2KWNA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing acetylation at lysine 16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
b'GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwnA00
5AITA 5G05B 4O64A 2MA6A 2Y1MA 1VD4A 2M85A 1G25A 4GNFA 4AYCB 3O34A 4YATA 3U5NA 2LGVA 3M63A 4GNEA 3KV6A 2CT2A 2EA6A 3U5PA 1WGMA 4AP4A 1DVPA 3O7AA 4X3GA 3N9MA 5B79A 4WZ0A 2FSAA 3I2DA 4YBMA 4A0CD 5FB0A 2NAAA 5DINA 5B77A 3L1ZB 5C11A 3DQVR 5D1KB 5TABA 2M6MA 2ECTA 2LXHC 1WEWA 4MSXA 4XI1A 5H1TA 2Y1NA 3ZPVE 3KV5A 2G45A 4I7CA 3KNVA 2MT5A 3N9OA 1RMDA 1WFKA 2LV9A 3M99A 1Z2QA 2YREA 1MM3A 4YBTA 1JM7A 5G04B 2QIZA 1WE9A 3PURA 4FIPA 4B86C 5H1VA 2E6RA 3GV4A 3HCSA 2RSDA 1E4UA 4L7XA 1BORA 3NG2A 3LQHA 1V87A 5KH9A 5FEYA 2YQMA 1ZBDB 1XWHA 2YQLA 3C5KA 2MD7B 5FERA 5LKUA 3PUQA 1HYIA 5B75A 2LQ6A 3EB6A 4N4FA 4MVTA 3PHDA 2YURA 4I7DA 4R2YA 3N9LA 3N9PA 4R8PK 4PPEA 1WEQA 4P5OB 2PUYA 2FUIA 2F6JA 3GL6A 1JOCA 2M1RA 3RPGB 2YHOA 4A4CA 4CCGX 2L5UA 4FJCA 3ZPV1 4PTBA 3SHBA 2LDRA 2G43A 1WEEA 3O33A 3L11A 1WILA 2LGGA 2OXQC 2UZGA 1X4JA 2VJFB 2KIZA 3RTRB 1LDJB 2K4DA 2VP7A 4GNGA 2I50A 5KH7A 1K2FA 4FO9A 1X4IA 4LK9A 4LKAA 4B7YC 2MNZA 2KWJA 2Y43A 3SOXA 2KGIA 2L80A 4V3KC 2YYRA 2C2LA 4GNDA 2H0DB 4WA6A 2KU3A 4A49A 5I3LA 3ZYQA 5G0FA 4GB0A 2KWOA 3ZTGA 3VK6A 2PNXA 5C13A 2KREA 4WZ3B 4AYCA 2F6NA 1WEUA 2JMJA 4BBQA 4LADB 2G6QA 3N9NA 5FB1A 2VJFA 3SOWA 2MUMA 3M62A 3HCTA 3O70A 4TKPB 2ECIA 4R7EA 2IDAA 3MHSA 4ZDTA 2VJEB 5LKTA 3T6RA 1Z6UA 4QF3A 2M3HA 5DKAA 2JMIA 2YSMA 1VYXA 2ECNA 2H0DA 3MHHA 2VPEA 1MM2A 2HDPA 3ZNIA 2YHNA 1X4UA 2DX8A 3RPGC 3LQJA 2MA5A 5TDWA 5EYAF 3C6WA 4UI9B 1WEOA 3LQIA 4ZQLA 4AVXA 2E6SA 1WESA 3FL2A 5LKZA 4N3WA 1WEMA 5LKXA 1Z60A 2MIQA 5H9MA 5B78A 3DPLR 2MNYA 1WEVA 2FUUA 2L0BA 2YUCA 4LLBA 2EODA 2HYED 4QF2A 2LGLA 3O36A 3O35A 4S3OB 4IC2A 3U5MA 2JMDA 5H1UA 5B8DA 2MD8C 2BAYA 2K17A 2YSJA 4V3LC 1LDKC 5B76A 4A4BA 5J3XA 2L75A 4YABA 1F62A 4W4UA 2RI7A 1N87A 1T1HA 4YBSA 2ECVA 5LCWB 2KE1A 4YAXA 4IC3A 2CKLB 3ASLA 2KGGA 3QZVA 2VPBA 1JM7B 2LGKA 4AUQB 4UP5A 2KR4A 3IHPA 2VNFA 5TDRA 4Q6FA 1WEPA 2AN6A 4BHWA 2K1JA 5AIUA 3ZVZB 2CSZA 5JG6A 2QJ0A 4L58A 2CSYA 3N9QA 3LRQA 1VFYA 2EGPA 1FBVA 2JRJA 3SOUA 3EB5A 3HCUA 2CKLA 1IYMA 3T7LA 5TRBA 4NN2A 1CHCA 4UP0A 4C9ZA 2LN0A 2ECGA 2VPGA 2QICA 3ZVYA 2LRIC 2C2VS 2KFTA 3HTKC 4S3OC 3KQIA 4YADA 2D8SA 4CA1A 1FP0A 4LJNA 2LXPC 2ECJA 5D1MB 2L43A 3V43A 4YC9A 5D1LB 2KWKA 2KWNA 2KYUA 2YW8A 2XB1A 2F42A 2K16A 2VPDA 3O37A 2YT5A 1HYJA 2YU4A 2XEUA 5KH3A 4FK5A 4I7BA 4ZUXU 4F52B 2VJEA 4WZ2A 2ECWA 1U6GB 5TBNA 1WENA 3L1XA 3U5OA 2ZETC 1WIMA
chains in the Genus database with same CATH superfamily
5AITA 5G05B 4O64A 2MA6A 2Y1MA 1VD4A 2M13A 2M85A 2XOZA 2L7PA 1G25A 2JM3A 4GNFA 4AYCB 3O34A 4YATA 3U5NA 5SVIB 2LGVA 3M63A 4GNEA 3KV6A 2CT2A 2EA6A 2IQJA 3U5PA 2B0OE 4H9DA 1WGMA 4AP4A 1DVPA 3O7AA 4X3GA 2RR4A 3N9MA 5B79A 4WZ0A 2FSAA 3I2DA 4YBMA 2FD4A 4A0CD 5FB0A 2NAAA 5DINA 2XOYA 5B77A 3DDTA 3L1ZB 3FJUB 5C11A 3KDEC 3DQVR 5D1KB 5TABA 2M6MA 2ECTA 2LXHC 1WEWA 4MSXA 4XI1A 5H1TA 2Y1NA 3ZPVE 3KV5A 2G45A 4I7CA 3KNVA 2MT5A 3N9OA 1RMDA 1WFKA 2LV9A 3FAOA 3M99A 1Z2QA 2YREA 1MM3A 4YBTA 2MKEA 3FEHA 1JM7A 5G04B 2QIZA 1WE9A 3PURA 4FIPA 4B86C 3M7KA 5H1VA 4F1PA 2E6RA 3GV4A 3HCSA 2RSDA 1E4UA 4L7XA 1BORA 3NG2A 3LQHA 1V87A 5KH9A 5FEYA 2YQMA 1ZBDB 1XWHA 2KKXA 2YQLA 3C5KA 2MD7B 5FERA 5LKUA 3PUQA 1HYIA 5B75A 2LQ6A 3EB6A 4N4FA 2XOCA 4MVTA 3PHDA 3JUEA 2YURA 4I7DA 4R2YA 3N9LA 3N9PA 4R8PK 4PPEA 1WEQA 4P5OB 2PUYA 2FUIA 2F6JA 3FANA 3GL6A 1JOCA 2M1RA 2OWAA 3RPGB 2YHOA 3H7HA 4A4CA 4CCGX 2L5UA 4FJCA 3ZPV1 4OGCA 4PTBA 3SHBA 2LDRA 2G43A 1WEEA 3O33A 3L11A 1WILA 2LGGA 2OXQC 2D8UA 2UZGA 1X4JA 2VJFB 2KIZA 3SUBA 3RTRB 1LDJB 2K4DA 2VP7A 4GNGA 3LVRE 2I50A 5KH7A 1K2FA 4FO9A 1X4IA 4LK9A 4LKAA 5SVYA 4B7YC 2MNZA 4Z0RA 4Z0OA 2KWJA 2Y43A 3SOXA 2KGIA 2L80A 4OGEA 4V3KC 2YYRA 2C2LA 4GNDA 2H0DB 4WA6A 2KU3A 4A49A 5I3LA 3ZYQA 5G0FA 4GB0A 2KWOA 2YVRA 3ZTGA 3VK6A 2PNXA 5C13A 2KREA 3O47A 4WZ3B 2CSVA 3PLWA 4AYCA 2F6NA 1WEUA 2JMJA 5SVIA 4BBQA 4LADB 2G6QA 3N9NA 5FB1A 2VJFA 3SOWA 2MUMA 3M62A 3HCTA 3MDBC 3O70A 4TKPB 2ECIA 4R7EA 2IDAA 3MHSA 4ZDTA 2VJEB 5LKTA 2CRWA 4QQ4A 3T6RA 2CRRA 1Z6UA 4QF3A 2M3HA 5DKAA 2JMIA 3LDYA 2YSMA 1VYXA 2ECNA 2H0DA 3MHHA 2VPEA 1MM2A 2HDPA 3ZNIA 2YHNA 1X4UA 2DX8A 3RPGC 3LQJA 2MA5A 5SVXA 4O62A 5TDWA 5EYAF 3C6WA 4UI9B 1MBMA 1WEOA 3LQIA 4ZQLA 4AVXA 3Q1DA 2E6SA 1WESA 2DJAA 3FL2A 5LKZA 4N3WA 1WEMA 5LKXA 1Z60A 2MIQA 5H9MA 5B78A 3DWDA 3DPLR 2MNYA 1WEVA 2FUUA 2L0BA 2YUCA 4LLBA 2EODA 2HYED 4QF2A 2LGLA 3O36A 3O35A 4S3OB 4IC2A 3U5MA 2JMDA 5H1UA 5B8DA 2MD8C 2EXUA 2BAYA 1DCQA 2K17A 2YSJA 4V3LC 1LDKC 5B76A 2CONA 5J3XA 4A4BA 2L75A 4YABA 1F62A 4W4UA 2RI7A 1N87A 1T1HA 4YBSA 2ECVA 5LCWB 2KE1A 4YAXA 3LVQE 4IC3A 2CKLB 2XP0A 3ASLA 2KGGA 3QZVA 2VPBA 2DSMA 3E2DA 1JM7B 2LGKA 4AUQB 4UP5A 2KR4A 3IHPA 2VNFA 5TDRA 4Q6FA 1WEPA 2AN6A 4BHWA 2K1JA 2KKYA 5AIUA 3ZVZB 2CSZA 5JG6A 2QJ0A 4L58A 2CSYA 3N9QA 3LRQA 2FFWA 1VFYA 2EGPA 1FBVA 2JRJA 3SOUA 3EB5A 3HCUA 2CKLA 1IYMA 3T7LA 5TRBA 4NN2A 2EGMA 1CHCA 4UP0A 4C9ZA 2LN0A 2ECGA 2JUNA 2VPGA 2QICA 3ZVYA 2LRIC 2C2VS 2KFTA 3HTKC 4S3OC 3KQIA 4YADA 2D8SA 4CA1A 1FP0A 2LAUA 4LJNA 2LXPC 2ECJA 5D1MB 2L43A 3V43A 4YC9A 5D1LB 2KWKA 2KWNA 2KYUA 2YW8A 2XB1A 2F42A 2K16A 3FM8C 2VPDA 3O37A 2YT5A 1HYJA 2YU4A 2XEUA 5KH3A 4FK5A 4I7BA 4ZUXU 4F52B 2E61A 2VJEA 4WZ2A 5K3QA 3LJUX 2ECWA 1U6GB 5TBNA 1WENA 3L1XA 2P57A 3U5OA 2ZETC 1WIMA 3T9KA
chains in the Genus database with same CATH topology
5AITA 5G05B 4O64A 2MA6A 2Y1MA 1VD4A 2M85A 1G25A 4GNFA 4AYCB 3O34A 4YATA 3U5NA 2LGVA 3M63A 4GNEA 3KV6A 2CT2A 2EA6A 3U5PA 1WGMA 4AP4A 1DVPA 3O7AA 4X3GA 3N9MA 5B79A 4WZ0A 2FSAA 3I2DA 4YBMA 4A0CD 5FB0A 2NAAA 5DINA 5B77A 3L1ZB 5C11A 3DQVR 5D1KB 5TABA 2M6MA 2ECTA 2LXHC 1WEWA 4MSXA 4XI1A 5H1TA 2Y1NA 3ZPVE 3KV5A 2G45A 4I7CA 3KNVA 2MT5A 3N9OA 1RMDA 1WFKA 2LV9A 3M99A 1Z2QA 2YREA 1MM3A 4YBTA 1JM7A 5G04B 2QIZA 1WE9A 3PURA 4FIPA 4B86C 5H1VA 2E6RA 3GV4A 3HCSA 2RSDA 1E4UA 4L7XA 1BORA 3NG2A 3LQHA 1V87A 5KH9A 5FEYA 2YQMA 1ZBDB 1XWHA 2YQLA 3C5KA 2MD7B 5FERA 5LKUA 3PUQA 1HYIA 5B75A 2LQ6A 3EB6A 4N4FA 4MVTA 3PHDA 2YURA 4I7DA 4R2YA 3N9LA 3N9PA 4R8PK 4PPEA 1WEQA 4P5OB 2PUYA 2FUIA 2F6JA 3GL6A 1JOCA 2M1RA 3RPGB 2YHOA 4A4CA 4CCGX 2L5UA 4FJCA 3ZPV1 4PTBA 3SHBA 2LDRA 2G43A 1WEEA 3O33A 3L11A 1WILA 2LGGA 2OXQC 2UZGA 1X4JA 2VJFB 2KIZA 3RTRB 1LDJB 2K4DA 2VP7A 4GNGA 2I50A 5KH7A 1K2FA 4FO9A 1X4IA 4LK9A 4LKAA 4B7YC 2MNZA 2KWJA 2Y43A 3SOXA 2KGIA 2L80A 4V3KC 2YYRA 2C2LA 4GNDA 2H0DB 4WA6A 2KU3A 4A49A 5I3LA 3ZYQA 5G0FA 4GB0A 2KWOA 3ZTGA 3VK6A 2PNXA 5C13A 2KREA 4WZ3B 4AYCA 2F6NA 1WEUA 2JMJA 4BBQA 4LADB 2G6QA 3N9NA 5FB1A 2VJFA 3SOWA 2MUMA 3M62A 3HCTA 3O70A 4TKPB 2ECIA 4R7EA 2IDAA 3MHSA 4ZDTA 2VJEB 5LKTA 3T6RA 1Z6UA 4QF3A 2M3HA 5DKAA 2JMIA 2YSMA 1VYXA 2ECNA 2H0DA 3MHHA 2VPEA 1MM2A 2HDPA 3ZNIA 2YHNA 1X4UA 2DX8A 3RPGC 3LQJA 2MA5A 5TDWA 5EYAF 3C6WA 4UI9B 1WEOA 3LQIA 4ZQLA 4AVXA 2E6SA 1WESA 3FL2A 5LKZA 4N3WA 1WEMA 5LKXA 1Z60A 2MIQA 5H9MA 5B78A 3DPLR 2MNYA 1WEVA 2FUUA 2L0BA 2YUCA 4LLBA 2EODA 2HYED 4QF2A 2LGLA 3O36A 3O35A 4S3OB 4IC2A 3U5MA 2JMDA 5H1UA 5B8DA 2MD8C 2BAYA 2K17A 2YSJA 4V3LC 1LDKC 5B76A 4A4BA 5J3XA 2L75A 4YABA 1F62A 4W4UA 2RI7A 1N87A 1T1HA 4YBSA 2ECVA 5LCWB 2KE1A 4YAXA 4IC3A 2CKLB 3ASLA 2KGGA 3QZVA 2VPBA 1JM7B 2LGKA 4AUQB 4UP5A 2KR4A 3IHPA 2VNFA 5TDRA 4Q6FA 1WEPA 2AN6A 4BHWA 2K1JA 5AIUA 3ZVZB 2CSZA 5JG6A 2QJ0A 4L58A 2CSYA 3N9QA 3LRQA 1VFYA 2EGPA 1FBVA 2JRJA 3SOUA 3EB5A 3HCUA 2CKLA 1IYMA 3T7LA 5TRBA 4NN2A 1CHCA 4UP0A 4C9ZA 2LN0A 2ECGA 2VPGA 2QICA 3ZVYA 2LRIC 2C2VS 2KFTA 3HTKC 4S3OC 3KQIA 4YADA 2D8SA 4CA1A 1FP0A 4LJNA 2LXPC 2ECJA 5D1MB 2L43A 3V43A 4YC9A 5D1LB 2KWKA 2KWNA 2KYUA 2YW8A 2XB1A 2F42A 2K16A 2VPDA 3O37A 2YT5A 1HYJA 2YU4A 2XEUA 5KH3A 4FK5A 4I7BA 4ZUXU 4F52B 2VJEA 4WZ2A 2ECWA 1U6GB 5TBNA 1WENA 3L1XA 3U5OA 2ZETC 1WIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIT A;  5G05 B;  4O64 A;  2MA6 A;  2Y1M A;  1VD4 A;  2M85 A;  1G25 A;  4GNF A;  4AYC B;  3O34 A;  4YAT A;  3U5N A;  2LGV A;  3M63 A;  4GNE A;  3KV6 A;  2CT2 A;  2EA6 A;  3U5P A;  1WGM A;  4AP4 A;  1DVP A;  3O7A A;  4X3G A;  3N9M A;  5B79 A;  4WZ0 A;  2FSA A;  3I2D A;  4YBM A;  4A0C D;  5FB0 A;  2NAA A;  5DIN A;  5B77 A;  3L1Z B;  5C11 A;  3DQV R;  5D1K B;  5TAB A;  2M6M A;  2ECT A;  2LXH C;  1WEW A;  4MSX A;  4XI1 A;  5H1T A;  2Y1N A;  3ZPV E;  3KV5 A;  2G45 A;  4I7C A;  3KNV A;  2MT5 A;  3N9O A;  1RMD A;  1WFK A;  2LV9 A;  3M99 A;  1Z2Q A;  2YRE A;  1MM3 A;  4YBT A;  1JM7 A;  5G04 B;  2QIZ A;  1WE9 A;  3PUR A;  4FIP A;  4B86 C;  5H1V A;  2E6R A;  3GV4 A;  3HCS A;  2RSD A;  1E4U A;  4L7X A;  1BOR A;  3NG2 A;  3LQH A;  1V87 A;  5KH9 A;  5FEY A;  2YQM A;  1ZBD B;  1XWH A;  2YQL A;  3C5K A;  2MD7 B;  5FER A;  5LKU A;  3PUQ A;  1HYI A;  5B75 A;  2LQ6 A;  3EB6 A;  4N4F A;  4MVT A;  3PHD A;  2YUR A;  4I7D A;  4R2Y A;  3N9L A;  3N9P A;  4R8P K;  4PPE A;  1WEQ A;  4P5O B;  2PUY A;  2FUI A;  2F6J A;  3GL6 A;  1JOC A;  2M1R A;  3RPG B;  2YHO A;  4A4C A;  4CCG X;  2L5U A;  4FJC A;  3ZPV 1;  4PTB A;  3SHB A;  2LDR A;  2G43 A;  1WEE A;  3O33 A;  3L11 A;  1WIL A;  2LGG A;  2OXQ C;  2UZG A;  1X4J A;  2VJF B;  2KIZ A;  3RTR B;  1LDJ B;  2K4D A;  2VP7 A;  4GNG A;  2I50 A;  5KH7 A;  1K2F A;  4FO9 A;  1X4I A;  4LK9 A;  4LKA A;  4B7Y C;  2MNZ A;  2KWJ A;  2Y43 A;  3SOX A;  2KGI A;  2L80 A;  4V3K C;  2YYR A;  2C2L A;  4GND A;  2H0D B;  4WA6 A;  2KU3 A;  4A49 A;  5I3L A;  3ZYQ A;  5G0F A;  4GB0 A;  2KWO A;  3ZTG A;  3VK6 A;  2PNX A;  5C13 A;  2KRE A;  4WZ3 B;  4AYC A;  2F6N A;  1WEU A;  2JMJ A;  4BBQ A;  4LAD B;  2G6Q A;  3N9N A;  5FB1 A;  2VJF A;  3SOW A;  2MUM A;  3M62 A;  3HCT A;  3O70 A;  4TKP B;  2ECI A;  4R7E A;  2IDA A;  3MHS A;  4ZDT A;  2VJE B;  5LKT A;  3T6R A;  1Z6U A;  4QF3 A;  2M3H A;  5DKA A;  2JMI A;  2YSM A;  1VYX A;  2ECN A;  2H0D A;  3MHH A;  2VPE A;  1MM2 A;  2HDP A;  3ZNI A;  2YHN A;  1X4U A;  2DX8 A;  3RPG C;  3LQJ A;  2MA5 A;  5TDW A;  5EYA F;  3C6W A;  4UI9 B;  1WEO A;  3LQI A;  4ZQL A;  4AVX A;  2E6S A;  1WES A;  3FL2 A;  5LKZ A;  4N3W A;  1WEM A;  5LKX A;  1Z60 A;  2MIQ A;  5H9M A;  5B78 A;  3DPL R;  2MNY A;  1WEV A;  2FUU A;  2L0B A;  2YUC A;  4LLB A;  2EOD A;  2HYE D;  4QF2 A;  2LGL A;  3O36 A;  3O35 A;  4S3O B;  4IC2 A;  3U5M A;  2JMD A;  5H1U A;  5B8D A;  2MD8 C;  2BAY A;  2K17 A;  2YSJ A;  4V3L C;  1LDK C;  5B76 A;  4A4B A;  5J3X A;  2L75 A;  4YAB A;  1F62 A;  4W4U A;  2RI7 A;  1N87 A;  1T1H A;  4YBS A;  2ECV A;  5LCW B;  2KE1 A;  4YAX A;  4IC3 A;  2CKL B;  3ASL A;  2KGG A;  3QZV A;  2VPB A;  1JM7 B;  2LGK A;  4AUQ B;  4UP5 A;  2KR4 A;  3IHP A;  2VNF A;  5TDR A;  4Q6F A;  1WEP A;  2AN6 A;  4BHW A;  2K1J A;  5AIU A;  3ZVZ B;  2CSZ A;  5JG6 A;  2QJ0 A;  4L58 A;  2CSY A;  3N9Q A;  3LRQ A;  1VFY A;  2EGP A;  1FBV A;  2JRJ A;  3SOU A;  3EB5 A;  3HCU A;  2CKL A;  1IYM A;  3T7L A;  5TRB A;  4NN2 A;  1CHC A;  4UP0 A;  4C9Z A;  2LN0 A;  2ECG A;  2VPG A;  2QIC A;  3ZVY A;  2LRI C;  2C2V S;  2KFT A;  3HTK C;  4S3O C;  3KQI A;  4YAD A;  2D8S A;  4CA1 A;  1FP0 A;  4LJN A;  2LXP C;  2ECJ A;  5D1M B;  2L43 A;  3V43 A;  4YC9 A;  5D1L B;  2KWK A;  2KWN A;  2KYU A;  2YW8 A;  2XB1 A;  2F42 A;  2K16 A;  2VPD A;  3O37 A;  2YT5 A;  1HYJ A;  2YU4 A;  2XEU A;  5KH3 A;  4FK5 A;  4I7B A;  4ZUX U;  4F52 B;  2VJE A;  4WZ2 A;  2ECW A;  1U6G B;  5TBN A;  1WEN A;  3L1X A;  3U5O A;  2ZET C;  1WIM A; 
#chains in the Genus database with same CATH topology
 5AIT A;  5G05 B;  4O64 A;  2MA6 A;  2Y1M A;  1VD4 A;  2M13 A;  2M85 A;  2XOZ A;  2L7P A;  1G25 A;  2JM3 A;  4GNF A;  4AYC B;  3O34 A;  4YAT A;  3U5N A;  5SVI B;  2LGV A;  3M63 A;  4GNE A;  3KV6 A;  2CT2 A;  2EA6 A;  2IQJ A;  3U5P A;  2B0O E;  4H9D A;  1WGM A;  4AP4 A;  1DVP A;  3O7A A;  4X3G A;  2RR4 A;  3N9M A;  5B79 A;  4WZ0 A;  2FSA A;  3I2D A;  4YBM A;  2FD4 A;  4A0C D;  5FB0 A;  2NAA A;  5DIN A;  2XOY A;  5B77 A;  3DDT A;  3L1Z B;  3FJU B;  5C11 A;  3KDE C;  3DQV R;  5D1K B;  5TAB A;  2M6M A;  2ECT A;  2LXH C;  1WEW A;  4MSX A;  4XI1 A;  5H1T A;  2Y1N A;  3ZPV E;  3KV5 A;  2G45 A;  4I7C A;  3KNV A;  2MT5 A;  3N9O A;  1RMD A;  1WFK A;  2LV9 A;  3FAO A;  3M99 A;  1Z2Q A;  2YRE A;  1MM3 A;  4YBT A;  2MKE A;  3FEH A;  1JM7 A;  5G04 B;  2QIZ A;  1WE9 A;  3PUR A;  4FIP A;  4B86 C;  3M7K A;  5H1V A;  4F1P A;  2E6R A;  3GV4 A;  3HCS A;  2RSD A;  1E4U A;  4L7X A;  1BOR A;  3NG2 A;  3LQH A;  1V87 A;  5KH9 A;  5FEY A;  2YQM A;  1ZBD B;  1XWH A;  2KKX A;  2YQL A;  3C5K A;  2MD7 B;  5FER A;  5LKU A;  3PUQ A;  1HYI A;  5B75 A;  2LQ6 A;  3EB6 A;  4N4F A;  2XOC A;  4MVT A;  3PHD A;  3JUE A;  2YUR A;  4I7D A;  4R2Y A;  3N9L A;  3N9P A;  4R8P K;  4PPE A;  1WEQ A;  4P5O B;  2PUY A;  2FUI A;  2F6J A;  3FAN A;  3GL6 A;  1JOC A;  2M1R A;  2OWA A;  3RPG B;  2YHO A;  3H7H A;  4A4C A;  4CCG X;  2L5U A;  4FJC A;  3ZPV 1;  4OGC A;  4PTB A;  3SHB A;  2LDR A;  2G43 A;  1WEE A;  3O33 A;  3L11 A;  1WIL A;  2LGG A;  2OXQ C;  2D8U A;  2UZG A;  1X4J A;  2VJF B;  2KIZ A;  3SUB A;  3RTR B;  1LDJ B;  2K4D A;  2VP7 A;  4GNG A;  3LVR E;  2I50 A;  5KH7 A;  1K2F A;  4FO9 A;  1X4I A;  4LK9 A;  4LKA A;  5SVY A;  4B7Y C;  2MNZ A;  4Z0R A;  4Z0O A;  2KWJ A;  2Y43 A;  3SOX A;  2KGI A;  2L80 A;  4OGE A;  4V3K C;  2YYR A;  2C2L A;  4GND A;  2H0D B;  4WA6 A;  2KU3 A;  4A49 A;  5I3L A;  3ZYQ A;  5G0F A;  4GB0 A;  2KWO A;  2YVR A;  3ZTG A;  3VK6 A;  2PNX A;  5C13 A;  2KRE A;  3O47 A;  4WZ3 B;  2CSV A;  3PLW A;  4AYC A;  2F6N A;  1WEU A;  2JMJ A;  5SVI A;  4BBQ A;  4LAD B;  2G6Q A;  3N9N A;  5FB1 A;  2VJF A;  3SOW A;  2MUM A;  3M62 A;  3HCT A;  3MDB C;  3O70 A;  4TKP B;  2ECI A;  4R7E A;  2IDA A;  3MHS A;  4ZDT A;  2VJE B;  5LKT A;  2CRW A;  4QQ4 A;  3T6R A;  2CRR A;  1Z6U A;  4QF3 A;  2M3H A;  5DKA A;  2JMI A;  3LDY A;  2YSM A;  1VYX A;  2ECN A;  2H0D A;  3MHH A;  2VPE A;  1MM2 A;  2HDP A;  3ZNI A;  2YHN A;  1X4U A;  2DX8 A;  3RPG C;  3LQJ A;  2MA5 A;  5SVX A;  4O62 A;  5TDW A;  5EYA F;  3C6W A;  4UI9 B;  1MBM A;  1WEO A;  3LQI A;  4ZQL A;  4AVX A;  3Q1D A;  2E6S A;  1WES A;  2DJA A;  3FL2 A;  5LKZ A;  4N3W A;  1WEM A;  5LKX A;  1Z60 A;  2MIQ A;  5H9M A;  5B78 A;  3DWD A;  3DPL R;  2MNY A;  1WEV A;  2FUU A;  2L0B A;  2YUC A;  4LLB A;  2EOD A;  2HYE D;  4QF2 A;  2LGL A;  3O36 A;  3O35 A;  4S3O B;  4IC2 A;  3U5M A;  2JMD A;  5H1U A;  5B8D A;  2MD8 C;  2EXU A;  2BAY A;  1DCQ A;  2K17 A;  2YSJ A;  4V3L C;  1LDK C;  5B76 A;  2CON A;  5J3X A;  4A4B A;  2L75 A;  4YAB A;  1F62 A;  4W4U A;  2RI7 A;  1N87 A;  1T1H A;  4YBS A;  2ECV A;  5LCW B;  2KE1 A;  4YAX A;  3LVQ E;  4IC3 A;  2CKL B;  2XP0 A;  3ASL A;  2KGG A;  3QZV A;  2VPB A;  2DSM A;  3E2D A;  1JM7 B;  2LGK A;  4AUQ B;  4UP5 A;  2KR4 A;  3IHP A;  2VNF A;  5TDR A;  4Q6F A;  1WEP A;  2AN6 A;  4BHW A;  2K1J A;  2KKY A;  5AIU A;  3ZVZ B;  2CSZ A;  5JG6 A;  2QJ0 A;  4L58 A;  2CSY A;  3N9Q A;  3LRQ A;  2FFW A;  1VFY A;  2EGP A;  1FBV A;  2JRJ A;  3SOU A;  3EB5 A;  3HCU A;  2CKL A;  1IYM A;  3T7L A;  5TRB A;  4NN2 A;  2EGM A;  1CHC A;  4UP0 A;  4C9Z A;  2LN0 A;  2ECG A;  2JUN A;  2VPG A;  2QIC A;  3ZVY A;  2LRI C;  2C2V S;  2KFT A;  3HTK C;  4S3O C;  3KQI A;  4YAD A;  2D8S A;  4CA1 A;  1FP0 A;  2LAU A;  4LJN A;  2LXP C;  2ECJ A;  5D1M B;  2L43 A;  3V43 A;  4YC9 A;  5D1L B;  2KWK A;  2KWN A;  2KYU A;  2YW8 A;  2XB1 A;  2F42 A;  2K16 A;  3FM8 C;  2VPD A;  3O37 A;  2YT5 A;  1HYJ A;  2YU4 A;  2XEU A;  5KH3 A;  4FK5 A;  4I7B A;  4ZUX U;  4F52 B;  2E61 A;  2VJE A;  4WZ2 A;  5K3Q A;  3LJU X;  2ECW A;  1U6G B;  5TBN A;  1WEN A;  3L1X A;  2P57 A;  3U5O A;  2ZET C;  1WIM A;  3T9K A; 
#chains in the Genus database with same CATH homology
 5AIT A;  5G05 B;  4O64 A;  2MA6 A;  2Y1M A;  1VD4 A;  2M85 A;  1G25 A;  4GNF A;  4AYC B;  3O34 A;  4YAT A;  3U5N A;  2LGV A;  3M63 A;  4GNE A;  3KV6 A;  2CT2 A;  2EA6 A;  3U5P A;  1WGM A;  4AP4 A;  1DVP A;  3O7A A;  4X3G A;  3N9M A;  5B79 A;  4WZ0 A;  2FSA A;  3I2D A;  4YBM A;  4A0C D;  5FB0 A;  2NAA A;  5DIN A;  5B77 A;  3L1Z B;  5C11 A;  3DQV R;  5D1K B;  5TAB A;  2M6M A;  2ECT A;  2LXH C;  1WEW A;  4MSX A;  4XI1 A;  5H1T A;  2Y1N A;  3ZPV E;  3KV5 A;  2G45 A;  4I7C A;  3KNV A;  2MT5 A;  3N9O A;  1RMD A;  1WFK A;  2LV9 A;  3M99 A;  1Z2Q A;  2YRE A;  1MM3 A;  4YBT A;  1JM7 A;  5G04 B;  2QIZ A;  1WE9 A;  3PUR A;  4FIP A;  4B86 C;  5H1V A;  2E6R A;  3GV4 A;  3HCS A;  2RSD A;  1E4U A;  4L7X A;  1BOR A;  3NG2 A;  3LQH A;  1V87 A;  5KH9 A;  5FEY A;  2YQM A;  1ZBD B;  1XWH A;  2YQL A;  3C5K A;  2MD7 B;  5FER A;  5LKU A;  3PUQ A;  1HYI A;  5B75 A;  2LQ6 A;  3EB6 A;  4N4F A;  4MVT A;  3PHD A;  2YUR A;  4I7D A;  4R2Y A;  3N9L A;  3N9P A;  4R8P K;  4PPE A;  1WEQ A;  4P5O B;  2PUY A;  2FUI A;  2F6J A;  3GL6 A;  1JOC A;  2M1R A;  3RPG B;  2YHO A;  4A4C A;  4CCG X;  2L5U A;  4FJC A;  3ZPV 1;  4PTB A;  3SHB A;  2LDR A;  2G43 A;  1WEE A;  3O33 A;  3L11 A;  1WIL A;  2LGG A;  2OXQ C;  2UZG A;  1X4J A;  2VJF B;  2KIZ A;  3RTR B;  1LDJ B;  2K4D A;  2VP7 A;  4GNG A;  2I50 A;  5KH7 A;  1K2F A;  4FO9 A;  1X4I A;  4LK9 A;  4LKA A;  4B7Y C;  2MNZ A;  2KWJ A;  2Y43 A;  3SOX A;  2KGI A;  2L80 A;  4V3K C;  2YYR A;  2C2L A;  4GND A;  2H0D B;  4WA6 A;  2KU3 A;  4A49 A;  5I3L A;  3ZYQ A;  5G0F A;  4GB0 A;  2KWO A;  3ZTG A;  3VK6 A;  2PNX A;  5C13 A;  2KRE A;  4WZ3 B;  4AYC A;  2F6N A;  1WEU A;  2JMJ A;  4BBQ A;  4LAD B;  2G6Q A;  3N9N A;  5FB1 A;  2VJF A;  3SOW A;  2MUM A;  3M62 A;  3HCT A;  3O70 A;  4TKP B;  2ECI A;  4R7E A;  2IDA A;  3MHS A;  4ZDT A;  2VJE B;  5LKT A;  3T6R A;  1Z6U A;  4QF3 A;  2M3H A;  5DKA A;  2JMI A;  2YSM A;  1VYX A;  2ECN A;  2H0D A;  3MHH A;  2VPE A;  1MM2 A;  2HDP A;  3ZNI A;  2YHN A;  1X4U A;  2DX8 A;  3RPG C;  3LQJ A;  2MA5 A;  5TDW A;  5EYA F;  3C6W A;  4UI9 B;  1WEO A;  3LQI A;  4ZQL A;  4AVX A;  2E6S A;  1WES A;  3FL2 A;  5LKZ A;  4N3W A;  1WEM A;  5LKX A;  1Z60 A;  2MIQ A;  5H9M A;  5B78 A;  3DPL R;  2MNY A;  1WEV A;  2FUU A;  2L0B A;  2YUC A;  4LLB A;  2EOD A;  2HYE D;  4QF2 A;  2LGL A;  3O36 A;  3O35 A;  4S3O B;  4IC2 A;  3U5M A;  2JMD A;  5H1U A;  5B8D A;  2MD8 C;  2BAY A;  2K17 A;  2YSJ A;  4V3L C;  1LDK C;  5B76 A;  4A4B A;  5J3X A;  2L75 A;  4YAB A;  1F62 A;  4W4U A;  2RI7 A;  1N87 A;  1T1H A;  4YBS A;  2ECV A;  5LCW B;  2KE1 A;  4YAX A;  4IC3 A;  2CKL B;  3ASL A;  2KGG A;  3QZV A;  2VPB A;  1JM7 B;  2LGK A;  4AUQ B;  4UP5 A;  2KR4 A;  3IHP A;  2VNF A;  5TDR A;  4Q6F A;  1WEP A;  2AN6 A;  4BHW A;  2K1J A;  5AIU A;  3ZVZ B;  2CSZ A;  5JG6 A;  2QJ0 A;  4L58 A;  2CSY A;  3N9Q A;  3LRQ A;  1VFY A;  2EGP A;  1FBV A;  2JRJ A;  3SOU A;  3EB5 A;  3HCU A;  2CKL A;  1IYM A;  3T7L A;  5TRB A;  4NN2 A;  1CHC A;  4UP0 A;  4C9Z A;  2LN0 A;  2ECG A;  2VPG A;  2QIC A;  3ZVY A;  2LRI C;  2C2V S;  2KFT A;  3HTK C;  4S3O C;  3KQI A;  4YAD A;  2D8S A;  4CA1 A;  1FP0 A;  4LJN A;  2LXP C;  2ECJ A;  5D1M B;  2L43 A;  3V43 A;  4YC9 A;  5D1L B;  2KWK A;  2KWN A;  2KYU A;  2YW8 A;  2XB1 A;  2F42 A;  2K16 A;  2VPD A;  3O37 A;  2YT5 A;  1HYJ A;  2YU4 A;  2XEU A;  5KH3 A;  4FK5 A;  4I7B A;  4ZUX U;  4F52 B;  2VJE A;  4WZ2 A;  2ECW A;  1U6G B;  5TBN A;  1WEN A;  3L1X A;  3U5O A;  2ZET C;  1WIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...