CHCA 4B7YC 1Z2QA 5C13A 1Z60A 3ZNIA 3M99A 3LQIA 2K1JA 2EODA 4L58A 2EXUA 2XOCA 3JUEA 5B76A 3DPLR 3U5OA 2M13A 4W4UA 2LGGA 2EGPA 2KKXA 1Z6UA 5LCWB 3LJUX 2YQLA 3HCSA 3M63A 4F1PA 3Q1DA 4MSXA 5D1LB 2VJFA 2KE1A 4Q6FA 2LAUA 3N9OA 4N4FA 4C9ZA 2YSMA 1WIMA 5B77A 2MNYA 3N9NA 2MA5A 3N9PA 5TBNA 3GL6A 5D1KB 2JMJA 3KV5A 4B86C 2FSAA 2KWJA 2OWAA 3FEHA 1K2FA 2YHNA 1MM2A 4YBTA 3HTKC 2FUIA 1LDJB 1F62A 5SVYA 2YT5A 3U5MA 2MA6A 4TKPB 3ZYQA 3QZVA 1HYIA 2RI7A 4Z0OA 4LADB 5JG6A 3DQVR 3PLWA 2LGVA 2G6QA 3KDEC 4YBMA 2P57A 2L80A 3ASLA 2K4DA 5LKXA 3EB6A 2ECIA 2ECJA 1X4IA 3N9LA 2HDPA 3L1ZB 3LVQE 2KGGA 5G05B 2YW8A 4FIPA 4AYCB 2YHOA 3EB5A 4BBQA 2QICA 3SUBA 2E6RA 5FB1A 2B0OE 2VJEB 5LKTA 3M62A 2IQJA 5G04B 1MBMA 2KKYA 2VNFA 4Z0RA 4GNDA 2DSMA 3O36A 1WEMA 5G0FA 1WEQA 2G45A 5AITA 2MD7B 5TABA 4O64A 4YADA 4GNGA 4R8PK 2RSDA 3ZVYA 4NN2A 2KFTA 4UP5A 1WEEA 2ZETC 2JUNA 4QF3A 5C11A 2MUMA 1T1HA 5B75A 3HCTA 3O37A 2C2VS 4UI9B 5LKUA 1X4JA 4R2YA 2CRRA 4ZQLA 3ZPVE 2M1RA 2M3HA 5SVXA 3ZPV1 2EA6A 1WE9A 1FBVA 2MIQA 2G43A 1BORA 1JM7A 4WA6A 3SOUA 2ECVA 3ZVZB 5FERA 2H0DA 1HYJA 4OGCA 1MM3A 1U6GB 5KH9A 5H1TA 2K17A 2F6NA 2VPGA 2LN0A 4QQ4A 4PPEA 3MHSA 1RMDA 2KWNA 2FFWA 5J3XA 3SHBA 2F6JA 4WZ0A 2CT2A 1VYXA 5D1MB 2L0BA 4I7BA 1LDKC 4WZ3B 3ZTGA 2KWKA 4F52B 2XB1A 2VPBA 3FM8C 5SVIA 3FAOA 5H1VA 2MD8C 2CSVA 4A4CA 1N87A 2HYED 4O62A 4X3GA 1DCQA 2ECGA 2DX8A 2CKLA 3C5KA 3U5PA 2CONA 1VD4A 1WENA 3C6WA 4ZUXU 5FB0A 3DDTA 4AVXA 2YU4A 3N9QA 3N9MA 2QIZA 2D8SA 2FUUA 5H9MA 2MKEA 3T9KA 2VPEA 2L43A 2YSJA 1WEUA 4A0CD 3SOWA 2DJAA 5K3QA 2VPDA 2KGIA 4AP4A 5KH3A 2XOYA 3U5NA 3PURA 3LRQA 2LXHC 4ZDTA 4MVTA 4PTBA 4V3KC 2MT5A 4CA1A 2QJ0A 3O35A 1G25A 4P5OB 3SOXA 2KU3A 2UZGA 4H9DA 3V43A 2LDRA 2JRJA 1XWHA 3DWDA 1V87A 3MDBC 4UP0A
chains in the Genus database with same CATH topology
2LRIC 3O33A 1WEVA 4QF2A 4LJNA 3I2DA 4R7EA 2YYRA 4LKAA 3L1XA 4IC3A 4CCGX 2JMIA 2VJFB 2YUCA 3LQHA 4YC9A 3T6RA 3FL2A 2BAYA 2ECTA 3VK6A 1ZBDB 5TDRA 2YQMA 4V3LC 2YREA 4YBSA 2PUYA 5B8DA 4AYCA 3MHHA 2VJEA 4LLBA 4GNEA 2M6MA 4AUQB 2CKLB 2K16A 1DVPA 2L5UA 3L11A 1IYMA 2ECWA 1WESA 2Y1MA 3T7LA 4S3OC 3O34A 2CSZA 1WEOA 2Y1NA 4N3WA 2LGLA 3RPGB 5KH7A 2KIZA 3HCUA 4GNFA 2MNZA 5DINA 5FEYA 1WILA 3KNVA 2LV9A 2ECNA 2LQ6A 2VP7A 2PNXA 2C2LA 5TDWA 2I50A 2M85A 4FO9A 4YABA 5I3LA 1X4UA 3IHPA 2CSYA 5B79A 4FJCA 2AN6A 4XI1A 3PHDA 2E6SA 4BHWA 3RPGC 2LGKA 3LQJA 4IC2A 3GV4A 2XEUA 5TRBA 2OXQC 2KYUA 4WZ2A 2Y43A 4L7XA 1WFKA 2KREA 2F42A 4LK9A 4GB0A 1WEWA 2JMDA 1VFYA 5B78A 4I7CA 1JOCA 2KR4A 2YURA 5LKZA 5DKAA 3KQIA 4YAXA 1JM7B 2L75A 4A49A 2KWOA 4S3OB 2H0DB 1WEPA 2LXPC 3NG2A 4YATA 1FP0A 2NAAA 4A4BA 3RTRB 1WGMA 1E4UA 2IDAA 3O70A 4FK5A 5EYAF 3O7AA 4I7DA 5H1UA 5AIUA 3KV6A 3PUQA 1CHCA 4B7YC 1Z2QA 5C13A 1Z60A 3ZNIA 3M99A 3LQIA 2K1JA 2EODA 4L58A 5B76A 3DPLR 3U5OA 4W4UA 2LGGA 2EGPA 1Z6UA 5LCWB 2YQLA 3HCSA 3M63A 4MSXA 5D1LB 2VJFA 2KE1A 4Q6FA 3N9OA 4N4FA 4C9ZA 2YSMA 1WIMA 5B77A 2MNYA 3N9NA 2MA5A 3N9PA 5TBNA 3GL6A 5D1KB 2JMJA 3KV5A 4B86C 2FSAA 2KWJA 1K2FA 2YHNA 1MM2A 4YBTA 3HTKC 2FUIA 1LDJB 1F62A 2YT5A 3U5MA 2MA6A 4TKPB 3ZYQA 3QZVA 1HYIA 2RI7A 4LADB 5JG6A 3DQVR 2LGVA 2G6QA 4YBMA 2L80A 3ASLA 2K4DA 5LKXA 3EB6A 2ECIA 2ECJA 1X4IA 3N9LA 2HDPA 3L1ZB 2KGGA 5G05B 2YW8A 4FIPA 4AYCB 2YHOA 3EB5A 4BBQA 2QICA 2E6RA 5FB1A 2VJEB 5LKTA 3M62A 5G04B 2VNFA 4GNDA 3O36A 1WEMA 5G0FA 1WEQA 2G45A 5AITA 2MD7B 5TABA 4O64A 4YADA 4GNGA 4R8PK 2RSDA 3ZVYA 4NN2A 2KFTA 4UP5A 1WEEA 2ZETC 4QF3A 5C11A 2MUMA 1T1HA 5B75A 3HCTA 3O37A 2C2VS 4UI9B 5LKUA 1X4JA 4R2YA 4ZQLA 3ZPVE 2M1RA 2M3HA 3ZPV1 2EA6A 1WE9A 1FBVA 2MIQA 2G43A 1BORA 1JM7A 4WA6A 3SOUA 2ECVA 3ZVZB 5FERA 2H0DA 1HYJA 1MM3A 1U6GB 5KH9A 5H1TA 2K17A 2F6NA 2VPGA 2LN0A 4PPEA 3MHSA 1RMDA 2KWNA 5J3XA 3SHBA 2F6JA 4WZ0A 2CT2A 1VYXA 5D1MB 2L0BA 4I7BA 1LDKC 4WZ3B 3ZTGA 2KWKA 4F52B 2XB1A 2VPBA 5H1VA 2MD8C 4A4CA 1N87A 2HYED 4X3GA 2ECGA 2DX8A 2CKLA 3C5KA 3U5PA 1VD4A 1WENA 3C6WA 4ZUXU 5FB0A 4AVXA 2YU4A 3N9QA 3N9MA 2QIZA 2D8SA 2FUUA 5H9MA 2VPEA 2L43A 2YSJA 1WEUA 4A0CD 3SOWA 2VPDA 2KGIA 4AP4A 5KH3A 3U5NA 3PURA 3LRQA 2LXHC 4ZDTA 4MVTA 4PTBA 4V3KC 2MT5A 4CA1A 2QJ0A 3O35A 1G25A 4P5OB 3SOXA 2KU3A 2UZGA 3V43A 2LDRA 2JRJA 1XWHA 1V87A 4UP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRI C;  3O33 A;  1WEV A;  4QF2 A;  4LJN A;  3I2D A;  4R7E A;  2YYR A;  4LKA A;  3L1X A;  4IC3 A;  4CCG X;  2JMI A;  2VJF B;  2YUC A;  3LQH A;  4YC9 A;  3T6R A;  3FL2 A;  2BAY A;  2ECT A;  3VK6 A;  1ZBD B;  5TDR A;  2YQM A;  4V3L C;  2YRE A;  4YBS A;  2PUY A;  5B8D A;  4AYC A;  3MHH A;  2VJE A;  4LLB A;  4GNE A;  2M6M A;  4AUQ B;  2CKL B;  2K16 A;  1DVP A;  2L5U A;  3L11 A;  1IYM A;  2ECW A;  1WES A;  2Y1M A;  3T7L A;  4S3O C;  3O34 A;  2CSZ A;  1WEO A;  2Y1N A;  4N3W A;  2LGL A;  3RPG B;  5KH7 A;  2KIZ A;  3HCU A;  4GNF A;  2MNZ A;  5DIN A;  5FEY A;  1WIL A;  3KNV A;  2LV9 A;  2ECN A;  2LQ6 A;  2VP7 A;  2PNX A;  2C2L A;  5TDW A;  2I50 A;  2M85 A;  4FO9 A;  4YAB A;  5I3L A;  1X4U A;  3IHP A;  2CSY A;  5B79 A;  4FJC A;  2AN6 A;  4XI1 A;  3PHD A;  2E6S A;  4BHW A;  3RPG C;  2LGK A;  3LQJ A;  4IC2 A;  3GV4 A;  2XEU A;  5TRB A;  2OXQ C;  2KYU A;  4WZ2 A;  2Y43 A;  4L7X A;  1WFK A;  2KRE A;  2F42 A;  4LK9 A;  4GB0 A;  1WEW A;  2JMD A;  1VFY A;  5B78 A;  4I7C A;  1JOC A;  2KR4 A;  2YUR A;  5LKZ A;  5DKA A;  3KQI A;  4YAX A;  1JM7 B;  2L75 A;  4A49 A;  2KWO A;  4S3O B;  2H0D B;  1WEP A;  2LXP C;  3NG2 A;  4YAT A;  1FP0 A;  2NAA A;  4A4B A;  3RTR B;  1WGM A;  1E4U A;  2IDA A;  3O70 A;  4FK5 A;  5EYA F;  3O7A A;  4I7D A;  5H1U A;  5AIU A;  3KV6 A;  3PUQ A;  1CHC A;  4B7Y C;  1Z2Q A;  5C13 A;  1Z60 A;  3ZNI A;  3M99 A;  3LQI A;  2K1J A;  2EOD A;  4L58 A;  5B76 A;  3DPL R;  3U5O A;  4W4U A;  2LGG A;  2EGP A;  1Z6U A;  5LCW B;  2YQL A;  3HCS A;  3M63 A;  4MSX A;  5D1L B;  2VJF A;  2KE1 A;  4Q6F A;  3N9O A;  4N4F A;  4C9Z A;  2YSM A;  1WIM A;  5B77 A;  2MNY A;  3N9N A;  2MA5 A;  3N9P A;  5TBN A;  3GL6 A;  5D1K B;  2JMJ A;  3KV5 A;  4B86 C;  2FSA A;  2KWJ A;  1K2F A;  2YHN A;  1MM2 A;  4YBT A;  3HTK C;  2FUI A;  1LDJ B;  1F62 A;  2YT5 A;  3U5M A;  2MA6 A;  4TKP B;  3ZYQ A;  3QZV A;  1HYI A;  2RI7 A;  4LAD B;  5JG6 A;  3DQV R;  2LGV A;  2G6Q A;  4YBM A;  2L80 A;  3ASL A;  2K4D A;  5LKX A;  3EB6 A;  2ECI A;  2ECJ A;  1X4I A;  3N9L A;  2HDP A;  3L1Z B;  2KGG A;  5G05 B;  2YW8 A;  4FIP A;  4AYC B;  2YHO A;  3EB5 A;  4BBQ A;  2QIC A;  2E6R A;  5FB1 A;  2VJE B;  5LKT A;  3M62 A;  5G04 B;  2VNF A;  4GND A;  3O36 A;  1WEM A;  5G0F A;  1WEQ A;  2G45 A;  5AIT A;  2MD7 B;  5TAB A;  4O64 A;  4YAD A;  4GNG A;  4R8P K;  2RSD A;  3ZVY A;  4NN2 A;  2KFT A;  4UP5 A;  1WEE A;  2ZET C;  4QF3 A;  5C11 A;  2MUM A;  1T1H A;  5B75 A;  3HCT A;  3O37 A;  2C2V S;  4UI9 B;  5LKU A;  1X4J A;  4R2Y A;  4ZQL A;  3ZPV E;  2M1R A;  2M3H A;  3ZPV 1;  2EA6 A;  1WE9 A;  1FBV A;  2MIQ A;  2G43 A;  1BOR A;  1JM7 A;  4WA6 A;  3SOU A;  2ECV A;  3ZVZ B;  5FER A;  2H0D A;  1HYJ A;  1MM3 A;  1U6G B;  5KH9 A;  5H1T A;  2K17 A;  2F6N A;  2VPG A;  2LN0 A;  4PPE A;  3MHS A;  1RMD A;  2KWN A;  5J3X A;  3SHB A;  2F6J A;  4WZ0 A;  2CT2 A;  1VYX A;  5D1M B;  2L0B A;  4I7B A;  1LDK C;  4WZ3 B;  3ZTG A;  2KWK A;  4F52 B;  2XB1 A;  2VPB A;  5H1V A;  2MD8 C;  4A4C A;  1N87 A;  2HYE D;  4X3G A;  2ECG A;  2DX8 A;  2CKL A;  3C5K A;  3U5P A;  1VD4 A;  1WEN A;  3C6W A;  4ZUX U;  5FB0 A;  4AVX A;  2YU4 A;  3N9Q A;  3N9M A;  2QIZ A;  2D8S A;  2FUU A;  5H9M A;  2VPE A;  2L43 A;  2YSJ A;  1WEU A;  4A0C D;  3SOW A;  2VPD A;  2KGI A;  4AP4 A;  5KH3 A;  3U5N A;  3PUR A;  3LRQ A;  2LXH C;  4ZDT A;  4MVT A;  4PTB A;  4V3K C;  2MT5 A;  4CA1 A;  2QJ0 A;  3O35 A;  1G25 A;  4P5O B;  3SOX A;  2KU3 A;  2UZG A;  3V43 A;  2LDR A;  2JRJ A;  1XWH A;  1V87 A;  4UP0 A; 
#chains in the Genus database with same CATH topology
 2LRI C;  3O33 A;  1WEV A;  4QF2 A;  4LJN A;  2EGM A;  3I2D A;  4R7E A;  2RR4 A;  2YYR A;  4LKA A;  3L1X A;  4IC3 A;  4CCG X;  2JMI A;  2VJF B;  2YUC A;  3LQH A;  4YC9 A;  3T6R A;  3FL2 A;  2BAY A;  2ECT A;  3VK6 A;  1ZBD B;  5TDR A;  2YQM A;  3LVR E;  4V3L C;  2YRE A;  4YBS A;  2PUY A;  5B8D A;  4AYC A;  3MHH A;  4OGE A;  2VJE A;  4LLB A;  4GNE A;  2M6M A;  4AUQ B;  2CKL B;  2K16 A;  1DVP A;  2L5U A;  3L11 A;  1IYM A;  2ECW A;  1WES A;  2Y1M A;  3T7L A;  4S3O C;  3O34 A;  2D8U A;  2CSZ A;  1WEO A;  2Y1N A;  4N3W A;  2LGL A;  3E2D A;  3RPG B;  5KH7 A;  2KIZ A;  2JM3 A;  3HCU A;  4GNF A;  2MNZ A;  5DIN A;  5FEY A;  3FAN A;  3M7K A;  1WIL A;  3KNV A;  2LV9 A;  2ECN A;  2LQ6 A;  2VP7 A;  2PNX A;  2C2L A;  5TDW A;  3LDY A;  2I50 A;  2XOZ A;  2M85 A;  4FO9 A;  4YAB A;  5I3L A;  1X4U A;  3IHP A;  2CSY A;  5B79 A;  4FJC A;  2AN6 A;  3FJU B;  4XI1 A;  3PHD A;  2E6S A;  4BHW A;  3RPG C;  2LGK A;  3LQJ A;  4IC2 A;  3GV4 A;  2XEU A;  5TRB A;  2OXQ C;  2KYU A;  4WZ2 A;  2Y43 A;  4L7X A;  1WFK A;  2KRE A;  2E61 A;  2F42 A;  4LK9 A;  4GB0 A;  1WEW A;  2JMD A;  3H7H A;  1VFY A;  5B78 A;  2FD4 A;  4I7C A;  1JOC A;  2KR4 A;  2YUR A;  5LKZ A;  5DKA A;  3KQI A;  4YAX A;  2CRW A;  1JM7 B;  2L75 A;  3O47 A;  4A49 A;  2KWO A;  4S3O B;  2H0D B;  1WEP A;  2LXP C;  2L7P A;  3NG2 A;  4YAT A;  1FP0 A;  2XP0 A;  2NAA A;  4A4B A;  3RTR B;  1WGM A;  1E4U A;  2IDA A;  3O70 A;  4FK5 A;  5EYA F;  3O7A A;  4I7D A;  5H1U A;  5AIU A;  2YVR A;  3KV6 A;  5SVI B;  3PUQ A;  1CHC A;  4B7Y C;  1Z2Q A;  5C13 A;  1Z60 A;  3ZNI A;  3M99 A;  3LQI A;  2K1J A;  2EOD A;  4L58 A;  2EXU A;  2XOC A;  3JUE A;  5B76 A;  3DPL R;  3U5O A;  2M13 A;  4W4U A;  2LGG A;  2EGP A;  2KKX A;  1Z6U A;  5LCW B;  3LJU X;  2YQL A;  3HCS A;  3M63 A;  4F1P A;  3Q1D A;  4MSX A;  5D1L B;  2VJF A;  2KE1 A;  4Q6F A;  2LAU A;  3N9O A;  4N4F A;  4C9Z A;  2YSM A;  1WIM A;  5B77 A;  2MNY A;  3N9N A;  2MA5 A;  3N9P A;  5TBN A;  3GL6 A;  5D1K B;  2JMJ A;  3KV5 A;  4B86 C;  2FSA A;  2KWJ A;  2OWA A;  3FEH A;  1K2F A;  2YHN A;  1MM2 A;  4YBT A;  3HTK C;  2FUI A;  1LDJ B;  1F62 A;  5SVY A;  2YT5 A;  3U5M A;  2MA6 A;  4TKP B;  3ZYQ A;  3QZV A;  1HYI A;  2RI7 A;  4Z0O A;  4LAD B;  5JG6 A;  3DQV R;  3PLW A;  2LGV A;  2G6Q A;  3KDE C;  4YBM A;  2P57 A;  2L80 A;  3ASL A;  2K4D A;  5LKX A;  3EB6 A;  2ECI A;  2ECJ A;  1X4I A;  3N9L A;  2HDP A;  3L1Z B;  3LVQ E;  2KGG A;  5G05 B;  2YW8 A;  4FIP A;  4AYC B;  2YHO A;  3EB5 A;  4BBQ A;  2QIC A;  3SUB A;  2E6R A;  5FB1 A;  2B0O E;  2VJE B;  5LKT A;  3M62 A;  2IQJ A;  5G04 B;  1MBM A;  2KKY A;  2VNF A;  4Z0R A;  4GND A;  2DSM A;  3O36 A;  1WEM A;  5G0F A;  1WEQ A;  2G45 A;  5AIT A;  2MD7 B;  5TAB A;  4O64 A;  4YAD A;  4GNG A;  4R8P K;  2RSD A;  3ZVY A;  4NN2 A;  2KFT A;  4UP5 A;  1WEE A;  2ZET C;  2JUN A;  4QF3 A;  5C11 A;  2MUM A;  1T1H A;  5B75 A;  3HCT A;  3O37 A;  2C2V S;  4UI9 B;  5LKU A;  1X4J A;  4R2Y A;  2CRR A;  4ZQL A;  3ZPV E;  2M1R A;  2M3H A;  5SVX A;  3ZPV 1;  2EA6 A;  1WE9 A;  1FBV A;  2MIQ A;  2G43 A;  1BOR A;  1JM7 A;  4WA6 A;  3SOU A;  2ECV A;  3ZVZ B;  5FER A;  2H0D A;  1HYJ A;  4OGC A;  1MM3 A;  1U6G B;  5KH9 A;  5H1T A;  2K17 A;  2F6N A;  2VPG A;  2LN0 A;  4QQ4 A;  4PPE A;  3MHS A;  1RMD A;  2KWN A;  2FFW A;  5J3X A;  3SHB A;  2F6J A;  4WZ0 A;  2CT2 A;  1VYX A;  5D1M B;  2L0B A;  4I7B A;  1LDK C;  4WZ3 B;  3ZTG A;  2KWK A;  4F52 B;  2XB1 A;  2VPB A;  3FM8 C;  5SVI A;  3FAO A;  5H1V A;  2MD8 C;  2CSV A;  4A4C A;  1N87 A;  2HYE D;  4O62 A;  4X3G A;  1DCQ A;  2ECG A;  2DX8 A;  2CKL A;  3C5K A;  3U5P A;  2CON A;  1VD4 A;  1WEN A;  3C6W A;  4ZUX U;  5FB0 A;  3DDT A;  4AVX A;  2YU4 A;  3N9Q A;  3N9M A;  2QIZ A;  2D8S A;  2FUU A;  5H9M A;  2MKE A;  3T9K A;  2VPE A;  2L43 A;  2YSJ A;  1WEU A;  4A0C D;  3SOW A;  2DJA A;  5K3Q A;  2VPD A;  2KGI A;  4AP4 A;  5KH3 A;  2XOY A;  3U5N A;  3PUR A;  3LRQ A;  2LXH C;  4ZDT A;  4MVT A;  4PTB A;  4V3K C;  2MT5 A;  4CA1 A;  2QJ0 A;  3O35 A;  1G25 A;  4P5O B;  3SOX A;  2KU3 A;  2UZG A;  4H9D A;  3V43 A;  2LDR A;  2JRJ A;  1XWH A;  3DWD A;  1V87 A;  3MDB C;  4UP0 A; 
#chains in the Genus database with same CATH homology
 2LRI C;  3O33 A;  1WEV A;  4QF2 A;  4LJN A;  3I2D A;  4R7E A;  2YYR A;  4LKA A;  3L1X A;  4IC3 A;  4CCG X;  2JMI A;  2VJF B;  2YUC A;  3LQH A;  4YC9 A;  3T6R A;  3FL2 A;  2BAY A;  2ECT A;  3VK6 A;  1ZBD B;  5TDR A;  2YQM A;  4V3L C;  2YRE A;  4YBS A;  2PUY A;  5B8D A;  4AYC A;  3MHH A;  2VJE A;  4LLB A;  4GNE A;  2M6M A;  4AUQ B;  2CKL B;  2K16 A;  1DVP A;  2L5U A;  3L11 A;  1IYM A;  2ECW A;  1WES A;  2Y1M A;  3T7L A;  4S3O C;  3O34 A;  2CSZ A;  1WEO A;  2Y1N A;  4N3W A;  2LGL A;  3RPG B;  5KH7 A;  2KIZ A;  3HCU A;  4GNF A;  2MNZ A;  5DIN A;  5FEY A;  1WIL A;  3KNV A;  2LV9 A;  2ECN A;  2LQ6 A;  2VP7 A;  2PNX A;  2C2L A;  5TDW A;  2I50 A;  2M85 A;  4FO9 A;  4YAB A;  5I3L A;  1X4U A;  3IHP A;  2CSY A;  5B79 A;  4FJC A;  2AN6 A;  4XI1 A;  3PHD A;  2E6S A;  4BHW A;  3RPG C;  2LGK A;  3LQJ A;  4IC2 A;  3GV4 A;  2XEU A;  5TRB A;  2OXQ C;  2KYU A;  4WZ2 A;  2Y43 A;  4L7X A;  1WFK A;  2KRE A;  2F42 A;  4LK9 A;  4GB0 A;  1WEW A;  2JMD A;  1VFY A;  5B78 A;  4I7C A;  1JOC A;  2KR4 A;  2YUR A;  5LKZ A;  5DKA A;  3KQI A;  4YAX A;  1JM7 B;  2L75 A;  4A49 A;  2KWO A;  4S3O B;  2H0D B;  1WEP A;  2LXP C;  3NG2 A;  4YAT A;  1FP0 A;  2NAA A;  4A4B A;  3RTR B;  1WGM A;  1E4U A;  2IDA A;  3O70 A;  4FK5 A;  5EYA F;  3O7A A;  4I7D A;  5H1U A;  5AIU A;  3KV6 A;  3PUQ A;  1CHC A;  4B7Y C;  1Z2Q A;  5C13 A;  1Z60 A;  3ZNI A;  3M99 A;  3LQI A;  2K1J A;  2EOD A;  4L58 A;  5B76 A;  3DPL R;  3U5O A;  4W4U A;  2LGG A;  2EGP A;  1Z6U A;  5LCW B;  2YQL A;  3HCS A;  3M63 A;  4MSX A;  5D1L B;  2VJF A;  2KE1 A;  4Q6F A;  3N9O A;  4N4F A;  4C9Z A;  2YSM A;  1WIM A;  5B77 A;  2MNY A;  3N9N A;  2MA5 A;  3N9P A;  5TBN A;  3GL6 A;  5D1K B;  2JMJ A;  3KV5 A;  4B86 C;  2FSA A;  2KWJ A;  1K2F A;  2YHN A;  1MM2 A;  4YBT A;  3HTK C;  2FUI A;  1LDJ B;  1F62 A;  2YT5 A;  3U5M A;  2MA6 A;  4TKP B;  3ZYQ A;  3QZV A;  1HYI A;  2RI7 A;  4LAD B;  5JG6 A;  3DQV R;  2LGV A;  2G6Q A;  4YBM A;  2L80 A;  3ASL A;  2K4D A;  5LKX A;  3EB6 A;  2ECI A;  2ECJ A;  1X4I A;  3N9L A;  2HDP A;  3L1Z B;  2KGG A;  5G05 B;  2YW8 A;  4FIP A;  4AYC B;  2YHO A;  3EB5 A;  4BBQ A;  2QIC A;  2E6R A;  5FB1 A;  2VJE B;  5LKT A;  3M62 A;  5G04 B;  2VNF A;  4GND A;  3O36 A;  1WEM A;  5G0F A;  1WEQ A;  2G45 A;  5AIT A;  2MD7 B;  5TAB A;  4O64 A;  4YAD A;  4GNG A;  4R8P K;  2RSD A;  3ZVY A;  4NN2 A;  2KFT A;  4UP5 A;  1WEE A;  2ZET C;  4QF3 A;  5C11 A;  2MUM A;  1T1H A;  5B75 A;  3HCT A;  3O37 A;  2C2V S;  4UI9 B;  5LKU A;  1X4J A;  4R2Y A;  4ZQL A;  3ZPV E;  2M1R A;  2M3H A;  3ZPV 1;  2EA6 A;  1WE9 A;  1FBV A;  2MIQ A;  2G43 A;  1BOR A;  1JM7 A;  4WA6 A;  3SOU A;  2ECV A;  3ZVZ B;  5FER A;  2H0D A;  1HYJ A;  1MM3 A;  1U6G B;  5KH9 A;  5H1T A;  2K17 A;  2F6N A;  2VPG A;  2LN0 A;  4PPE A;  3MHS A;  1RMD A;  2KWN A;  5J3X A;  3SHB A;  2F6J A;  4WZ0 A;  2CT2 A;  1VYX A;  5D1M B;  2L0B A;  4I7B A;  1LDK C;  4WZ3 B;  3ZTG A;  2KWK A;  4F52 B;  2XB1 A;  2VPB A;  5H1V A;  2MD8 C;  4A4C A;  1N87 A;  2HYE D;  4X3G A;  2ECG A;  2DX8 A;  2CKL A;  3C5K A;  3U5P A;  1VD4 A;  1WEN A;  3C6W A;  4ZUX U;  5FB0 A;  4AVX A;  2YU4 A;  3N9Q A;  3N9M A;  2QIZ A;  2D8S A;  2FUU A;  5H9M A;  2VPE A;  2L43 A;  2YSJ A;  1WEU A;  4A0C D;  3SOW A;  2VPD A;  2KGI A;  4AP4 A;  5KH3 A;  3U5N A;  3PUR A;  3LRQ A;  2LXH C;  4ZDT A;  4MVT A;  4PTB A;  4V3K C;  2MT5 A;  4CA1 A;  2QJ0 A;  3O35 A;  1G25 A;  4P5O B;  3SOX A;  2KU3 A;  2UZG A;  3V43 A;  2LDR A;  2JRJ A;  1XWH A;  1V87 A;  4UP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...