2KWNA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing acetylation at lysine 16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone peptide
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwnA00
2XB1A 5G04B 3M63A 3ZYQA 3U5PA 4WZ0A 3GL6A 5H9MA 1JM7B 4AP4A 2LDRA 1X4IA 1WENA 4FJCA 2JMIA 1WILA 2KYUA 1RMDA 4LK9A 2JMDA 2KE1A 2G6QA 3ZVYA 2YSJA 2K4DA 5TDWA 1VFYA 2MUMA 4N3WA 2LGKA 4O64A 1G25A 5DKAA 2E6RA 2L75A 5LKXA 5B77A 2LXPC 4TKPB 3RPGB 3N9LA 1MM2A 2C2VS 2MA5A 5TBNA 3I2DA 2YHOA 2ECVA 5KH9A 4S3OC 5D1KB 4MSXA 1WEOA 3EB5A 3RPGC 4UP0A 5H1UA 2K17A 1WGMA 2YT5A 4AYCA 5FB1A 3MHSA 2MNYA 4QF2A 3GV4A 2RSDA 2MA6A 3N9OA 4GNGA 5FEYA 3KQIA 4W4UA 2F6JA 2Y1MA 3C5KA 3U5OA 2CSZA 3LQJA 1WEQA 3IHPA 2BAYA 2VJEB 4R8PK 4A49A 1FBVA 2K16A 1K2FA 2PNXA 3NG2A 2KIZA 2VP7A 4PTBA 5TDRA 2YU4A 4LADB 2M6MA 2LQ6A 2KREA 4AVXA 5EYAF 2QICA 2OXQC 4I7CA 2C2LA 4FK5A 4MVTA 2YQMA 5FB0A 4FO9A 2AN6A 2ECGA 3KNVA 2DX8A 2UZGA 5B78A 4YATA 2LGLA 4R7EA 5I3LA 1BORA 4ZQLA 1MM3A 3MHHA 2YUCA 2Y43A 2LGVA 3C6WA 2MIQA 5KH3A 2I50A 4A0CD 3LRQA 5H1TA 3ZPVE 4PPEA 3LQHA 3HCSA 1CHCA 3SOUA 4ZDTA 5JG6A 2M3HA 1VD4A 3PURA 1WEEA 1X4JA 5AITA 5C11A 4AUQB 1FP0A 2CSYA 3ZPV1 4LJNA 1VYXA 5J3XA 4F52B 1WESA 2KR4A 1WEVA 5FERA 2HYED 2YW8A 3L1XA 1WEPA 2FUIA 3O70A 1V87A 3KV5A 1F62A 2L43A 4GNDA 4IC2A 4BHWA 4C9ZA 2KWNA 3DQVR 2RI7A 3N9QA 2VPDA 3SOXA 5D1MB 1WEWA 3N9NA 1E4UA 2D8SA 3ZVZB 2G43A 3QZVA 2KGIA 4B7YC 2LGGA 5B8DA 2MD7B 4GB0A 4CA1A 3EB6A 1JM7A 4R2YA 4A4BA 4I7BA 1N87A 4YAXA 1WFKA 2ECTA 2M1RA 2KWOA 1T1HA 3ASLA 3HCTA 4YABA 2K1JA 2YSMA 5LCWB 1LDKC 2CT2A 2VNFA 2KU3A 2G45A 2EGPA 5LKZA 5KH7A 4B86C 1WE9A 2VPGA 3V43A 2Y1NA 3PUQA 3VK6A 1IYMA 4L7XA 4WZ2A 4YADA 1Z6UA 2LV9A 3T7LA 2LRIC 5H1VA 1Z60A 4IC3A 1JOCA 2MNZA 3HCUA 1U6GB 2ECNA 4WA6A 5G0FA 2L5UA 3ZTGA 2EA6A 3PHDA 4YBTA 4WZ3B 3O33A 2VJFA 4CCGX 5B76A 3DPLR 2VPEA 4UI9B 3U5MA 2HDPA 2VPBA 5DINA 2KFTA 2CKLB 5LKTA 2E6SA 4ZUXU 1Z2QA 2JRJA 2YREA 4L58A 2JMJA 4YBMA 2H0DB 4YBSA 2YURA 4LKAA 5G05B 2H0DA 3ZNIA 3RTRB 4AYCB 2PUYA 4X3GA 3L1ZB 4S3OB 3L11A 2LXHC 4QF3A 1WIMA 3N9PA 2ZETC 4BBQA 2KWKA 4N4FA 3O35A 3LQIA 4XI1A 4GNEA 2YQLA 1HYIA 2M85A 3M99A 4A4CA 5B75A 1WEMA 3KV6A 5B79A 2YHNA 1X4UA 5D1LB 2LN0A 2QIZA 4FIPA 2XEUA 2KGGA 4I7DA 3O37A 2QJ0A 3O7AA 2FSAA 2YYRA 2NAAA 2ECJA 2ECIA 5C13A 1XWHA 4V3KC 3O36A 5TRBA 3SOWA 4LLBA 2VJFB 3FL2A 4GNFA 3U5NA 2F42A 2FUUA 3N9MA 4P5OB 2VJEA 5TABA 1DVPA 2KWJA 1LDJB 2IDAA 2EODA 2MT5A 5AIUA 4UP5A 2L80A 1WEUA 2ECWA 3O34A 4V3LC 3T6RA 2L0BA 4NN2A 1HYJA 4YC9A 3SHBA 1ZBDB 2CKLA 2F6NA 2MD8C 4Q6FA 3M62A 3HTKC 5LKUA
chains in the Genus database with same CATH superfamily
2XB1A 5G04B 3M63A 3ZYQA 3U5PA 4WZ0A 3GL6A 5H9MA 1JM7B 4AP4A 2LDRA 2XOYA 1X4IA 1WENA 4FJCA 2JMIA 5K3QA 1WILA 2KYUA 3O47A 1RMDA 4LK9A 2JMDA 2KE1A 2G6QA 2FFWA 3ZVYA 2YSJA 2K4DA 5TDWA 2EXUA 2KKYA 1VFYA 2MUMA 4N3WA 2LGKA 4O64A 3FANA 1G25A 5DKAA 2E6RA 2L75A 5LKXA 5B77A 2LXPC 4TKPB 3RPGB 3N9LA 1MM2A 2C2VS 2MA5A 5TBNA 3I2DA 2YHOA 2ECVA 5KH9A 4S3OC 5D1KB 4MSXA 1WEOA 3EB5A 3RPGC 4UP0A 5SVXA 5H1UA 2K17A 1WGMA 2YT5A 4AYCA 5FB1A 3FEHA 3MHSA 2MNYA 4QF2A 3GV4A 2RSDA 3H7HA 2MA6A 3N9OA 4GNGA 5FEYA 3KQIA 4W4UA 2F6JA 2Y1MA 3C5KA 3U5OA 2CSZA 3LQJA 1WEQA 3IHPA 2BAYA 2VJEB 4R8PK 4A49A 1FBVA 2K16A 3NG2A 1K2FA 2PNXA 2KIZA 2VP7A 3FJUB 4PTBA 5TDRA 2YU4A 4LADB 2M6MA 4O62A 2LQ6A 2KREA 4AVXA 5EYAF 2CONA 2QICA 2OXQC 4I7CA 2XOZA 2C2LA 4FK5A 4MVTA 2YQMA 5FB0A 4FO9A 2AN6A 1MBMA 2E61A 2ECGA 3KNVA 2DX8A 2UZGA 5B78A 4YATA 2LGLA 4R7EA 5I3LA 1BORA 3DWDA 4ZQLA 1MM3A 3MHHA 2YUCA 2Y43A 2LGVA 3C6WA 2MIQA 5KH3A 2I50A 4A0CD 3LRQA 5H1TA 3ZPVE 4PPEA 3LQHA 3HCSA 4Z0OA 1CHCA 3SOUA 4ZDTA 5JG6A 2M3HA 3Q1DA 1VD4A 3T9KA 3PURA 1WEEA 1X4JA 3LVQE 5AITA 5C11A 4AUQB 2LAUA 1FP0A 2CSYA 2DSMA 3ZPV1 4LJNA 1VYXA 5J3XA 4F52B 1WESA 2KR4A 4QQ4A 1WEVA 3SUBA 5FERA 2HYED 2YW8A 3L1XA 3M7KA 1WEPA 2KKXA 2FUIA 3O70A 1V87A 3DDTA 3KV5A 1F62A 2L43A 4H9DA 4GNDA 4IC2A 4BHWA 4C9ZA 2KWNA 3DQVR 2RI7A 3N9QA 2VPDA 3SOXA 5D1MB 1WEWA 2JUNA 3FM8C 3N9NA 1E4UA 2D8SA 3ZVZB 2G43A 2FD4A 3QZVA 2KGIA 4B7YC 2LGGA 5B8DA 2MD7B 4GB0A 4CA1A 3EB6A 1JM7A 4R2YA 4A4BA 4I7BA 1N87A 4YAXA 1WFKA 2ECTA 2M1RA 2KWOA 1T1HA 3ASLA 3HCTA 4YABA 2K1JA 2YSMA 2M13A 5LCWB 1LDKC 2CT2A 2VNFA 2KU3A 2G45A 2EGPA 3FAOA 5LKZA 5KH7A 4B86C 1WE9A 2VPGA 2XOCA 2IQJA 2MKEA 3V43A 2Y1NA 3JUEA 3PUQA 2CRWA 3VK6A 1IYMA 4L7XA 2L7PA 4WZ2A 4YADA 1Z6UA 2P57A 2LV9A 3T7LA 2LRIC 5H1VA 5SVIA 1Z60A 4IC3A 1JOCA 2MNZA 2D8UA 1U6GB 3HCUA 2ECNA 4WA6A 5G0FA 2L5UA 3ZTGA 2EA6A 3PHDA 4YBTA 4WZ3B 3O33A 2VJFA 3KDEC 4CCGX 5B76A 3DPLR 2DJAA 2VPEA 4UI9B 4F1PA 3U5MA 2HDPA 2VPBA 5DINA 2KFTA 2CKLB 5LKTA 2E6SA 4ZUXU 1Z2QA 2JRJA 2YREA 4L58A 2JMJA 4YBMA 2H0DB 4YBSA 2YURA 4LKAA 5G05B 2H0DA 3ZNIA 3RTRB 4AYCB 2PUYA 4X3GA 3L1ZB 2RR4A 4S3OB 4OGEA 3L11A 2LXHC 4QF3A 2JM3A 1WIMA 3N9PA 2ZETC 4BBQA 2KWKA 4N4FA 3O35A 3PLWA 2OWAA 3LDYA 3LQIA 4XI1A 4GNEA 2YQLA 1HYIA 2M85A 3M99A 4A4CA 5B75A 1WEMA 3KV6A 1DCQA 5B79A 2YHNA 1X4UA 5D1LB 2LN0A 2QIZA 4FIPA 2XEUA 2KGGA 4I7DA 3O37A 2QJ0A 3O7AA 2FSAA 2YYRA 5SVIB 2CSVA 2NAAA 2ECJA 2ECIA 5C13A 1XWHA 4V3KC 3O36A 3E2DA 5TRBA 3SOWA 4LLBA 2VJFB 3FL2A 4GNFA 3U5NA 2F42A 2CRRA 2FUUA 3MDBC 3N9MA 4P5OB 2YVRA 2VJEA 2EGMA 5TABA 1DVPA 2KWJA 1LDJB 2IDAA 4Z0RA 4OGCA 2EODA 2MT5A 5AIUA 4UP5A 2L80A 1WEUA 2ECWA 3O34A 4V3LC 5SVYA 3T6RA 2B0OE 3LJUX 2L0BA 3LVRE 4NN2A 1HYJA 4YC9A 3SHBA 1ZBDB 2CKLA 2F6NA 2MD8C 2XP0A 4Q6FA 3M62A 3HTKC 5LKUA
chains in the Genus database with same CATH topology
2XB1A 5G04B 3M63A 3ZYQA 3U5PA 4WZ0A 3GL6A 5H9MA 1JM7B 4AP4A 2LDRA 1X4IA 1WENA 4FJCA 2JMIA 1WILA 2KYUA 1RMDA 4LK9A 2JMDA 2KE1A 2G6QA 3ZVYA 2YSJA 2K4DA 5TDWA 1VFYA 2MUMA 4N3WA 2LGKA 4O64A 1G25A 5DKAA 2E6RA 2L75A 5LKXA 5B77A 2LXPC 4TKPB 3RPGB 3N9LA 1MM2A 2C2VS 2MA5A 5TBNA 3I2DA 2YHOA 2ECVA 5KH9A 4S3OC 5D1KB 4MSXA 1WEOA 3EB5A 3RPGC 4UP0A 5H1UA 2K17A 1WGMA 2YT5A 4AYCA 5FB1A 3MHSA 2MNYA 4QF2A 3GV4A 2RSDA 2MA6A 3N9OA 4GNGA 5FEYA 3KQIA 4W4UA 2F6JA 2Y1MA 3C5KA 3U5OA 2CSZA 3LQJA 1WEQA 3IHPA 2BAYA 2VJEB 4R8PK 4A49A 1FBVA 2K16A 1K2FA 2PNXA 3NG2A 2KIZA 2VP7A 4PTBA 5TDRA 2YU4A 4LADB 2M6MA 2LQ6A 2KREA 4AVXA 5EYAF 2QICA 2OXQC 4I7CA 2C2LA 4FK5A 4MVTA 2YQMA 5FB0A 4FO9A 2AN6A 2ECGA 3KNVA 2DX8A 2UZGA 5B78A 4YATA 2LGLA 4R7EA 5I3LA 1BORA 4ZQLA 1MM3A 3MHHA 2YUCA 2Y43A 2LGVA 3C6WA 2MIQA 5KH3A 2I50A 4A0CD 3LRQA 5H1TA 3ZPVE 4PPEA 3LQHA 3HCSA 1CHCA 3SOUA 4ZDTA 5JG6A 2M3HA 1VD4A 3PURA 1WEEA 1X4JA 5AITA 5C11A 4AUQB 1FP0A 2CSYA 3ZPV1 4LJNA 1VYXA 5J3XA 4F52B 1WESA 2KR4A 1WEVA 5FERA 2HYED 2YW8A 3L1XA 1WEPA 2FUIA 3O70A 1V87A 3KV5A 1F62A 2L43A 4GNDA 4IC2A 4BHWA 4C9ZA 2KWNA 3DQVR 2RI7A 3N9QA 2VPDA 3SOXA 5D1MB 1WEWA 3N9NA 1E4UA 2D8SA 3ZVZB 2G43A 3QZVA 2KGIA 4B7YC 2LGGA 5B8DA 2MD7B 4GB0A 4CA1A 3EB6A 1JM7A 4R2YA 4A4BA 4I7BA 1N87A 4YAXA 1WFKA 2ECTA 2M1RA 2KWOA 1T1HA 3ASLA 3HCTA 4YABA 2K1JA 2YSMA 5LCWB 1LDKC 2CT2A 2VNFA 2KU3A 2G45A 2EGPA 5LKZA 5KH7A 4B86C 1WE9A 2VPGA 3V43A 2Y1NA 3PUQA 3VK6A 1IYMA 4L7XA 4WZ2A 4YADA 1Z6UA 2LV9A 3T7LA 2LRIC 5H1VA 1Z60A 4IC3A 1JOCA 2MNZA 3HCUA 1U6GB 2ECNA 4WA6A 5G0FA 2L5UA 3ZTGA 2EA6A 3PHDA 4YBTA 4WZ3B 3O33A 2VJFA 4CCGX 5B76A 3DPLR 2VPEA 4UI9B 3U5MA 2HDPA 2VPBA 5DINA 2KFTA 2CKLB 5LKTA 2E6SA 4ZUXU 1Z2QA 2JRJA 2YREA 4L58A 2JMJA 4YBMA 2H0DB 4YBSA 2YURA 4LKAA 5G05B 2H0DA 3ZNIA 3RTRB 4AYCB 2PUYA 4X3GA 3L1ZB 4S3OB 3L11A 2LXHC 4QF3A 1WIMA 3N9PA 2ZETC 4BBQA 2KWKA 4N4FA 3O35A 3LQIA 4XI1A 4GNEA 2YQLA 1HYIA 2M85A 3M99A 4A4CA 5B75A 1WEMA 3KV6A 5B79A 2YHNA 1X4UA 5D1LB 2LN0A 2QIZA 4FIPA 2XEUA 2KGGA 4I7DA 3O37A 2QJ0A 3O7AA 2FSAA 2YYRA 2NAAA 2ECJA 2ECIA 5C13A 1XWHA 4V3KC 3O36A 5TRBA 3SOWA 4LLBA 2VJFB 3FL2A 4GNFA 3U5NA 2F42A 2FUUA 3N9MA 4P5OB 2VJEA 5TABA 1DVPA 2KWJA 1LDJB 2IDAA 2EODA 2MT5A 5AIUA 4UP5A 2L80A 1WEUA 2ECWA 3O34A 4V3LC 3T6RA 2L0BA 4NN2A 1HYJA 4YC9A 3SHBA 1ZBDB 2CKLA 2F6NA 2MD8C 4Q6FA 3M62A 3HTKC 5LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB1 A;  5G04 B;  3M63 A;  3ZYQ A;  3U5P A;  4WZ0 A;  3GL6 A;  5H9M A;  1JM7 B;  4AP4 A;  2LDR A;  1X4I A;  1WEN A;  4FJC A;  2JMI A;  1WIL A;  2KYU A;  1RMD A;  4LK9 A;  2JMD A;  2KE1 A;  2G6Q A;  3ZVY A;  2YSJ A;  2K4D A;  5TDW A;  1VFY A;  2MUM A;  4N3W A;  2LGK A;  4O64 A;  1G25 A;  5DKA A;  2E6R A;  2L75 A;  5LKX A;  5B77 A;  2LXP C;  4TKP B;  3RPG B;  3N9L A;  1MM2 A;  2C2V S;  2MA5 A;  5TBN A;  3I2D A;  2YHO A;  2ECV A;  5KH9 A;  4S3O C;  5D1K B;  4MSX A;  1WEO A;  3EB5 A;  3RPG C;  4UP0 A;  5H1U A;  2K17 A;  1WGM A;  2YT5 A;  4AYC A;  5FB1 A;  3MHS A;  2MNY A;  4QF2 A;  3GV4 A;  2RSD A;  2MA6 A;  3N9O A;  4GNG A;  5FEY A;  3KQI A;  4W4U A;  2F6J A;  2Y1M A;  3C5K A;  3U5O A;  2CSZ A;  3LQJ A;  1WEQ A;  3IHP A;  2BAY A;  2VJE B;  4R8P K;  4A49 A;  1FBV A;  2K16 A;  1K2F A;  2PNX A;  3NG2 A;  2KIZ A;  2VP7 A;  4PTB A;  5TDR A;  2YU4 A;  4LAD B;  2M6M A;  2LQ6 A;  2KRE A;  4AVX A;  5EYA F;  2QIC A;  2OXQ C;  4I7C A;  2C2L A;  4FK5 A;  4MVT A;  2YQM A;  5FB0 A;  4FO9 A;  2AN6 A;  2ECG A;  3KNV A;  2DX8 A;  2UZG A;  5B78 A;  4YAT A;  2LGL A;  4R7E A;  5I3L A;  1BOR A;  4ZQL A;  1MM3 A;  3MHH A;  2YUC A;  2Y43 A;  2LGV A;  3C6W A;  2MIQ A;  5KH3 A;  2I50 A;  4A0C D;  3LRQ A;  5H1T A;  3ZPV E;  4PPE A;  3LQH A;  3HCS A;  1CHC A;  3SOU A;  4ZDT A;  5JG6 A;  2M3H A;  1VD4 A;  3PUR A;  1WEE A;  1X4J A;  5AIT A;  5C11 A;  4AUQ B;  1FP0 A;  2CSY A;  3ZPV 1;  4LJN A;  1VYX A;  5J3X A;  4F52 B;  1WES A;  2KR4 A;  1WEV A;  5FER A;  2HYE D;  2YW8 A;  3L1X A;  1WEP A;  2FUI A;  3O70 A;  1V87 A;  3KV5 A;  1F62 A;  2L43 A;  4GND A;  4IC2 A;  4BHW A;  4C9Z A;  2KWN A;  3DQV R;  2RI7 A;  3N9Q A;  2VPD A;  3SOX A;  5D1M B;  1WEW A;  3N9N A;  1E4U A;  2D8S A;  3ZVZ B;  2G43 A;  3QZV A;  2KGI A;  4B7Y C;  2LGG A;  5B8D A;  2MD7 B;  4GB0 A;  4CA1 A;  3EB6 A;  1JM7 A;  4R2Y A;  4A4B A;  4I7B A;  1N87 A;  4YAX A;  1WFK A;  2ECT A;  2M1R A;  2KWO A;  1T1H A;  3ASL A;  3HCT A;  4YAB A;  2K1J A;  2YSM A;  5LCW B;  1LDK C;  2CT2 A;  2VNF A;  2KU3 A;  2G45 A;  2EGP A;  5LKZ A;  5KH7 A;  4B86 C;  1WE9 A;  2VPG A;  3V43 A;  2Y1N A;  3PUQ A;  3VK6 A;  1IYM A;  4L7X A;  4WZ2 A;  4YAD A;  1Z6U A;  2LV9 A;  3T7L A;  2LRI C;  5H1V A;  1Z60 A;  4IC3 A;  1JOC A;  2MNZ A;  3HCU A;  1U6G B;  2ECN A;  4WA6 A;  5G0F A;  2L5U A;  3ZTG A;  2EA6 A;  3PHD A;  4YBT A;  4WZ3 B;  3O33 A;  2VJF A;  4CCG X;  5B76 A;  3DPL R;  2VPE A;  4UI9 B;  3U5M A;  2HDP A;  2VPB A;  5DIN A;  2KFT A;  2CKL B;  5LKT A;  2E6S A;  4ZUX U;  1Z2Q A;  2JRJ A;  2YRE A;  4L58 A;  2JMJ A;  4YBM A;  2H0D B;  4YBS A;  2YUR A;  4LKA A;  5G05 B;  2H0D A;  3ZNI A;  3RTR B;  4AYC B;  2PUY A;  4X3G A;  3L1Z B;  4S3O B;  3L11 A;  2LXH C;  4QF3 A;  1WIM A;  3N9P A;  2ZET C;  4BBQ A;  2KWK A;  4N4F A;  3O35 A;  3LQI A;  4XI1 A;  4GNE A;  2YQL A;  1HYI A;  2M85 A;  3M99 A;  4A4C A;  5B75 A;  1WEM A;  3KV6 A;  5B79 A;  2YHN A;  1X4U A;  5D1L B;  2LN0 A;  2QIZ A;  4FIP A;  2XEU A;  2KGG A;  4I7D A;  3O37 A;  2QJ0 A;  3O7A A;  2FSA A;  2YYR A;  2NAA A;  2ECJ A;  2ECI A;  5C13 A;  1XWH A;  4V3K C;  3O36 A;  5TRB A;  3SOW A;  4LLB A;  2VJF B;  3FL2 A;  4GNF A;  3U5N A;  2F42 A;  2FUU A;  3N9M A;  4P5O B;  2VJE A;  5TAB A;  1DVP A;  2KWJ A;  1LDJ B;  2IDA A;  2EOD A;  2MT5 A;  5AIU A;  4UP5 A;  2L80 A;  1WEU A;  2ECW A;  3O34 A;  4V3L C;  3T6R A;  2L0B A;  4NN2 A;  1HYJ A;  4YC9 A;  3SHB A;  1ZBD B;  2CKL A;  2F6N A;  2MD8 C;  4Q6F A;  3M62 A;  3HTK C;  5LKU A; 
#chains in the Genus database with same CATH topology
 2XB1 A;  5G04 B;  3M63 A;  3ZYQ A;  3U5P A;  4WZ0 A;  3GL6 A;  5H9M A;  1JM7 B;  4AP4 A;  2LDR A;  2XOY A;  1X4I A;  1WEN A;  4FJC A;  2JMI A;  5K3Q A;  1WIL A;  2KYU A;  3O47 A;  1RMD A;  4LK9 A;  2JMD A;  2KE1 A;  2G6Q A;  2FFW A;  3ZVY A;  2YSJ A;  2K4D A;  5TDW A;  2EXU A;  2KKY A;  1VFY A;  2MUM A;  4N3W A;  2LGK A;  4O64 A;  3FAN A;  1G25 A;  5DKA A;  2E6R A;  2L75 A;  5LKX A;  5B77 A;  2LXP C;  4TKP B;  3RPG B;  3N9L A;  1MM2 A;  2C2V S;  2MA5 A;  5TBN A;  3I2D A;  2YHO A;  2ECV A;  5KH9 A;  4S3O C;  5D1K B;  4MSX A;  1WEO A;  3EB5 A;  3RPG C;  4UP0 A;  5SVX A;  5H1U A;  2K17 A;  1WGM A;  2YT5 A;  4AYC A;  5FB1 A;  3FEH A;  3MHS A;  2MNY A;  4QF2 A;  3GV4 A;  2RSD A;  3H7H A;  2MA6 A;  3N9O A;  4GNG A;  5FEY A;  3KQI A;  4W4U A;  2F6J A;  2Y1M A;  3C5K A;  3U5O A;  2CSZ A;  3LQJ A;  1WEQ A;  3IHP A;  2BAY A;  2VJE B;  4R8P K;  4A49 A;  1FBV A;  2K16 A;  3NG2 A;  1K2F A;  2PNX A;  2KIZ A;  2VP7 A;  3FJU B;  4PTB A;  5TDR A;  2YU4 A;  4LAD B;  2M6M A;  4O62 A;  2LQ6 A;  2KRE A;  4AVX A;  5EYA F;  2CON A;  2QIC A;  2OXQ C;  4I7C A;  2XOZ A;  2C2L A;  4FK5 A;  4MVT A;  2YQM A;  5FB0 A;  4FO9 A;  2AN6 A;  1MBM A;  2E61 A;  2ECG A;  3KNV A;  2DX8 A;  2UZG A;  5B78 A;  4YAT A;  2LGL A;  4R7E A;  5I3L A;  1BOR A;  3DWD A;  4ZQL A;  1MM3 A;  3MHH A;  2YUC A;  2Y43 A;  2LGV A;  3C6W A;  2MIQ A;  5KH3 A;  2I50 A;  4A0C D;  3LRQ A;  5H1T A;  3ZPV E;  4PPE A;  3LQH A;  3HCS A;  4Z0O A;  1CHC A;  3SOU A;  4ZDT A;  5JG6 A;  2M3H A;  3Q1D A;  1VD4 A;  3T9K A;  3PUR A;  1WEE A;  1X4J A;  3LVQ E;  5AIT A;  5C11 A;  4AUQ B;  2LAU A;  1FP0 A;  2CSY A;  2DSM A;  3ZPV 1;  4LJN A;  1VYX A;  5J3X A;  4F52 B;  1WES A;  2KR4 A;  4QQ4 A;  1WEV A;  3SUB A;  5FER A;  2HYE D;  2YW8 A;  3L1X A;  3M7K A;  1WEP A;  2KKX A;  2FUI A;  3O70 A;  1V87 A;  3DDT A;  3KV5 A;  1F62 A;  2L43 A;  4H9D A;  4GND A;  4IC2 A;  4BHW A;  4C9Z A;  2KWN A;  3DQV R;  2RI7 A;  3N9Q A;  2VPD A;  3SOX A;  5D1M B;  1WEW A;  2JUN A;  3FM8 C;  3N9N A;  1E4U A;  2D8S A;  3ZVZ B;  2G43 A;  2FD4 A;  3QZV A;  2KGI A;  4B7Y C;  2LGG A;  5B8D A;  2MD7 B;  4GB0 A;  4CA1 A;  3EB6 A;  1JM7 A;  4R2Y A;  4A4B A;  4I7B A;  1N87 A;  4YAX A;  1WFK A;  2ECT A;  2M1R A;  2KWO A;  1T1H A;  3ASL A;  3HCT A;  4YAB A;  2K1J A;  2YSM A;  2M13 A;  5LCW B;  1LDK C;  2CT2 A;  2VNF A;  2KU3 A;  2G45 A;  2EGP A;  3FAO A;  5LKZ A;  5KH7 A;  4B86 C;  1WE9 A;  2VPG A;  2XOC A;  2IQJ A;  2MKE A;  3V43 A;  2Y1N A;  3JUE A;  3PUQ A;  2CRW A;  3VK6 A;  1IYM A;  4L7X A;  2L7P A;  4WZ2 A;  4YAD A;  1Z6U A;  2P57 A;  2LV9 A;  3T7L A;  2LRI C;  5H1V A;  5SVI A;  1Z60 A;  4IC3 A;  1JOC A;  2MNZ A;  2D8U A;  1U6G B;  3HCU A;  2ECN A;  4WA6 A;  5G0F A;  2L5U A;  3ZTG A;  2EA6 A;  3PHD A;  4YBT A;  4WZ3 B;  3O33 A;  2VJF A;  3KDE C;  4CCG X;  5B76 A;  3DPL R;  2DJA A;  2VPE A;  4UI9 B;  4F1P A;  3U5M A;  2HDP A;  2VPB A;  5DIN A;  2KFT A;  2CKL B;  5LKT A;  2E6S A;  4ZUX U;  1Z2Q A;  2JRJ A;  2YRE A;  4L58 A;  2JMJ A;  4YBM A;  2H0D B;  4YBS A;  2YUR A;  4LKA A;  5G05 B;  2H0D A;  3ZNI A;  3RTR B;  4AYC B;  2PUY A;  4X3G A;  3L1Z B;  2RR4 A;  4S3O B;  4OGE A;  3L11 A;  2LXH C;  4QF3 A;  2JM3 A;  1WIM A;  3N9P A;  2ZET C;  4BBQ A;  2KWK A;  4N4F A;  3O35 A;  3PLW A;  2OWA A;  3LDY A;  3LQI A;  4XI1 A;  4GNE A;  2YQL A;  1HYI A;  2M85 A;  3M99 A;  4A4C A;  5B75 A;  1WEM A;  3KV6 A;  1DCQ A;  5B79 A;  2YHN A;  1X4U A;  5D1L B;  2LN0 A;  2QIZ A;  4FIP A;  2XEU A;  2KGG A;  4I7D A;  3O37 A;  2QJ0 A;  3O7A A;  2FSA A;  2YYR A;  5SVI B;  2CSV A;  2NAA A;  2ECJ A;  2ECI A;  5C13 A;  1XWH A;  4V3K C;  3O36 A;  3E2D A;  5TRB A;  3SOW A;  4LLB A;  2VJF B;  3FL2 A;  4GNF A;  3U5N A;  2F42 A;  2CRR A;  2FUU A;  3MDB C;  3N9M A;  4P5O B;  2YVR A;  2VJE A;  2EGM A;  5TAB A;  1DVP A;  2KWJ A;  1LDJ B;  2IDA A;  4Z0R A;  4OGC A;  2EOD A;  2MT5 A;  5AIU A;  4UP5 A;  2L80 A;  1WEU A;  2ECW A;  3O34 A;  4V3L C;  5SVY A;  3T6R A;  2B0O E;  3LJU X;  2L0B A;  3LVR E;  4NN2 A;  1HYJ A;  4YC9 A;  3SHB A;  1ZBD B;  2CKL A;  2F6N A;  2MD8 C;  2XP0 A;  4Q6F A;  3M62 A;  3HTK C;  5LKU A; 
#chains in the Genus database with same CATH homology
 2XB1 A;  5G04 B;  3M63 A;  3ZYQ A;  3U5P A;  4WZ0 A;  3GL6 A;  5H9M A;  1JM7 B;  4AP4 A;  2LDR A;  1X4I A;  1WEN A;  4FJC A;  2JMI A;  1WIL A;  2KYU A;  1RMD A;  4LK9 A;  2JMD A;  2KE1 A;  2G6Q A;  3ZVY A;  2YSJ A;  2K4D A;  5TDW A;  1VFY A;  2MUM A;  4N3W A;  2LGK A;  4O64 A;  1G25 A;  5DKA A;  2E6R A;  2L75 A;  5LKX A;  5B77 A;  2LXP C;  4TKP B;  3RPG B;  3N9L A;  1MM2 A;  2C2V S;  2MA5 A;  5TBN A;  3I2D A;  2YHO A;  2ECV A;  5KH9 A;  4S3O C;  5D1K B;  4MSX A;  1WEO A;  3EB5 A;  3RPG C;  4UP0 A;  5H1U A;  2K17 A;  1WGM A;  2YT5 A;  4AYC A;  5FB1 A;  3MHS A;  2MNY A;  4QF2 A;  3GV4 A;  2RSD A;  2MA6 A;  3N9O A;  4GNG A;  5FEY A;  3KQI A;  4W4U A;  2F6J A;  2Y1M A;  3C5K A;  3U5O A;  2CSZ A;  3LQJ A;  1WEQ A;  3IHP A;  2BAY A;  2VJE B;  4R8P K;  4A49 A;  1FBV A;  2K16 A;  1K2F A;  2PNX A;  3NG2 A;  2KIZ A;  2VP7 A;  4PTB A;  5TDR A;  2YU4 A;  4LAD B;  2M6M A;  2LQ6 A;  2KRE A;  4AVX A;  5EYA F;  2QIC A;  2OXQ C;  4I7C A;  2C2L A;  4FK5 A;  4MVT A;  2YQM A;  5FB0 A;  4FO9 A;  2AN6 A;  2ECG A;  3KNV A;  2DX8 A;  2UZG A;  5B78 A;  4YAT A;  2LGL A;  4R7E A;  5I3L A;  1BOR A;  4ZQL A;  1MM3 A;  3MHH A;  2YUC A;  2Y43 A;  2LGV A;  3C6W A;  2MIQ A;  5KH3 A;  2I50 A;  4A0C D;  3LRQ A;  5H1T A;  3ZPV E;  4PPE A;  3LQH A;  3HCS A;  1CHC A;  3SOU A;  4ZDT A;  5JG6 A;  2M3H A;  1VD4 A;  3PUR A;  1WEE A;  1X4J A;  5AIT A;  5C11 A;  4AUQ B;  1FP0 A;  2CSY A;  3ZPV 1;  4LJN A;  1VYX A;  5J3X A;  4F52 B;  1WES A;  2KR4 A;  1WEV A;  5FER A;  2HYE D;  2YW8 A;  3L1X A;  1WEP A;  2FUI A;  3O70 A;  1V87 A;  3KV5 A;  1F62 A;  2L43 A;  4GND A;  4IC2 A;  4BHW A;  4C9Z A;  2KWN A;  3DQV R;  2RI7 A;  3N9Q A;  2VPD A;  3SOX A;  5D1M B;  1WEW A;  3N9N A;  1E4U A;  2D8S A;  3ZVZ B;  2G43 A;  3QZV A;  2KGI A;  4B7Y C;  2LGG A;  5B8D A;  2MD7 B;  4GB0 A;  4CA1 A;  3EB6 A;  1JM7 A;  4R2Y A;  4A4B A;  4I7B A;  1N87 A;  4YAX A;  1WFK A;  2ECT A;  2M1R A;  2KWO A;  1T1H A;  3ASL A;  3HCT A;  4YAB A;  2K1J A;  2YSM A;  5LCW B;  1LDK C;  2CT2 A;  2VNF A;  2KU3 A;  2G45 A;  2EGP A;  5LKZ A;  5KH7 A;  4B86 C;  1WE9 A;  2VPG A;  3V43 A;  2Y1N A;  3PUQ A;  3VK6 A;  1IYM A;  4L7X A;  4WZ2 A;  4YAD A;  1Z6U A;  2LV9 A;  3T7L A;  2LRI C;  5H1V A;  1Z60 A;  4IC3 A;  1JOC A;  2MNZ A;  3HCU A;  1U6G B;  2ECN A;  4WA6 A;  5G0F A;  2L5U A;  3ZTG A;  2EA6 A;  3PHD A;  4YBT A;  4WZ3 B;  3O33 A;  2VJF A;  4CCG X;  5B76 A;  3DPL R;  2VPE A;  4UI9 B;  3U5M A;  2HDP A;  2VPB A;  5DIN A;  2KFT A;  2CKL B;  5LKT A;  2E6S A;  4ZUX U;  1Z2Q A;  2JRJ A;  2YRE A;  4L58 A;  2JMJ A;  4YBM A;  2H0D B;  4YBS A;  2YUR A;  4LKA A;  5G05 B;  2H0D A;  3ZNI A;  3RTR B;  4AYC B;  2PUY A;  4X3G A;  3L1Z B;  4S3O B;  3L11 A;  2LXH C;  4QF3 A;  1WIM A;  3N9P A;  2ZET C;  4BBQ A;  2KWK A;  4N4F A;  3O35 A;  3LQI A;  4XI1 A;  4GNE A;  2YQL A;  1HYI A;  2M85 A;  3M99 A;  4A4C A;  5B75 A;  1WEM A;  3KV6 A;  5B79 A;  2YHN A;  1X4U A;  5D1L B;  2LN0 A;  2QIZ A;  4FIP A;  2XEU A;  2KGG A;  4I7D A;  3O37 A;  2QJ0 A;  3O7A A;  2FSA A;  2YYR A;  2NAA A;  2ECJ A;  2ECI A;  5C13 A;  1XWH A;  4V3K C;  3O36 A;  5TRB A;  3SOW A;  4LLB A;  2VJF B;  3FL2 A;  4GNF A;  3U5N A;  2F42 A;  2FUU A;  3N9M A;  4P5O B;  2VJE A;  5TAB A;  1DVP A;  2KWJ A;  1LDJ B;  2IDA A;  2EOD A;  2MT5 A;  5AIU A;  4UP5 A;  2L80 A;  1WEU A;  2ECW A;  3O34 A;  4V3L C;  3T6R A;  2L0B A;  4NN2 A;  1HYJ A;  4YC9 A;  3SHB A;  1ZBD B;  2CKL A;  2F6N A;  2MD8 C;  4Q6F A;  3M62 A;  3HTK C;  5LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...