2KWNA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing acetylation at lysine 16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwnA00
3O35A 2JMDA 2KGIA 3IHPA 4YABA 4AYCA 5D1MB 5B8DA 2L43A 2LRIC 2VP7A 2F6NA 1WEOA 2VNFA 1U6GB 4ZUXU 2KYUA 2G43A 3PHDA 2VPGA 3ASLA 3FL2A 4AP4A 2KU3A 2QICA 4YAXA 4BHWA 5H9MA 3GV4A 2VJEB 3I2DA 2KIZA 4AVXA 4I7CA 5G05B 3ZPV1 3LRQA 2YU4A 2MA5A 4PPEA 2QJ0A 2LV9A 2HYED 5LKZA 3LQHA 4PTBA 2YHOA 2LGKA 2ECGA 1HYJA 3PURA 3O36A 4S3OC 4LLBA 2NAAA 2XEUA 2OXQC 2ECVA 1N87A 4P5OB 2YQMA 4UP0A 2M85A 2LN0A 1JOCA 2F42A 3NG2A 4WZ3B 3T6RA 2L75A 2KWOA 2YHNA 4FO9A 2MUMA 4W4UA 1V87A 1WIMA 2PNXA 3LQIA 2FUIA 4WA6A 2VJEA 2MD7B 4QF2A 3MHSA 4S3OB 1FP0A 4ZDTA 2KGGA 4GNGA 1E4UA 4MSXA 3O37A 5LKXA 4YBTA 1LDJB 3EB6A 2KWJA 3U5PA 4O64A 2H0DB 1WEVA 3RPGC 1JM7B 3ZYQA 5TBNA 2G6QA 1WEUA 3VK6A 3ZTGA 2IDAA 2RI7A 2YYRA 1HYIA 3KQIA 2FSAA 4YATA 2ECTA 2M3HA 5AITA 2YURA 4R8PK 4NN2A 5J3XA 2UZGA 2F6JA 4GNDA 2JMIA 3SOWA 5KH7A 5TDRA 4LKAA 5B75A 3RPGB 2DX8A 4R2YA 2ECWA 2M1RA 3KV6A 1VYXA 4WZ2A 3C6WA 2L80A 2MA6A 2C2LA 5C13A 3GL6A 2LGGA 5EYAF 4BBQA 1F62A 1WEPA 2K17A 5G0FA 5JG6A 2CKLB 3O34A 5FB0A 2H0DA 4N3WA 3QZVA 3SOUA 1JM7A 1X4JA 2KR4A 4TKPB 1CHCA 2YSMA 1WGMA 1Z60A 4I7BA 2VJFB 4R7EA 3SOXA 1WE9A 4Q6FA 2VPBA 4LADB 5LKUA 2ECJA 4WZ0A 5I3LA 2VPEA 2ZETC 2ECIA 4XI1A 4A4BA 2MD8C 4IC3A 2BAYA 4QF3A 2I50A 1K2FA 3DPLR 3SHBA 4UP5A 1WEEA 4YBSA 2FUUA 1G25A 2YQLA 5LKTA 4GB0A 5FEYA 5FB1A 4F52B 2CSYA 2KREA 2CSZA 4L58A 3N9QA 2EODA 3O33A 3HTKC 1FBVA 2LQ6A 2CKLA 1WFKA 3O70A 1WENA 3DQVR 2K4DA 4YC9A 2E6SA 2KWKA 1VFYA 2E6RA 1ZBDB 5H1TA 2VJFA 3HCUA 2KE1A 5DINA 4YADA 1DVPA 2JMJA 4LJNA 4GNFA 5B78A 5B79A 5LCWB 2LXPC 2YT5A 1Z6UA 2JRJA 3KNVA 2EA6A 2MNYA 5D1LB 3M62A 4LK9A 5G04B 3N9PA 3T7LA 2L0BA 1T1HA 3N9NA 3HCTA 3ZVYA 2AN6A 3MHHA 3N9LA 4V3KC 1WESA 3V43A 3N9OA 5TDWA 2YW8A 3U5NA 1WEMA 2Y43A 3L1ZB 4ZQLA 1VD4A 2YREA 3U5OA 1Z2QA 2LDRA 2L5UA 3C5KA 2MIQA 2PUYA 2ECNA 2K16A 3ZNIA 4MVTA 5H1VA 2YSJA 3EB5A 2Y1MA 2HDPA 4C9ZA 5D1KB 4FJCA 1MM2A 2MT5A 5KH3A 3ZPVE 3L1XA 3PUQA 5TRBA 2K1JA 4L7XA 5B77A 2LXHC 2CT2A 5AIUA 3M99A 4AUQB 2RSDA 4CA1A 4CCGX 4YBMA 4I7DA 5FERA 1WEQA 1BORA 5TABA 4FK5A 4A0CD 2C2VS 5KH9A 1X4UA 3ZVZB 2KWNA 4AYCB 5B76A 3N9MA 3HCSA 5DKAA 3LQJA 1XWHA 3KV5A 4IC2A 2QIZA 1IYMA 4GNEA 1X4IA 5H1UA 4X3GA 4N4FA 3L11A 4B7YC 2Y1NA 4A49A 5C11A 1MM3A 4UI9B 3RTRB 2VPDA 3M63A 2EGPA 1RMDA 2KFTA 2YUCA 3O7AA 2M6MA 4A4CA 4FIPA 2G45A 4V3LC 3U5MA 2D8SA 1WILA 2XB1A 1LDKC 2MNZA 4B86C 2LGVA 2LGLA 1WEWA
chains in the Genus database with same CATH superfamily
3O35A 2JMDA 2CONA 2KGIA 3IHPA 4YABA 4AYCA 5D1MB 5B8DA 2L43A 2LRIC 2VP7A 2F6NA 1WEOA 2VNFA 1U6GB 4ZUXU 2KYUA 2G43A 3PHDA 2VPGA 3ASLA 3FL2A 4AP4A 2KU3A 2QICA 4YAXA 4BHWA 5H9MA 3GV4A 2VJEB 3I2DA 2KIZA 4AVXA 4I7CA 5G05B 3ZPV1 3LRQA 2YU4A 2MA5A 4PPEA 2QJ0A 2LV9A 2HYED 5LKZA 3T9KA 3O47A 3LQHA 4PTBA 2YHOA 2LGKA 2ECGA 1HYJA 3PURA 3O36A 4S3OC 4LLBA 2JM3A 2NAAA 2XEUA 2OXQC 2ECVA 1N87A 4P5OB 2YQMA 2D8UA 4UP0A 2M85A 2LN0A 1JOCA 2F42A 3NG2A 4WZ3B 3T6RA 2L75A 2KWOA 2YHNA 4FO9A 2MUMA 4W4UA 1V87A 1WIMA 2PNXA 3LQIA 2FUIA 2KKXA 2XOYA 4WA6A 2VJEA 2MD7B 4QF2A 3MHSA 4S3OB 1FP0A 4ZDTA 2KGGA 4GNGA 1E4UA 4MSXA 3O37A 5LKXA 3KDEC 4YBTA 1LDJB 3EB6A 2KWJA 3U5PA 3PLWA 4O64A 4Z0OA 2H0DB 1WEVA 3RPGC 1JM7B 3ZYQA 5TBNA 2G6QA 1WEUA 3VK6A 3ZTGA 2IDAA 2RI7A 3FAOA 2YYRA 1HYIA 3KQIA 2FSAA 4YATA 3Q1DA 2ECTA 2M3HA 5AITA 2YURA 4R8PK 4NN2A 5J3XA 2UZGA 2F6JA 4GNDA 2JMIA 3FJUB 3SOWA 5KH7A 5TDRA 2YVRA 4LKAA 5B75A 3RPGB 2DX8A 4R2YA 3LDYA 2ECWA 2M1RA 3KV6A 1VYXA 4WZ2A 3C6WA 4Z0RA 2L80A 2MA6A 2C2LA 5C13A 3GL6A 2LGGA 5EYAF 5SVXA 4BBQA 4F1PA 1F62A 1WEPA 2K17A 5G0FA 5JG6A 2CKLB 3O34A 5FB0A 2H0DA 4N3WA 3QZVA 3SOUA 1JM7A 1X4JA 2KR4A 4TKPB 1CHCA 2YSMA 1WGMA 2EGMA 1Z60A 4I7BA 2VJFB 4R7EA 3SOXA 1WE9A 5SVIB 4Q6FA 2VPBA 4LADB 2OWAA 1MBMA 5LKUA 2ECJA 3LJUX 4H9DA 4WZ0A 5I3LA 2VPEA 2ZETC 2ECIA 4XI1A 4A4BA 2MD8C 4IC3A 2MKEA 2BAYA 4QF3A 2I50A 1K2FA 2FD4A 2FFWA 3DPLR 3SHBA 4UP5A 1WEEA 4YBSA 2FUUA 1G25A 4O62A 5SVYA 2YQLA 5LKTA 3LVQE 4GB0A 2B0OE 5FEYA 5FB1A 4F52B 2CSYA 2KREA 2CSZA 4L58A 3N9QA 2LAUA 2EODA 4OGCA 2IQJA 3O33A 3HTKC 1FBVA 2LQ6A 4OGEA 2XOCA 2CKLA 1WFKA 3O70A 2DSMA 3FANA 1WENA 1DCQA 3DQVR 2K4DA 4YC9A 2E6SA 2KWKA 1VFYA 2E6RA 1ZBDB 5H1TA 2VJFA 5SVIA 3HCUA 2KE1A 3MDBC 5DINA 4YADA 1DVPA 2JMJA 4LJNA 4GNFA 5B78A 5B79A 5LCWB 2LXPC 2YT5A 2RR4A 1Z6UA 2JRJA 3KNVA 2EA6A 2MNYA 5D1LB 3M62A 4LK9A 5G04B 3N9PA 3T7LA 2L0BA 1T1HA 3N9NA 3HCTA 3ZVYA 2KKYA 2AN6A 3MHHA 3N9LA 4V3KC 1WESA 3V43A 3N9OA 5TDWA 2YW8A 3U5NA 1WEMA 2Y43A 3L1ZB 4ZQLA 1VD4A 2YREA 3U5OA 1Z2QA 2LDRA 2L5UA 3FEHA 3C5KA 2MIQA 2PUYA 2ECNA 3E2DA 2K16A 3ZNIA 4MVTA 5H1VA 2YSJA 4QQ4A 3EB5A 2Y1MA 2HDPA 4C9ZA 5D1KB 4FJCA 1MM2A 2MT5A 5KH3A 2M13A 3ZPVE 3L1XA 3PUQA 5TRBA 2K1JA 4L7XA 5B77A 2LXHC 2CT2A 5AIUA 3SUBA 3M99A 3FM8C 4AUQB 3H7HA 2RSDA 3DDTA 2EXUA 4CA1A 4CCGX 4YBMA 2CRWA 4I7DA 5FERA 1WEQA 1BORA 5TABA 4FK5A 4A0CD 2C2VS 5KH9A 2DJAA 1X4UA 2E61A 3ZVZB 2L7PA 2KWNA 4AYCB 5B76A 3M7KA 2XP0A 3N9MA 3HCSA 5DKAA 3LQJA 1XWHA 3KV5A 4IC2A 2XOZA 2QIZA 1IYMA 4GNEA 1X4IA 5H1UA 2CRRA 4X3GA 2CSVA 4N4FA 2P57A 3L11A 4B7YC 2Y1NA 4A49A 5C11A 3DWDA 1MM3A 4UI9B 3RTRB 2VPDA 3M63A 3LVRE 2EGPA 1RMDA 2KFTA 2YUCA 3O7AA 2M6MA 4A4CA 4FIPA 2G45A 4V3LC 3JUEA 3U5MA 2D8SA 1WILA 2XB1A 1LDKC 2MNZA 4B86C 5K3QA 2JUNA 2LGVA 2LGLA 1WEWA
chains in the Genus database with same CATH topology
3O35A 2JMDA 2KGIA 3IHPA 4YABA 4AYCA 5D1MB 5B8DA 2L43A 2LRIC 2VP7A 2F6NA 1WEOA 2VNFA 1U6GB 4ZUXU 2KYUA 2G43A 3PHDA 2VPGA 3ASLA 3FL2A 4AP4A 2KU3A 2QICA 4YAXA 4BHWA 5H9MA 3GV4A 2VJEB 3I2DA 2KIZA 4AVXA 4I7CA 5G05B 3ZPV1 3LRQA 2YU4A 2MA5A 4PPEA 2QJ0A 2LV9A 2HYED 5LKZA 3LQHA 4PTBA 2YHOA 2LGKA 2ECGA 1HYJA 3PURA 3O36A 4S3OC 4LLBA 2NAAA 2XEUA 2OXQC 2ECVA 1N87A 4P5OB 2YQMA 4UP0A 2M85A 2LN0A 1JOCA 2F42A 3NG2A 4WZ3B 3T6RA 2L75A 2KWOA 2YHNA 4FO9A 2MUMA 4W4UA 1V87A 1WIMA 2PNXA 3LQIA 2FUIA 4WA6A 2VJEA 2MD7B 4QF2A 3MHSA 4S3OB 1FP0A 4ZDTA 2KGGA 4GNGA 1E4UA 4MSXA 3O37A 5LKXA 4YBTA 1LDJB 3EB6A 2KWJA 3U5PA 4O64A 2H0DB 1WEVA 3RPGC 1JM7B 3ZYQA 5TBNA 2G6QA 1WEUA 3VK6A 3ZTGA 2IDAA 2RI7A 2YYRA 1HYIA 3KQIA 2FSAA 4YATA 2ECTA 2M3HA 5AITA 2YURA 4R8PK 4NN2A 5J3XA 2UZGA 2F6JA 4GNDA 2JMIA 3SOWA 5KH7A 5TDRA 4LKAA 5B75A 3RPGB 2DX8A 4R2YA 2ECWA 2M1RA 3KV6A 1VYXA 4WZ2A 3C6WA 2L80A 2MA6A 2C2LA 5C13A 3GL6A 2LGGA 5EYAF 4BBQA 1F62A 1WEPA 2K17A 5G0FA 5JG6A 2CKLB 3O34A 5FB0A 2H0DA 4N3WA 3QZVA 3SOUA 1JM7A 1X4JA 2KR4A 4TKPB 1CHCA 2YSMA 1WGMA 1Z60A 4I7BA 2VJFB 4R7EA 3SOXA 1WE9A 4Q6FA 2VPBA 4LADB 5LKUA 2ECJA 4WZ0A 5I3LA 2VPEA 2ZETC 2ECIA 4XI1A 4A4BA 2MD8C 4IC3A 2BAYA 4QF3A 2I50A 1K2FA 3DPLR 3SHBA 4UP5A 1WEEA 4YBSA 2FUUA 1G25A 2YQLA 5LKTA 4GB0A 5FEYA 5FB1A 4F52B 2CSYA 2KREA 2CSZA 4L58A 3N9QA 2EODA 3O33A 3HTKC 1FBVA 2LQ6A 2CKLA 1WFKA 3O70A 1WENA 3DQVR 2K4DA 4YC9A 2E6SA 2KWKA 1VFYA 2E6RA 1ZBDB 5H1TA 2VJFA 3HCUA 2KE1A 5DINA 4YADA 1DVPA 2JMJA 4LJNA 4GNFA 5B78A 5B79A 5LCWB 2LXPC 2YT5A 1Z6UA 2JRJA 3KNVA 2EA6A 2MNYA 5D1LB 3M62A 4LK9A 5G04B 3N9PA 3T7LA 2L0BA 1T1HA 3N9NA 3HCTA 3ZVYA 2AN6A 3MHHA 3N9LA 4V3KC 1WESA 3V43A 3N9OA 5TDWA 2YW8A 3U5NA 1WEMA 2Y43A 3L1ZB 4ZQLA 1VD4A 2YREA 3U5OA 1Z2QA 2LDRA 2L5UA 3C5KA 2MIQA 2PUYA 2ECNA 2K16A 3ZNIA 4MVTA 5H1VA 2YSJA 3EB5A 2Y1MA 2HDPA 4C9ZA 5D1KB 4FJCA 1MM2A 2MT5A 5KH3A 3ZPVE 3L1XA 3PUQA 5TRBA 2K1JA 4L7XA 5B77A 2LXHC 2CT2A 5AIUA 3M99A 4AUQB 2RSDA 4CA1A 4CCGX 4YBMA 4I7DA 5FERA 1WEQA 1BORA 5TABA 4FK5A 4A0CD 2C2VS 5KH9A 1X4UA 3ZVZB 2KWNA 4AYCB 5B76A 3N9MA 3HCSA 5DKAA 3LQJA 1XWHA 3KV5A 4IC2A 2QIZA 1IYMA 4GNEA 1X4IA 5H1UA 4X3GA 4N4FA 3L11A 4B7YC 2Y1NA 4A49A 5C11A 1MM3A 4UI9B 3RTRB 2VPDA 3M63A 2EGPA 1RMDA 2KFTA 2YUCA 3O7AA 2M6MA 4A4CA 4FIPA 2G45A 4V3LC 3U5MA 2D8SA 1WILA 2XB1A 1LDKC 2MNZA 4B86C 2LGVA 2LGLA 1WEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O35 A;  2JMD A;  2KGI A;  3IHP A;  4YAB A;  4AYC A;  5D1M B;  5B8D A;  2L43 A;  2LRI C;  2VP7 A;  2F6N A;  1WEO A;  2VNF A;  1U6G B;  4ZUX U;  2KYU A;  2G43 A;  3PHD A;  2VPG A;  3ASL A;  3FL2 A;  4AP4 A;  2KU3 A;  2QIC A;  4YAX A;  4BHW A;  5H9M A;  3GV4 A;  2VJE B;  3I2D A;  2KIZ A;  4AVX A;  4I7C A;  5G05 B;  3ZPV 1;  3LRQ A;  2YU4 A;  2MA5 A;  4PPE A;  2QJ0 A;  2LV9 A;  2HYE D;  5LKZ A;  3LQH A;  4PTB A;  2YHO A;  2LGK A;  2ECG A;  1HYJ A;  3PUR A;  3O36 A;  4S3O C;  4LLB A;  2NAA A;  2XEU A;  2OXQ C;  2ECV A;  1N87 A;  4P5O B;  2YQM A;  4UP0 A;  2M85 A;  2LN0 A;  1JOC A;  2F42 A;  3NG2 A;  4WZ3 B;  3T6R A;  2L75 A;  2KWO A;  2YHN A;  4FO9 A;  2MUM A;  4W4U A;  1V87 A;  1WIM A;  2PNX A;  3LQI A;  2FUI A;  4WA6 A;  2VJE A;  2MD7 B;  4QF2 A;  3MHS A;  4S3O B;  1FP0 A;  4ZDT A;  2KGG A;  4GNG A;  1E4U A;  4MSX A;  3O37 A;  5LKX A;  4YBT A;  1LDJ B;  3EB6 A;  2KWJ A;  3U5P A;  4O64 A;  2H0D B;  1WEV A;  3RPG C;  1JM7 B;  3ZYQ A;  5TBN A;  2G6Q A;  1WEU A;  3VK6 A;  3ZTG A;  2IDA A;  2RI7 A;  2YYR A;  1HYI A;  3KQI A;  2FSA A;  4YAT A;  2ECT A;  2M3H A;  5AIT A;  2YUR A;  4R8P K;  4NN2 A;  5J3X A;  2UZG A;  2F6J A;  4GND A;  2JMI A;  3SOW A;  5KH7 A;  5TDR A;  4LKA A;  5B75 A;  3RPG B;  2DX8 A;  4R2Y A;  2ECW A;  2M1R A;  3KV6 A;  1VYX A;  4WZ2 A;  3C6W A;  2L80 A;  2MA6 A;  2C2L A;  5C13 A;  3GL6 A;  2LGG A;  5EYA F;  4BBQ A;  1F62 A;  1WEP A;  2K17 A;  5G0F A;  5JG6 A;  2CKL B;  3O34 A;  5FB0 A;  2H0D A;  4N3W A;  3QZV A;  3SOU A;  1JM7 A;  1X4J A;  2KR4 A;  4TKP B;  1CHC A;  2YSM A;  1WGM A;  1Z60 A;  4I7B A;  2VJF B;  4R7E A;  3SOX A;  1WE9 A;  4Q6F A;  2VPB A;  4LAD B;  5LKU A;  2ECJ A;  4WZ0 A;  5I3L A;  2VPE A;  2ZET C;  2ECI A;  4XI1 A;  4A4B A;  2MD8 C;  4IC3 A;  2BAY A;  4QF3 A;  2I50 A;  1K2F A;  3DPL R;  3SHB A;  4UP5 A;  1WEE A;  4YBS A;  2FUU A;  1G25 A;  2YQL A;  5LKT A;  4GB0 A;  5FEY A;  5FB1 A;  4F52 B;  2CSY A;  2KRE A;  2CSZ A;  4L58 A;  3N9Q A;  2EOD A;  3O33 A;  3HTK C;  1FBV A;  2LQ6 A;  2CKL A;  1WFK A;  3O70 A;  1WEN A;  3DQV R;  2K4D A;  4YC9 A;  2E6S A;  2KWK A;  1VFY A;  2E6R A;  1ZBD B;  5H1T A;  2VJF A;  3HCU A;  2KE1 A;  5DIN A;  4YAD A;  1DVP A;  2JMJ A;  4LJN A;  4GNF A;  5B78 A;  5B79 A;  5LCW B;  2LXP C;  2YT5 A;  1Z6U A;  2JRJ A;  3KNV A;  2EA6 A;  2MNY A;  5D1L B;  3M62 A;  4LK9 A;  5G04 B;  3N9P A;  3T7L A;  2L0B A;  1T1H A;  3N9N A;  3HCT A;  3ZVY A;  2AN6 A;  3MHH A;  3N9L A;  4V3K C;  1WES A;  3V43 A;  3N9O A;  5TDW A;  2YW8 A;  3U5N A;  1WEM A;  2Y43 A;  3L1Z B;  4ZQL A;  1VD4 A;  2YRE A;  3U5O A;  1Z2Q A;  2LDR A;  2L5U A;  3C5K A;  2MIQ A;  2PUY A;  2ECN A;  2K16 A;  3ZNI A;  4MVT A;  5H1V A;  2YSJ A;  3EB5 A;  2Y1M A;  2HDP A;  4C9Z A;  5D1K B;  4FJC A;  1MM2 A;  2MT5 A;  5KH3 A;  3ZPV E;  3L1X A;  3PUQ A;  5TRB A;  2K1J A;  4L7X A;  5B77 A;  2LXH C;  2CT2 A;  5AIU A;  3M99 A;  4AUQ B;  2RSD A;  4CA1 A;  4CCG X;  4YBM A;  4I7D A;  5FER A;  1WEQ A;  1BOR A;  5TAB A;  4FK5 A;  4A0C D;  2C2V S;  5KH9 A;  1X4U A;  3ZVZ B;  2KWN A;  4AYC B;  5B76 A;  3N9M A;  3HCS A;  5DKA A;  3LQJ A;  1XWH A;  3KV5 A;  4IC2 A;  2QIZ A;  1IYM A;  4GNE A;  1X4I A;  5H1U A;  4X3G A;  4N4F A;  3L11 A;  4B7Y C;  2Y1N A;  4A49 A;  5C11 A;  1MM3 A;  4UI9 B;  3RTR B;  2VPD A;  3M63 A;  2EGP A;  1RMD A;  2KFT A;  2YUC A;  3O7A A;  2M6M A;  4A4C A;  4FIP A;  2G45 A;  4V3L C;  3U5M A;  2D8S A;  1WIL A;  2XB1 A;  1LDK C;  2MNZ A;  4B86 C;  2LGV A;  2LGL A;  1WEW A; 
#chains in the Genus database with same CATH topology
 3O35 A;  2JMD A;  2CON A;  2KGI A;  3IHP A;  4YAB A;  4AYC A;  5D1M B;  5B8D A;  2L43 A;  2LRI C;  2VP7 A;  2F6N A;  1WEO A;  2VNF A;  1U6G B;  4ZUX U;  2KYU A;  2G43 A;  3PHD A;  2VPG A;  3ASL A;  3FL2 A;  4AP4 A;  2KU3 A;  2QIC A;  4YAX A;  4BHW A;  5H9M A;  3GV4 A;  2VJE B;  3I2D A;  2KIZ A;  4AVX A;  4I7C A;  5G05 B;  3ZPV 1;  3LRQ A;  2YU4 A;  2MA5 A;  4PPE A;  2QJ0 A;  2LV9 A;  2HYE D;  5LKZ A;  3T9K A;  3O47 A;  3LQH A;  4PTB A;  2YHO A;  2LGK A;  2ECG A;  1HYJ A;  3PUR A;  3O36 A;  4S3O C;  4LLB A;  2JM3 A;  2NAA A;  2XEU A;  2OXQ C;  2ECV A;  1N87 A;  4P5O B;  2YQM A;  2D8U A;  4UP0 A;  2M85 A;  2LN0 A;  1JOC A;  2F42 A;  3NG2 A;  4WZ3 B;  3T6R A;  2L75 A;  2KWO A;  2YHN A;  4FO9 A;  2MUM A;  4W4U A;  1V87 A;  1WIM A;  2PNX A;  3LQI A;  2FUI A;  2KKX A;  2XOY A;  4WA6 A;  2VJE A;  2MD7 B;  4QF2 A;  3MHS A;  4S3O B;  1FP0 A;  4ZDT A;  2KGG A;  4GNG A;  1E4U A;  4MSX A;  3O37 A;  5LKX A;  3KDE C;  4YBT A;  1LDJ B;  3EB6 A;  2KWJ A;  3U5P A;  3PLW A;  4O64 A;  4Z0O A;  2H0D B;  1WEV A;  3RPG C;  1JM7 B;  3ZYQ A;  5TBN A;  2G6Q A;  1WEU A;  3VK6 A;  3ZTG A;  2IDA A;  2RI7 A;  3FAO A;  2YYR A;  1HYI A;  3KQI A;  2FSA A;  4YAT A;  3Q1D A;  2ECT A;  2M3H A;  5AIT A;  2YUR A;  4R8P K;  4NN2 A;  5J3X A;  2UZG A;  2F6J A;  4GND A;  2JMI A;  3FJU B;  3SOW A;  5KH7 A;  5TDR A;  2YVR A;  4LKA A;  5B75 A;  3RPG B;  2DX8 A;  4R2Y A;  3LDY A;  2ECW A;  2M1R A;  3KV6 A;  1VYX A;  4WZ2 A;  3C6W A;  4Z0R A;  2L80 A;  2MA6 A;  2C2L A;  5C13 A;  3GL6 A;  2LGG A;  5EYA F;  5SVX A;  4BBQ A;  4F1P A;  1F62 A;  1WEP A;  2K17 A;  5G0F A;  5JG6 A;  2CKL B;  3O34 A;  5FB0 A;  2H0D A;  4N3W A;  3QZV A;  3SOU A;  1JM7 A;  1X4J A;  2KR4 A;  4TKP B;  1CHC A;  2YSM A;  1WGM A;  2EGM A;  1Z60 A;  4I7B A;  2VJF B;  4R7E A;  3SOX A;  1WE9 A;  5SVI B;  4Q6F A;  2VPB A;  4LAD B;  2OWA A;  1MBM A;  5LKU A;  2ECJ A;  3LJU X;  4H9D A;  4WZ0 A;  5I3L A;  2VPE A;  2ZET C;  2ECI A;  4XI1 A;  4A4B A;  2MD8 C;  4IC3 A;  2MKE A;  2BAY A;  4QF3 A;  2I50 A;  1K2F A;  2FD4 A;  2FFW A;  3DPL R;  3SHB A;  4UP5 A;  1WEE A;  4YBS A;  2FUU A;  1G25 A;  4O62 A;  5SVY A;  2YQL A;  5LKT A;  3LVQ E;  4GB0 A;  2B0O E;  5FEY A;  5FB1 A;  4F52 B;  2CSY A;  2KRE A;  2CSZ A;  4L58 A;  3N9Q A;  2LAU A;  2EOD A;  4OGC A;  2IQJ A;  3O33 A;  3HTK C;  1FBV A;  2LQ6 A;  4OGE A;  2XOC A;  2CKL A;  1WFK A;  3O70 A;  2DSM A;  3FAN A;  1WEN A;  1DCQ A;  3DQV R;  2K4D A;  4YC9 A;  2E6S A;  2KWK A;  1VFY A;  2E6R A;  1ZBD B;  5H1T A;  2VJF A;  5SVI A;  3HCU A;  2KE1 A;  3MDB C;  5DIN A;  4YAD A;  1DVP A;  2JMJ A;  4LJN A;  4GNF A;  5B78 A;  5B79 A;  5LCW B;  2LXP C;  2YT5 A;  2RR4 A;  1Z6U A;  2JRJ A;  3KNV A;  2EA6 A;  2MNY A;  5D1L B;  3M62 A;  4LK9 A;  5G04 B;  3N9P A;  3T7L A;  2L0B A;  1T1H A;  3N9N A;  3HCT A;  3ZVY A;  2KKY A;  2AN6 A;  3MHH A;  3N9L A;  4V3K C;  1WES A;  3V43 A;  3N9O A;  5TDW A;  2YW8 A;  3U5N A;  1WEM A;  2Y43 A;  3L1Z B;  4ZQL A;  1VD4 A;  2YRE A;  3U5O A;  1Z2Q A;  2LDR A;  2L5U A;  3FEH A;  3C5K A;  2MIQ A;  2PUY A;  2ECN A;  3E2D A;  2K16 A;  3ZNI A;  4MVT A;  5H1V A;  2YSJ A;  4QQ4 A;  3EB5 A;  2Y1M A;  2HDP A;  4C9Z A;  5D1K B;  4FJC A;  1MM2 A;  2MT5 A;  5KH3 A;  2M13 A;  3ZPV E;  3L1X A;  3PUQ A;  5TRB A;  2K1J A;  4L7X A;  5B77 A;  2LXH C;  2CT2 A;  5AIU A;  3SUB A;  3M99 A;  3FM8 C;  4AUQ B;  3H7H A;  2RSD A;  3DDT A;  2EXU A;  4CA1 A;  4CCG X;  4YBM A;  2CRW A;  4I7D A;  5FER A;  1WEQ A;  1BOR A;  5TAB A;  4FK5 A;  4A0C D;  2C2V S;  5KH9 A;  2DJA A;  1X4U A;  2E61 A;  3ZVZ B;  2L7P A;  2KWN A;  4AYC B;  5B76 A;  3M7K A;  2XP0 A;  3N9M A;  3HCS A;  5DKA A;  3LQJ A;  1XWH A;  3KV5 A;  4IC2 A;  2XOZ A;  2QIZ A;  1IYM A;  4GNE A;  1X4I A;  5H1U A;  2CRR A;  4X3G A;  2CSV A;  4N4F A;  2P57 A;  3L11 A;  4B7Y C;  2Y1N A;  4A49 A;  5C11 A;  3DWD A;  1MM3 A;  4UI9 B;  3RTR B;  2VPD A;  3M63 A;  3LVR E;  2EGP A;  1RMD A;  2KFT A;  2YUC A;  3O7A A;  2M6M A;  4A4C A;  4FIP A;  2G45 A;  4V3L C;  3JUE A;  3U5M A;  2D8S A;  1WIL A;  2XB1 A;  1LDK C;  2MNZ A;  4B86 C;  5K3Q A;  2JUN A;  2LGV A;  2LGL A;  1WEW A; 
#chains in the Genus database with same CATH homology
 3O35 A;  2JMD A;  2KGI A;  3IHP A;  4YAB A;  4AYC A;  5D1M B;  5B8D A;  2L43 A;  2LRI C;  2VP7 A;  2F6N A;  1WEO A;  2VNF A;  1U6G B;  4ZUX U;  2KYU A;  2G43 A;  3PHD A;  2VPG A;  3ASL A;  3FL2 A;  4AP4 A;  2KU3 A;  2QIC A;  4YAX A;  4BHW A;  5H9M A;  3GV4 A;  2VJE B;  3I2D A;  2KIZ A;  4AVX A;  4I7C A;  5G05 B;  3ZPV 1;  3LRQ A;  2YU4 A;  2MA5 A;  4PPE A;  2QJ0 A;  2LV9 A;  2HYE D;  5LKZ A;  3LQH A;  4PTB A;  2YHO A;  2LGK A;  2ECG A;  1HYJ A;  3PUR A;  3O36 A;  4S3O C;  4LLB A;  2NAA A;  2XEU A;  2OXQ C;  2ECV A;  1N87 A;  4P5O B;  2YQM A;  4UP0 A;  2M85 A;  2LN0 A;  1JOC A;  2F42 A;  3NG2 A;  4WZ3 B;  3T6R A;  2L75 A;  2KWO A;  2YHN A;  4FO9 A;  2MUM A;  4W4U A;  1V87 A;  1WIM A;  2PNX A;  3LQI A;  2FUI A;  4WA6 A;  2VJE A;  2MD7 B;  4QF2 A;  3MHS A;  4S3O B;  1FP0 A;  4ZDT A;  2KGG A;  4GNG A;  1E4U A;  4MSX A;  3O37 A;  5LKX A;  4YBT A;  1LDJ B;  3EB6 A;  2KWJ A;  3U5P A;  4O64 A;  2H0D B;  1WEV A;  3RPG C;  1JM7 B;  3ZYQ A;  5TBN A;  2G6Q A;  1WEU A;  3VK6 A;  3ZTG A;  2IDA A;  2RI7 A;  2YYR A;  1HYI A;  3KQI A;  2FSA A;  4YAT A;  2ECT A;  2M3H A;  5AIT A;  2YUR A;  4R8P K;  4NN2 A;  5J3X A;  2UZG A;  2F6J A;  4GND A;  2JMI A;  3SOW A;  5KH7 A;  5TDR A;  4LKA A;  5B75 A;  3RPG B;  2DX8 A;  4R2Y A;  2ECW A;  2M1R A;  3KV6 A;  1VYX A;  4WZ2 A;  3C6W A;  2L80 A;  2MA6 A;  2C2L A;  5C13 A;  3GL6 A;  2LGG A;  5EYA F;  4BBQ A;  1F62 A;  1WEP A;  2K17 A;  5G0F A;  5JG6 A;  2CKL B;  3O34 A;  5FB0 A;  2H0D A;  4N3W A;  3QZV A;  3SOU A;  1JM7 A;  1X4J A;  2KR4 A;  4TKP B;  1CHC A;  2YSM A;  1WGM A;  1Z60 A;  4I7B A;  2VJF B;  4R7E A;  3SOX A;  1WE9 A;  4Q6F A;  2VPB A;  4LAD B;  5LKU A;  2ECJ A;  4WZ0 A;  5I3L A;  2VPE A;  2ZET C;  2ECI A;  4XI1 A;  4A4B A;  2MD8 C;  4IC3 A;  2BAY A;  4QF3 A;  2I50 A;  1K2F A;  3DPL R;  3SHB A;  4UP5 A;  1WEE A;  4YBS A;  2FUU A;  1G25 A;  2YQL A;  5LKT A;  4GB0 A;  5FEY A;  5FB1 A;  4F52 B;  2CSY A;  2KRE A;  2CSZ A;  4L58 A;  3N9Q A;  2EOD A;  3O33 A;  3HTK C;  1FBV A;  2LQ6 A;  2CKL A;  1WFK A;  3O70 A;  1WEN A;  3DQV R;  2K4D A;  4YC9 A;  2E6S A;  2KWK A;  1VFY A;  2E6R A;  1ZBD B;  5H1T A;  2VJF A;  3HCU A;  2KE1 A;  5DIN A;  4YAD A;  1DVP A;  2JMJ A;  4LJN A;  4GNF A;  5B78 A;  5B79 A;  5LCW B;  2LXP C;  2YT5 A;  1Z6U A;  2JRJ A;  3KNV A;  2EA6 A;  2MNY A;  5D1L B;  3M62 A;  4LK9 A;  5G04 B;  3N9P A;  3T7L A;  2L0B A;  1T1H A;  3N9N A;  3HCT A;  3ZVY A;  2AN6 A;  3MHH A;  3N9L A;  4V3K C;  1WES A;  3V43 A;  3N9O A;  5TDW A;  2YW8 A;  3U5N A;  1WEM A;  2Y43 A;  3L1Z B;  4ZQL A;  1VD4 A;  2YRE A;  3U5O A;  1Z2Q A;  2LDR A;  2L5U A;  3C5K A;  2MIQ A;  2PUY A;  2ECN A;  2K16 A;  3ZNI A;  4MVT A;  5H1V A;  2YSJ A;  3EB5 A;  2Y1M A;  2HDP A;  4C9Z A;  5D1K B;  4FJC A;  1MM2 A;  2MT5 A;  5KH3 A;  3ZPV E;  3L1X A;  3PUQ A;  5TRB A;  2K1J A;  4L7X A;  5B77 A;  2LXH C;  2CT2 A;  5AIU A;  3M99 A;  4AUQ B;  2RSD A;  4CA1 A;  4CCG X;  4YBM A;  4I7D A;  5FER A;  1WEQ A;  1BOR A;  5TAB A;  4FK5 A;  4A0C D;  2C2V S;  5KH9 A;  1X4U A;  3ZVZ B;  2KWN A;  4AYC B;  5B76 A;  3N9M A;  3HCS A;  5DKA A;  3LQJ A;  1XWH A;  3KV5 A;  4IC2 A;  2QIZ A;  1IYM A;  4GNE A;  1X4I A;  5H1U A;  4X3G A;  4N4F A;  3L11 A;  4B7Y C;  2Y1N A;  4A49 A;  5C11 A;  1MM3 A;  4UI9 B;  3RTR B;  2VPD A;  3M63 A;  2EGP A;  1RMD A;  2KFT A;  2YUC A;  3O7A A;  2M6M A;  4A4C A;  4FIP A;  2G45 A;  4V3L C;  3U5M A;  2D8S A;  1WIL A;  2XB1 A;  1LDK C;  2MNZ A;  4B86 C;  2LGV A;  2LGL A;  1WEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...