2KWNA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing acetylation at lysine 16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone peptide
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwnA00
1FBVA 4S3OB 4GNDA 2M85A 2VJEA 5AITA 4QF3A 4ZQLA 2K17A 1WEWA 2G45A 2F42A 2G43A 5EYAF 2KFTA 5TABA 2YYRA 2VJFB 5LCWB 3N9MA 3O33A 2LGLA 1Z2QA 3T6RA 3ZNIA 2ECWA 3T7LA 1T1HA 5FB1A 2MA6A 2KGIA 2MUMA 3ZVYA 1G25A 2BAYA 2YW8A 2MNZA 4N4FA 1WENA 3PUQA 5J3XA 3N9NA 4LKAA 4B7YC 1WESA 4S3OC 3O37A 3EB5A 5LKUA 2CT2A 3HCSA 5DINA 2EGPA 4CA1A 2ZETC 1U6GB 4AVXA 2KWNA 2YT5A 1HYIA 5D1MB 3O7AA 2FSAA 5G04B 4A4BA 1BORA 5FB0A 3ASLA 4TKPB 4ZDTA 2ECVA 4WZ3B 1WEPA 3ZVZB 3NG2A 3U5NA 4YBSA 4AYCA 1X4UA 4AYCB 3LRQA 3GL6A 3QZVA 4V3LC 1MM2A 1F62A 3M63A 3KV6A 5B78A 3C5KA 2I50A 1JM7B 2VJFA 4MVTA 1ZBDB 1VFYA 3L1ZB 3MHHA 2FUUA 4AUQB 3O70A 4I7BA 3DQVR 5FEYA 1Z6UA 4P5OB 5B8DA 4QF2A 2KYUA 2H0DB 2H0DA 2PNXA 2JMDA 2IDAA 2C2VS 3RPGC 4A4CA 1VD4A 3LQJA 2MD8C 3EB6A 2E6RA 4YAXA 4GNFA 5B77A 3GV4A 2XB1A 1E4UA 3RTRB 2L5UA 2K4DA 3SOXA 2K16A 2NAAA 2C2LA 5LKXA 4IC2A 3RPGB 4R2YA 2LGGA 2MA5A 5H9MA 4BHWA 1JM7A 3PURA 2LXPC 4C9ZA 4R7EA 5DKAA 2QICA 2UZGA 3N9LA 3LQHA 2ECTA 2D8SA 2M3HA 2F6JA 4UP0A 4CCGX 3O36A 5C13A 1WEOA 1FP0A 2JMJA 4LK9A 1IYMA 2KWJA 4X3GA 5B75A 4LADB 2RSDA 4YATA 3ZYQA 2JRJA 2YHNA 1X4JA 1MM3A 2CKLB 3MHSA 5B76A 2YURA 3SHBA 2KWKA 4O64A 3LQIA 4PPEA 1RMDA 2L0BA 3M99A 1LDJB 5KH3A 1WGMA 3KNVA 1JOCA 5D1LB 4YBMA 2F6NA 2VP7A 4YBTA 1WEVA 4XI1A 2VNFA 2KGGA 1WEEA 4L58A 1WIMA 5H1TA 4B86C 2LDRA 4WA6A 4R8PK 3L11A 2RI7A 4V3KC 1WEMA 5AIUA 5TDRA 1LDKC 5TDWA 3N9PA 1CHCA 2EA6A 4YABA 2ECIA 4AP4A 4MSXA 2L43A 2E6SA 2QJ0A 4W4UA 4BBQA 4F52B 3SOWA 4WZ0A 2KU3A 2YQMA 5G05B 2LGVA 2CKLA 2VPBA 5LKZA 1WEQA 2M6MA 1WE9A 2KIZA 5KH9A 1XWHA 3KV5A 2ECGA 5TBNA 5JG6A 3HCTA 1V87A 1X4IA 4I7DA 4PTBA 4A0CD 3U5OA 2VPDA 3HCUA 3HTKC 4GB0A 2M1RA 2VPGA 2Y43A 2AN6A 2LXHC 5D1KB 2LGKA 2YSMA 1N87A 2KR4A 2HYED 2LN0A 2L80A 4LJNA 2Y1MA 3N9OA 2MNYA 1DVPA 5G0FA 2L75A 3V43A 3I2DA 1VYXA 2YQLA 2YSJA 2CSZA 4WZ2A 4FK5A 5FERA 4GNEA 3O34A 3PHDA 4L7XA 2LV9A 2YU4A 3ZPVE 1K2FA 2CSYA 4GNGA 2K1JA 3DPLR 3U5MA 5C11A 2KWOA 3C6WA 3ZPV1 3FL2A 3L1XA 4FIPA 3O35A 5KH7A 2FUIA 2ECJA 5H1UA 3N9QA 2MD7B 2LRIC 2VPEA 2JMIA 3VK6A 2EODA 3ZTGA 4NN2A 2KREA 3SOUA 5LKTA 2VJEB 4I7CA 4YC9A 2Y1NA 2OXQC 4Q6FA 1Z60A 4YADA 3M62A 4IC3A 2DX8A 5I3LA 2YREA 2YUCA 1WILA 4N3WA 4UP5A 1WEUA 3IHPA 2XEUA 4FJCA 4FO9A 1WFKA 5H1VA 5TRBA 2ECNA 2MIQA 2LQ6A 1HYJA 4LLBA 2MT5A 3KQIA 2PUYA 4A49A 2G6QA 4ZUXU 2HDPA 4UI9B 3U5PA 2KE1A 2QIZA 5B79A 2YHOA
chains in the Genus database with same CATH superfamily
1FBVA 4S3OB 2JUNA 4GNDA 2M85A 2VJEA 5AITA 4QF3A 4ZQLA 2K17A 1DCQA 1WEWA 2G45A 2F42A 2G43A 5EYAF 2KFTA 5TABA 2YYRA 2VJFB 5LCWB 3N9MA 3O33A 2LGLA 1Z2QA 3T6RA 3ZNIA 2ECWA 3T7LA 1T1HA 5FB1A 2L7PA 2MA6A 4OGCA 2FFWA 2KGIA 2MUMA 3ZVYA 1G25A 2BAYA 2YW8A 2MNZA 4N4FA 1WENA 3PUQA 5J3XA 3N9NA 4LKAA 4B7YC 1WESA 4S3OC 3O37A 3EB5A 3LDYA 5LKUA 2CT2A 3JUEA 3HCSA 5DINA 2EGPA 4CA1A 2ZETC 1U6GB 4AVXA 2KWNA 2YT5A 1HYIA 5D1MB 3O7AA 2FSAA 3FJUB 5G04B 4A4BA 1BORA 2B0OE 5FB0A 4QQ4A 3ASLA 4TKPB 4ZDTA 2ECVA 4WZ3B 1WEPA 3ZVZB 3NG2A 2YVRA 3U5NA 4YBSA 4AYCA 1X4UA 4AYCB 3LRQA 3GL6A 3QZVA 4V3LC 1MM2A 1F62A 3M63A 3KV6A 5B78A 3C5KA 2I50A 2E61A 1JM7B 2VJFA 4MVTA 1ZBDB 1VFYA 3L1ZB 3MHHA 2FUUA 4AUQB 4OGEA 3O70A 4I7BA 3DQVR 5FEYA 1Z6UA 4P5OB 5B8DA 3FM8C 4QF2A 2KYUA 2H0DB 2H0DA 2DSMA 2PNXA 2JMDA 3H7HA 2IDAA 2C2VS 3RPGC 4A4CA 1VD4A 4Z0OA 3LQJA 2MD8C 3EB6A 2E6RA 4YAXA 4GNFA 5B77A 5SVXA 3GV4A 2XB1A 1E4UA 3RTRB 2L5UA 2K4DA 3SOXA 2K16A 2CSVA 1MBMA 2NAAA 2C2LA 5LKXA 4IC2A 3RPGB 4R2YA 2LGGA 2MA5A 5H9MA 4BHWA 2DJAA 1JM7A 3PURA 2LXPC 4C9ZA 4R7EA 5DKAA 2QICA 5SVYA 2UZGA 3N9LA 3LQHA 2EXUA 2ECTA 2D8SA 2M3HA 2F6JA 3O47A 4UP0A 4CCGX 3O36A 5C13A 1WEOA 1FP0A 2JMJA 4LK9A 1IYMA 2KWJA 4X3GA 5B75A 4LADB 2RSDA 4YATA 3ZYQA 2JRJA 2YHNA 2EGMA 3SUBA 1X4JA 1MM3A 2CKLB 2CRWA 3MHSA 5B76A 2YURA 3SHBA 2KWKA 4O64A 3LQIA 2XOCA 1RMDA 4PPEA 2L0BA 3M99A 1LDJB 5KH3A 2KKXA 1WGMA 3KNVA 1JOCA 5D1LB 4YBMA 2F6NA 2VP7A 4YBTA 3T9KA 3FAOA 1WEVA 4XI1A 3M7KA 2VNFA 2KGGA 1WEEA 4L58A 1WIMA 5H1TA 4B86C 2LDRA 4WA6A 4R8PK 3L11A 2RI7A 4V3KC 1WEMA 5AIUA 2XOZA 5TDRA 1LDKC 5TDWA 3N9PA 1CHCA 2EA6A 4YABA 2ECIA 4AP4A 2RR4A 4MSXA 4F1PA 2OWAA 2L43A 2E6SA 2QJ0A 4W4UA 4BBQA 4F52B 3SOWA 4WZ0A 2KU3A 2M13A 2YQMA 5G05B 2LGVA 2CKLA 2VPBA 5LKZA 1WEQA 2M6MA 1WE9A 2KIZA 5KH9A 2XOYA 1XWHA 3KV5A 2FD4A 2ECGA 5TBNA 5JG6A 3HCTA 1V87A 1X4IA 4I7DA 3LVRE 4PTBA 4A0CD 2IQJA 3U5OA 2VPDA 3HCUA 3HTKC 4GB0A 2M1RA 2VPGA 2Y43A 2AN6A 2LXHC 2MKEA 5D1KB 2D8UA 2LGKA 2P57A 2YSMA 1N87A 2KR4A 2HYED 2LN0A 2L80A 4LJNA 2XP0A 2Y1MA 3N9OA 3FEHA 2MNYA 2JM3A 1DVPA 5G0FA 4O62A 2L75A 3PLWA 3V43A 3I2DA 1VYXA 2KKYA 3FANA 2YQLA 2YSJA 2CSZA 4WZ2A 4FK5A 5FERA 4GNEA 3O34A 3PHDA 4L7XA 2LV9A 2YU4A 3ZPVE 1K2FA 2CSYA 4GNGA 4H9DA 2K1JA 3DPLR 3U5MA 5C11A 2KWOA 3C6WA 3ZPV1 3FL2A 3LVQE 4Z0RA 2LAUA 3L1XA 4FIPA 3O35A 5KH7A 2FUIA 2ECJA 5H1UA 3N9QA 2MD7B 2LRIC 2VPEA 2JMIA 3VK6A 2EODA 3ZTGA 4NN2A 2KREA 3Q1DA 3SOUA 5LKTA 2VJEB 3DWDA 4I7CA 4YC9A 2Y1NA 2OXQC 4Q6FA 1Z60A 4YADA 3M62A 3MDBC 4IC3A 2DX8A 5I3LA 2YREA 2YUCA 3DDTA 1WILA 4N3WA 4UP5A 1WEUA 3LJUX 3IHPA 2XEUA 5K3QA 4FO9A 4FJCA 1WFKA 5H1VA 2ECNA 5TRBA 2MIQA 2LQ6A 1HYJA 4LLBA 2MT5A 3KQIA 2PUYA 4A49A 2G6QA 3E2DA 5SVIA 4ZUXU 5SVIB 3KDEC 2HDPA 4UI9B 3U5PA 2KE1A 2CONA 2CRRA 2QIZA 5B79A 2YHOA
chains in the Genus database with same CATH topology
1FBVA 4S3OB 4GNDA 2M85A 2VJEA 5AITA 4QF3A 4ZQLA 2K17A 1WEWA 2G45A 2F42A 2G43A 5EYAF 2KFTA 5TABA 2YYRA 2VJFB 5LCWB 3N9MA 3O33A 2LGLA 1Z2QA 3T6RA 3ZNIA 2ECWA 3T7LA 1T1HA 5FB1A 2MA6A 2KGIA 2MUMA 3ZVYA 1G25A 2BAYA 2YW8A 2MNZA 4N4FA 1WENA 3PUQA 5J3XA 3N9NA 4LKAA 4B7YC 1WESA 4S3OC 3O37A 3EB5A 5LKUA 2CT2A 3HCSA 5DINA 2EGPA 4CA1A 2ZETC 1U6GB 4AVXA 2KWNA 2YT5A 1HYIA 5D1MB 3O7AA 2FSAA 5G04B 4A4BA 1BORA 5FB0A 3ASLA 4TKPB 4ZDTA 2ECVA 4WZ3B 1WEPA 3ZVZB 3NG2A 3U5NA 4YBSA 4AYCA 1X4UA 4AYCB 3LRQA 3GL6A 3QZVA 4V3LC 1MM2A 1F62A 3M63A 3KV6A 5B78A 3C5KA 2I50A 1JM7B 2VJFA 4MVTA 1ZBDB 1VFYA 3L1ZB 3MHHA 2FUUA 4AUQB 3O70A 4I7BA 3DQVR 5FEYA 1Z6UA 4P5OB 5B8DA 4QF2A 2KYUA 2H0DB 2H0DA 2PNXA 2JMDA 2IDAA 2C2VS 3RPGC 4A4CA 1VD4A 3LQJA 2MD8C 3EB6A 2E6RA 4YAXA 4GNFA 5B77A 3GV4A 2XB1A 1E4UA 3RTRB 2L5UA 2K4DA 3SOXA 2K16A 2NAAA 2C2LA 5LKXA 4IC2A 3RPGB 4R2YA 2LGGA 2MA5A 5H9MA 4BHWA 1JM7A 3PURA 2LXPC 4C9ZA 4R7EA 5DKAA 2QICA 2UZGA 3N9LA 3LQHA 2ECTA 2D8SA 2M3HA 2F6JA 4UP0A 4CCGX 3O36A 5C13A 1WEOA 1FP0A 2JMJA 4LK9A 1IYMA 2KWJA 4X3GA 5B75A 4LADB 2RSDA 4YATA 3ZYQA 2JRJA 2YHNA 1X4JA 1MM3A 2CKLB 3MHSA 5B76A 2YURA 3SHBA 2KWKA 4O64A 3LQIA 4PPEA 1RMDA 2L0BA 3M99A 1LDJB 5KH3A 1WGMA 3KNVA 1JOCA 5D1LB 4YBMA 2F6NA 2VP7A 4YBTA 1WEVA 4XI1A 2VNFA 2KGGA 1WEEA 4L58A 1WIMA 5H1TA 4B86C 2LDRA 4WA6A 4R8PK 3L11A 2RI7A 4V3KC 1WEMA 5AIUA 5TDRA 1LDKC 5TDWA 3N9PA 1CHCA 2EA6A 4YABA 2ECIA 4AP4A 4MSXA 2L43A 2E6SA 2QJ0A 4W4UA 4BBQA 4F52B 3SOWA 4WZ0A 2KU3A 2YQMA 5G05B 2LGVA 2CKLA 2VPBA 5LKZA 1WEQA 2M6MA 1WE9A 2KIZA 5KH9A 1XWHA 3KV5A 2ECGA 5TBNA 5JG6A 3HCTA 1V87A 1X4IA 4I7DA 4PTBA 4A0CD 3U5OA 2VPDA 3HCUA 3HTKC 4GB0A 2M1RA 2VPGA 2Y43A 2AN6A 2LXHC 5D1KB 2LGKA 2YSMA 1N87A 2KR4A 2HYED 2LN0A 2L80A 4LJNA 2Y1MA 3N9OA 2MNYA 1DVPA 5G0FA 2L75A 3V43A 3I2DA 1VYXA 2YQLA 2YSJA 2CSZA 4WZ2A 4FK5A 5FERA 4GNEA 3O34A 3PHDA 4L7XA 2LV9A 2YU4A 3ZPVE 1K2FA 2CSYA 4GNGA 2K1JA 3DPLR 3U5MA 5C11A 2KWOA 3C6WA 3ZPV1 3FL2A 3L1XA 4FIPA 3O35A 5KH7A 2FUIA 2ECJA 5H1UA 3N9QA 2MD7B 2LRIC 2VPEA 2JMIA 3VK6A 2EODA 3ZTGA 4NN2A 2KREA 3SOUA 5LKTA 2VJEB 4I7CA 4YC9A 2Y1NA 2OXQC 4Q6FA 1Z60A 4YADA 3M62A 4IC3A 2DX8A 5I3LA 2YREA 2YUCA 1WILA 4N3WA 4UP5A 1WEUA 3IHPA 2XEUA 4FJCA 4FO9A 1WFKA 5H1VA 5TRBA 2ECNA 2MIQA 2LQ6A 1HYJA 4LLBA 2MT5A 3KQIA 2PUYA 4A49A 2G6QA 4ZUXU 2HDPA 4UI9B 3U5PA 2KE1A 2QIZA 5B79A 2YHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  4S3O B;  4GND A;  2M85 A;  2VJE A;  5AIT A;  4QF3 A;  4ZQL A;  2K17 A;  1WEW A;  2G45 A;  2F42 A;  2G43 A;  5EYA F;  2KFT A;  5TAB A;  2YYR A;  2VJF B;  5LCW B;  3N9M A;  3O33 A;  2LGL A;  1Z2Q A;  3T6R A;  3ZNI A;  2ECW A;  3T7L A;  1T1H A;  5FB1 A;  2MA6 A;  2KGI A;  2MUM A;  3ZVY A;  1G25 A;  2BAY A;  2YW8 A;  2MNZ A;  4N4F A;  1WEN A;  3PUQ A;  5J3X A;  3N9N A;  4LKA A;  4B7Y C;  1WES A;  4S3O C;  3O37 A;  3EB5 A;  5LKU A;  2CT2 A;  3HCS A;  5DIN A;  2EGP A;  4CA1 A;  2ZET C;  1U6G B;  4AVX A;  2KWN A;  2YT5 A;  1HYI A;  5D1M B;  3O7A A;  2FSA A;  5G04 B;  4A4B A;  1BOR A;  5FB0 A;  3ASL A;  4TKP B;  4ZDT A;  2ECV A;  4WZ3 B;  1WEP A;  3ZVZ B;  3NG2 A;  3U5N A;  4YBS A;  4AYC A;  1X4U A;  4AYC B;  3LRQ A;  3GL6 A;  3QZV A;  4V3L C;  1MM2 A;  1F62 A;  3M63 A;  3KV6 A;  5B78 A;  3C5K A;  2I50 A;  1JM7 B;  2VJF A;  4MVT A;  1ZBD B;  1VFY A;  3L1Z B;  3MHH A;  2FUU A;  4AUQ B;  3O70 A;  4I7B A;  3DQV R;  5FEY A;  1Z6U A;  4P5O B;  5B8D A;  4QF2 A;  2KYU A;  2H0D B;  2H0D A;  2PNX A;  2JMD A;  2IDA A;  2C2V S;  3RPG C;  4A4C A;  1VD4 A;  3LQJ A;  2MD8 C;  3EB6 A;  2E6R A;  4YAX A;  4GNF A;  5B77 A;  3GV4 A;  2XB1 A;  1E4U A;  3RTR B;  2L5U A;  2K4D A;  3SOX A;  2K16 A;  2NAA A;  2C2L A;  5LKX A;  4IC2 A;  3RPG B;  4R2Y A;  2LGG A;  2MA5 A;  5H9M A;  4BHW A;  1JM7 A;  3PUR A;  2LXP C;  4C9Z A;  4R7E A;  5DKA A;  2QIC A;  2UZG A;  3N9L A;  3LQH A;  2ECT A;  2D8S A;  2M3H A;  2F6J A;  4UP0 A;  4CCG X;  3O36 A;  5C13 A;  1WEO A;  1FP0 A;  2JMJ A;  4LK9 A;  1IYM A;  2KWJ A;  4X3G A;  5B75 A;  4LAD B;  2RSD A;  4YAT A;  3ZYQ A;  2JRJ A;  2YHN A;  1X4J A;  1MM3 A;  2CKL B;  3MHS A;  5B76 A;  2YUR A;  3SHB A;  2KWK A;  4O64 A;  3LQI A;  4PPE A;  1RMD A;  2L0B A;  3M99 A;  1LDJ B;  5KH3 A;  1WGM A;  3KNV A;  1JOC A;  5D1L B;  4YBM A;  2F6N A;  2VP7 A;  4YBT A;  1WEV A;  4XI1 A;  2VNF A;  2KGG A;  1WEE A;  4L58 A;  1WIM A;  5H1T A;  4B86 C;  2LDR A;  4WA6 A;  4R8P K;  3L11 A;  2RI7 A;  4V3K C;  1WEM A;  5AIU A;  5TDR A;  1LDK C;  5TDW A;  3N9P A;  1CHC A;  2EA6 A;  4YAB A;  2ECI A;  4AP4 A;  4MSX A;  2L43 A;  2E6S A;  2QJ0 A;  4W4U A;  4BBQ A;  4F52 B;  3SOW A;  4WZ0 A;  2KU3 A;  2YQM A;  5G05 B;  2LGV A;  2CKL A;  2VPB A;  5LKZ A;  1WEQ A;  2M6M A;  1WE9 A;  2KIZ A;  5KH9 A;  1XWH A;  3KV5 A;  2ECG A;  5TBN A;  5JG6 A;  3HCT A;  1V87 A;  1X4I A;  4I7D A;  4PTB A;  4A0C D;  3U5O A;  2VPD A;  3HCU A;  3HTK C;  4GB0 A;  2M1R A;  2VPG A;  2Y43 A;  2AN6 A;  2LXH C;  5D1K B;  2LGK A;  2YSM A;  1N87 A;  2KR4 A;  2HYE D;  2LN0 A;  2L80 A;  4LJN A;  2Y1M A;  3N9O A;  2MNY A;  1DVP A;  5G0F A;  2L75 A;  3V43 A;  3I2D A;  1VYX A;  2YQL A;  2YSJ A;  2CSZ A;  4WZ2 A;  4FK5 A;  5FER A;  4GNE A;  3O34 A;  3PHD A;  4L7X A;  2LV9 A;  2YU4 A;  3ZPV E;  1K2F A;  2CSY A;  4GNG A;  2K1J A;  3DPL R;  3U5M A;  5C11 A;  2KWO A;  3C6W A;  3ZPV 1;  3FL2 A;  3L1X A;  4FIP A;  3O35 A;  5KH7 A;  2FUI A;  2ECJ A;  5H1U A;  3N9Q A;  2MD7 B;  2LRI C;  2VPE A;  2JMI A;  3VK6 A;  2EOD A;  3ZTG A;  4NN2 A;  2KRE A;  3SOU A;  5LKT A;  2VJE B;  4I7C A;  4YC9 A;  2Y1N A;  2OXQ C;  4Q6F A;  1Z60 A;  4YAD A;  3M62 A;  4IC3 A;  2DX8 A;  5I3L A;  2YRE A;  2YUC A;  1WIL A;  4N3W A;  4UP5 A;  1WEU A;  3IHP A;  2XEU A;  4FJC A;  4FO9 A;  1WFK A;  5H1V A;  5TRB A;  2ECN A;  2MIQ A;  2LQ6 A;  1HYJ A;  4LLB A;  2MT5 A;  3KQI A;  2PUY A;  4A49 A;  2G6Q A;  4ZUX U;  2HDP A;  4UI9 B;  3U5P A;  2KE1 A;  2QIZ A;  5B79 A;  2YHO A; 
#chains in the Genus database with same CATH topology
 1FBV A;  4S3O B;  2JUN A;  4GND A;  2M85 A;  2VJE A;  5AIT A;  4QF3 A;  4ZQL A;  2K17 A;  1DCQ A;  1WEW A;  2G45 A;  2F42 A;  2G43 A;  5EYA F;  2KFT A;  5TAB A;  2YYR A;  2VJF B;  5LCW B;  3N9M A;  3O33 A;  2LGL A;  1Z2Q A;  3T6R A;  3ZNI A;  2ECW A;  3T7L A;  1T1H A;  5FB1 A;  2L7P A;  2MA6 A;  4OGC A;  2FFW A;  2KGI A;  2MUM A;  3ZVY A;  1G25 A;  2BAY A;  2YW8 A;  2MNZ A;  4N4F A;  1WEN A;  3PUQ A;  5J3X A;  3N9N A;  4LKA A;  4B7Y C;  1WES A;  4S3O C;  3O37 A;  3EB5 A;  3LDY A;  5LKU A;  2CT2 A;  3JUE A;  3HCS A;  5DIN A;  2EGP A;  4CA1 A;  2ZET C;  1U6G B;  4AVX A;  2KWN A;  2YT5 A;  1HYI A;  5D1M B;  3O7A A;  2FSA A;  3FJU B;  5G04 B;  4A4B A;  1BOR A;  2B0O E;  5FB0 A;  4QQ4 A;  3ASL A;  4TKP B;  4ZDT A;  2ECV A;  4WZ3 B;  1WEP A;  3ZVZ B;  3NG2 A;  2YVR A;  3U5N A;  4YBS A;  4AYC A;  1X4U A;  4AYC B;  3LRQ A;  3GL6 A;  3QZV A;  4V3L C;  1MM2 A;  1F62 A;  3M63 A;  3KV6 A;  5B78 A;  3C5K A;  2I50 A;  2E61 A;  1JM7 B;  2VJF A;  4MVT A;  1ZBD B;  1VFY A;  3L1Z B;  3MHH A;  2FUU A;  4AUQ B;  4OGE A;  3O70 A;  4I7B A;  3DQV R;  5FEY A;  1Z6U A;  4P5O B;  5B8D A;  3FM8 C;  4QF2 A;  2KYU A;  2H0D B;  2H0D A;  2DSM A;  2PNX A;  2JMD A;  3H7H A;  2IDA A;  2C2V S;  3RPG C;  4A4C A;  1VD4 A;  4Z0O A;  3LQJ A;  2MD8 C;  3EB6 A;  2E6R A;  4YAX A;  4GNF A;  5B77 A;  5SVX A;  3GV4 A;  2XB1 A;  1E4U A;  3RTR B;  2L5U A;  2K4D A;  3SOX A;  2K16 A;  2CSV A;  1MBM A;  2NAA A;  2C2L A;  5LKX A;  4IC2 A;  3RPG B;  4R2Y A;  2LGG A;  2MA5 A;  5H9M A;  4BHW A;  2DJA A;  1JM7 A;  3PUR A;  2LXP C;  4C9Z A;  4R7E A;  5DKA A;  2QIC A;  5SVY A;  2UZG A;  3N9L A;  3LQH A;  2EXU A;  2ECT A;  2D8S A;  2M3H A;  2F6J A;  3O47 A;  4UP0 A;  4CCG X;  3O36 A;  5C13 A;  1WEO A;  1FP0 A;  2JMJ A;  4LK9 A;  1IYM A;  2KWJ A;  4X3G A;  5B75 A;  4LAD B;  2RSD A;  4YAT A;  3ZYQ A;  2JRJ A;  2YHN A;  2EGM A;  3SUB A;  1X4J A;  1MM3 A;  2CKL B;  2CRW A;  3MHS A;  5B76 A;  2YUR A;  3SHB A;  2KWK A;  4O64 A;  3LQI A;  2XOC A;  1RMD A;  4PPE A;  2L0B A;  3M99 A;  1LDJ B;  5KH3 A;  2KKX A;  1WGM A;  3KNV A;  1JOC A;  5D1L B;  4YBM A;  2F6N A;  2VP7 A;  4YBT A;  3T9K A;  3FAO A;  1WEV A;  4XI1 A;  3M7K A;  2VNF A;  2KGG A;  1WEE A;  4L58 A;  1WIM A;  5H1T A;  4B86 C;  2LDR A;  4WA6 A;  4R8P K;  3L11 A;  2RI7 A;  4V3K C;  1WEM A;  5AIU A;  2XOZ A;  5TDR A;  1LDK C;  5TDW A;  3N9P A;  1CHC A;  2EA6 A;  4YAB A;  2ECI A;  4AP4 A;  2RR4 A;  4MSX A;  4F1P A;  2OWA A;  2L43 A;  2E6S A;  2QJ0 A;  4W4U A;  4BBQ A;  4F52 B;  3SOW A;  4WZ0 A;  2KU3 A;  2M13 A;  2YQM A;  5G05 B;  2LGV A;  2CKL A;  2VPB A;  5LKZ A;  1WEQ A;  2M6M A;  1WE9 A;  2KIZ A;  5KH9 A;  2XOY A;  1XWH A;  3KV5 A;  2FD4 A;  2ECG A;  5TBN A;  5JG6 A;  3HCT A;  1V87 A;  1X4I A;  4I7D A;  3LVR E;  4PTB A;  4A0C D;  2IQJ A;  3U5O A;  2VPD A;  3HCU A;  3HTK C;  4GB0 A;  2M1R A;  2VPG A;  2Y43 A;  2AN6 A;  2LXH C;  2MKE A;  5D1K B;  2D8U A;  2LGK A;  2P57 A;  2YSM A;  1N87 A;  2KR4 A;  2HYE D;  2LN0 A;  2L80 A;  4LJN A;  2XP0 A;  2Y1M A;  3N9O A;  3FEH A;  2MNY A;  2JM3 A;  1DVP A;  5G0F A;  4O62 A;  2L75 A;  3PLW A;  3V43 A;  3I2D A;  1VYX A;  2KKY A;  3FAN A;  2YQL A;  2YSJ A;  2CSZ A;  4WZ2 A;  4FK5 A;  5FER A;  4GNE A;  3O34 A;  3PHD A;  4L7X A;  2LV9 A;  2YU4 A;  3ZPV E;  1K2F A;  2CSY A;  4GNG A;  4H9D A;  2K1J A;  3DPL R;  3U5M A;  5C11 A;  2KWO A;  3C6W A;  3ZPV 1;  3FL2 A;  3LVQ E;  4Z0R A;  2LAU A;  3L1X A;  4FIP A;  3O35 A;  5KH7 A;  2FUI A;  2ECJ A;  5H1U A;  3N9Q A;  2MD7 B;  2LRI C;  2VPE A;  2JMI A;  3VK6 A;  2EOD A;  3ZTG A;  4NN2 A;  2KRE A;  3Q1D A;  3SOU A;  5LKT A;  2VJE B;  3DWD A;  4I7C A;  4YC9 A;  2Y1N A;  2OXQ C;  4Q6F A;  1Z60 A;  4YAD A;  3M62 A;  3MDB C;  4IC3 A;  2DX8 A;  5I3L A;  2YRE A;  2YUC A;  3DDT A;  1WIL A;  4N3W A;  4UP5 A;  1WEU A;  3LJU X;  3IHP A;  2XEU A;  5K3Q A;  4FO9 A;  4FJC A;  1WFK A;  5H1V A;  2ECN A;  5TRB A;  2MIQ A;  2LQ6 A;  1HYJ A;  4LLB A;  2MT5 A;  3KQI A;  2PUY A;  4A49 A;  2G6Q A;  3E2D A;  5SVI A;  4ZUX U;  5SVI B;  3KDE C;  2HDP A;  4UI9 B;  3U5P A;  2KE1 A;  2CON A;  2CRR A;  2QIZ A;  5B79 A;  2YHO A; 
#chains in the Genus database with same CATH homology
 1FBV A;  4S3O B;  4GND A;  2M85 A;  2VJE A;  5AIT A;  4QF3 A;  4ZQL A;  2K17 A;  1WEW A;  2G45 A;  2F42 A;  2G43 A;  5EYA F;  2KFT A;  5TAB A;  2YYR A;  2VJF B;  5LCW B;  3N9M A;  3O33 A;  2LGL A;  1Z2Q A;  3T6R A;  3ZNI A;  2ECW A;  3T7L A;  1T1H A;  5FB1 A;  2MA6 A;  2KGI A;  2MUM A;  3ZVY A;  1G25 A;  2BAY A;  2YW8 A;  2MNZ A;  4N4F A;  1WEN A;  3PUQ A;  5J3X A;  3N9N A;  4LKA A;  4B7Y C;  1WES A;  4S3O C;  3O37 A;  3EB5 A;  5LKU A;  2CT2 A;  3HCS A;  5DIN A;  2EGP A;  4CA1 A;  2ZET C;  1U6G B;  4AVX A;  2KWN A;  2YT5 A;  1HYI A;  5D1M B;  3O7A A;  2FSA A;  5G04 B;  4A4B A;  1BOR A;  5FB0 A;  3ASL A;  4TKP B;  4ZDT A;  2ECV A;  4WZ3 B;  1WEP A;  3ZVZ B;  3NG2 A;  3U5N A;  4YBS A;  4AYC A;  1X4U A;  4AYC B;  3LRQ A;  3GL6 A;  3QZV A;  4V3L C;  1MM2 A;  1F62 A;  3M63 A;  3KV6 A;  5B78 A;  3C5K A;  2I50 A;  1JM7 B;  2VJF A;  4MVT A;  1ZBD B;  1VFY A;  3L1Z B;  3MHH A;  2FUU A;  4AUQ B;  3O70 A;  4I7B A;  3DQV R;  5FEY A;  1Z6U A;  4P5O B;  5B8D A;  4QF2 A;  2KYU A;  2H0D B;  2H0D A;  2PNX A;  2JMD A;  2IDA A;  2C2V S;  3RPG C;  4A4C A;  1VD4 A;  3LQJ A;  2MD8 C;  3EB6 A;  2E6R A;  4YAX A;  4GNF A;  5B77 A;  3GV4 A;  2XB1 A;  1E4U A;  3RTR B;  2L5U A;  2K4D A;  3SOX A;  2K16 A;  2NAA A;  2C2L A;  5LKX A;  4IC2 A;  3RPG B;  4R2Y A;  2LGG A;  2MA5 A;  5H9M A;  4BHW A;  1JM7 A;  3PUR A;  2LXP C;  4C9Z A;  4R7E A;  5DKA A;  2QIC A;  2UZG A;  3N9L A;  3LQH A;  2ECT A;  2D8S A;  2M3H A;  2F6J A;  4UP0 A;  4CCG X;  3O36 A;  5C13 A;  1WEO A;  1FP0 A;  2JMJ A;  4LK9 A;  1IYM A;  2KWJ A;  4X3G A;  5B75 A;  4LAD B;  2RSD A;  4YAT A;  3ZYQ A;  2JRJ A;  2YHN A;  1X4J A;  1MM3 A;  2CKL B;  3MHS A;  5B76 A;  2YUR A;  3SHB A;  2KWK A;  4O64 A;  3LQI A;  4PPE A;  1RMD A;  2L0B A;  3M99 A;  1LDJ B;  5KH3 A;  1WGM A;  3KNV A;  1JOC A;  5D1L B;  4YBM A;  2F6N A;  2VP7 A;  4YBT A;  1WEV A;  4XI1 A;  2VNF A;  2KGG A;  1WEE A;  4L58 A;  1WIM A;  5H1T A;  4B86 C;  2LDR A;  4WA6 A;  4R8P K;  3L11 A;  2RI7 A;  4V3K C;  1WEM A;  5AIU A;  5TDR A;  1LDK C;  5TDW A;  3N9P A;  1CHC A;  2EA6 A;  4YAB A;  2ECI A;  4AP4 A;  4MSX A;  2L43 A;  2E6S A;  2QJ0 A;  4W4U A;  4BBQ A;  4F52 B;  3SOW A;  4WZ0 A;  2KU3 A;  2YQM A;  5G05 B;  2LGV A;  2CKL A;  2VPB A;  5LKZ A;  1WEQ A;  2M6M A;  1WE9 A;  2KIZ A;  5KH9 A;  1XWH A;  3KV5 A;  2ECG A;  5TBN A;  5JG6 A;  3HCT A;  1V87 A;  1X4I A;  4I7D A;  4PTB A;  4A0C D;  3U5O A;  2VPD A;  3HCU A;  3HTK C;  4GB0 A;  2M1R A;  2VPG A;  2Y43 A;  2AN6 A;  2LXH C;  5D1K B;  2LGK A;  2YSM A;  1N87 A;  2KR4 A;  2HYE D;  2LN0 A;  2L80 A;  4LJN A;  2Y1M A;  3N9O A;  2MNY A;  1DVP A;  5G0F A;  2L75 A;  3V43 A;  3I2D A;  1VYX A;  2YQL A;  2YSJ A;  2CSZ A;  4WZ2 A;  4FK5 A;  5FER A;  4GNE A;  3O34 A;  3PHD A;  4L7X A;  2LV9 A;  2YU4 A;  3ZPV E;  1K2F A;  2CSY A;  4GNG A;  2K1J A;  3DPL R;  3U5M A;  5C11 A;  2KWO A;  3C6W A;  3ZPV 1;  3FL2 A;  3L1X A;  4FIP A;  3O35 A;  5KH7 A;  2FUI A;  2ECJ A;  5H1U A;  3N9Q A;  2MD7 B;  2LRI C;  2VPE A;  2JMI A;  3VK6 A;  2EOD A;  3ZTG A;  4NN2 A;  2KRE A;  3SOU A;  5LKT A;  2VJE B;  4I7C A;  4YC9 A;  2Y1N A;  2OXQ C;  4Q6F A;  1Z60 A;  4YAD A;  3M62 A;  4IC3 A;  2DX8 A;  5I3L A;  2YRE A;  2YUC A;  1WIL A;  4N3W A;  4UP5 A;  1WEU A;  3IHP A;  2XEU A;  4FJC A;  4FO9 A;  1WFK A;  5H1V A;  5TRB A;  2ECN A;  2MIQ A;  2LQ6 A;  1HYJ A;  4LLB A;  2MT5 A;  3KQI A;  2PUY A;  4A49 A;  2G6Q A;  4ZUX U;  2HDP A;  4UI9 B;  3U5P A;  2KE1 A;  2QIZ A;  5B79 A;  2YHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...