2KWNA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing acetylation at lysine 16
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwnA00
5TABA 4IC2A 1JM7A 2F6NA 1WENA 1WE9A 2JRJA 2C2LA 2LRIC 2MD7B 4MSXA 3KQIA 2PNXA 2YSJA 3ASLA 4GNEA 3ZVZB 2MA6A 2K1JA 3GV4A 1DVPA 4F52B 2ZETC 4WZ0A 4QF2A 1WEMA 2Y1NA 5FEYA 5G0FA 4S3OB 2KFTA 3KNVA 2L75A 2F42A 4LADB 2LV9A 1MM3A 2HYED 2PUYA 2F6JA 1VFYA 1X4IA 2KR4A 2FUUA 3O37A 5JG6A 3O35A 4NN2A 5EYAF 1FP0A 3ZVYA 2YSMA 1WILA 5KH7A 4A49A 2ECNA 1HYIA 2YW8A 4LJNA 2KIZA 2D8SA 2QIZA 2ECJA 3NG2A 4AUQB 2YT5A 2VJEB 2KYUA 2LXHC 3PUQA 4I7BA 2CSYA 4LKAA 3RTRB 4IC3A 2M6MA 4I7DA 2EGPA 1FBVA 2M85A 2KREA 5G05B 4AYCB 2E6SA 5H1UA 2FUIA 4FJCA 2JMJA 3FL2A 1Z6UA 1X4JA 1WGMA 2MUMA 2LXPC 4UP5A 2Y43A 1WESA 2YURA 2CKLA 5LKTA 1T1HA 5DINA 5KH3A 2L5UA 2KWNA 4GNDA 2LGVA 5LCWB 2MT5A 4YC9A 2M1RA 4YBMA 3C6WA 1Z2QA 1VD4A 2VPBA 2FSAA 1Z60A 4Q6FA 5C11A 5C13A 5FB0A 2I50A 1WFKA 4FIPA 1ZBDB 4A0CD 1U6GB 3I2DA 2MNYA 4FK5A 3SOXA 5B8DA 3ZPVE 4V3KC 5TRBA 3U5PA 3M63A 3ZNIA 2L0BA 3MHSA 1RMDA 5B75A 4N4FA 2KE1A 2YREA 3DQVR 5B76A 4MVTA 4YADA 3HCSA 4WZ2A 2KWJA 5H1TA 2LGLA 4V3LC 5B78A 3EB5A 4R8PK 5D1LB 2E6RA 2LGGA 4QF3A 5G04B 4WZ3B 5TDRA 3KV5A 4CCGX 1LDJB 4YBSA 2K16A 4C9ZA 3RPGC 3O33A 5H1VA 4YBTA 5I3LA 1LDKC 4P5OB 3HTKC 4FO9A 5FERA 4N3WA 2KU3A 5DKAA 5AIUA 2MNZA 2OXQC 3GL6A 2EODA 1BORA 4WA6A 4A4CA 3KV6A 4X3GA 2RI7A 4YABA 2H0DA 2EA6A 2L43A 2CKLB 4R7EA 2VJFA 5TBNA 1K2FA 4L7XA 2ECTA 1JOCA 2G43A 2LGKA 2ECGA 3M62A 2MD8C 3U5NA 1WEVA 2G45A 1JM7B 2VJEA 2C2VS 3N9MA 2RSDA 3RPGB 5AITA 5D1KB 1HYJA 4CA1A 3SOWA 3MHHA 3L1XA 1VYXA 4AYCA 2VPEA 5LKZA 1G25A 3LRQA 2KWKA 4UP0A 4ZQLA 2VP7A 4GB0A 4AVXA 2YHOA 2KGIA 4LLBA 5TDWA 2KWOA 3SHBA 2JMDA 2K4DA 5D1MB 2LQ6A 3U5MA 3ZPV1 2L80A 2LDRA 2YYRA 2MIQA 2YHNA 4TKPB 3N9QA 4GNGA 2KGGA 2QJ0A 3HCTA 5B77A 3O7AA 3V43A 3T6RA 1WEWA 1X4UA 1WEOA 1N87A 3N9LA 3IHPA 3T7LA 3N9PA 2IDAA 3O36A 1WEPA 5LKUA 4ZUXU 3N9OA 2CSZA 4LK9A 3LQJA 4O64A 4W4UA 1WEQA 1XWHA 2YUCA 2NAAA 3ZYQA 3QZVA 3L1ZB 5J3XA 3N9NA 4BBQA 2QICA 1WIMA 4GNFA 4ZDTA 2ECVA 2XEUA 3ZTGA 2H0DB 5H9MA 2VPDA 1WEEA 3VK6A 2VJFB 3O34A 1E4UA 2Y1MA 2DX8A 2UZGA 5LKXA 3C5KA 3DPLR 3L11A 2ECWA 1IYMA 4L58A 2K17A 3PURA 2HDPA 3O70A 4R2YA 2ECIA 4I7CA 3U5OA 3LQHA 1CHCA 3M99A 3LQIA 2G6QA 2BAYA 4B7YC 2XB1A 5FB1A 2CT2A 4YAXA 2MA5A 2YQLA 1MM2A 4A4BA 4YATA 2VNFA 5KH9A 3SOUA 2YQMA 2VPGA 5B79A 4S3OC 4UI9B 2LN0A 4XI1A 1F62A 1V87A 3PHDA 4PTBA 4BHWA 4PPEA 2M3HA 1WEUA 4B86C 3EB6A 3HCUA 4AP4A 2YU4A 2AN6A 2JMIA
chains in the Genus database with same CATH superfamily
5TABA 4IC2A 1JM7A 2F6NA 3DDTA 1WENA 1WE9A 2JRJA 2C2LA 2LRIC 2MD7B 4MSXA 3KQIA 2PNXA 2YSJA 2D8UA 3ASLA 4GNEA 3ZVZB 2EGMA 5SVYA 2MA6A 2K1JA 3GV4A 1DVPA 4F52B 2ZETC 4WZ0A 4QF2A 1WEMA 2YVRA 2Y1NA 5FEYA 5G0FA 3MDBC 4S3OB 2KFTA 3LVQE 3KNVA 2L75A 2F42A 4LADB 3DWDA 2LV9A 1MM3A 2HYED 2PUYA 2F6JA 1VFYA 1X4IA 2KR4A 2FUUA 3FAOA 3O37A 5JG6A 3O35A 3KDEC 4NN2A 5EYAF 2XP0A 2KKYA 1FP0A 4QQ4A 3ZVYA 2YSMA 1WILA 5KH7A 4A49A 2ECNA 1HYIA 2YW8A 2XOCA 4LJNA 2KIZA 2D8SA 2QIZA 2ECJA 3NG2A 4AUQB 2YT5A 2VJEB 2KYUA 2LXHC 3PUQA 4I7BA 2CSYA 4LKAA 3FANA 3RTRB 4IC3A 2M6MA 4I7DA 2EGPA 4OGCA 1FBVA 2OWAA 2M85A 2KREA 5G05B 4AYCB 2E6SA 2CRRA 5H1UA 3M7KA 2FUIA 4FJCA 2LAUA 2JMJA 3FL2A 1Z6UA 3LDYA 1X4JA 1WGMA 2MUMA 3H7HA 2IQJA 2LXPC 4UP5A 2JUNA 2Y43A 1WESA 2YURA 2CKLA 5LKTA 1T1HA 5DINA 5KH3A 2L5UA 4F1PA 2KWNA 4GNDA 2LGVA 2EXUA 5LCWB 2MT5A 4YC9A 2M1RA 4YBMA 3C6WA 1Z2QA 1VD4A 2VPBA 2FSAA 1Z60A 3JUEA 4Q6FA 5C11A 5C13A 5FB0A 5SVIA 2I50A 1WFKA 4FIPA 1ZBDB 4A0CD 1U6GB 3I2DA 2MNYA 4FK5A 3SOXA 5B8DA 3ZPVE 2MKEA 4V3KC 5TRBA 3U5PA 3M63A 3ZNIA 2L0BA 4H9DA 3MHSA 1RMDA 5B75A 4N4FA 2KE1A 2YREA 3DQVR 5B76A 4Z0OA 4MVTA 4YADA 3HCSA 4WZ2A 2KWJA 5H1TA 2LGLA 4V3LC 3SUBA 5B78A 3EB5A 4R8PK 2FD4A 5D1LB 2E6RA 2LGGA 4QF3A 5G04B 2CRWA 4WZ3B 5TDRA 3KV5A 4CCGX 1LDJB 4YBSA 3FJUB 2K16A 4C9ZA 3RPGC 3O33A 2XOZA 5H1VA 4YBTA 5I3LA 1LDKC 4P5OB 3HTKC 4FO9A 5FERA 4N3WA 3Q1DA 2KU3A 5DKAA 5AIUA 2MNZA 2OXQC 3GL6A 2EODA 1BORA 4WA6A 4A4CA 3KV6A 4X3GA 2KKXA 2RI7A 4YABA 2L7PA 2CSVA 2H0DA 2EA6A 2E61A 1MBMA 2L43A 2CKLB 4R7EA 2VJFA 5TBNA 2CONA 1K2FA 4L7XA 2ECTA 1JOCA 2G43A 2LGKA 2ECGA 3M62A 2MD8C 3U5NA 1WEVA 2G45A 5K3QA 1JM7B 2VJEA 2C2VS 3N9MA 2RSDA 3RPGB 5AITA 5D1KB 1HYJA 4CA1A 3SOWA 3MHHA 3L1XA 1VYXA 4AYCA 2VPEA 5LKZA 1G25A 3LRQA 3FEHA 2KWKA 4UP0A 2DSMA 4ZQLA 3O47A 2VP7A 4GB0A 4AVXA 2YHOA 2KGIA 4LLBA 5TDWA 2KWOA 3SHBA 2JMDA 2M13A 2K4DA 5D1MB 2LQ6A 3U5MA 3ZPV1 2L80A 2LDRA 3PLWA 2YYRA 2MIQA 2YHNA 3E2DA 4TKPB 3N9QA 4GNGA 2KGGA 2QJ0A 3HCTA 2XOYA 5B77A 3O7AA 3V43A 3T6RA 1WEWA 1X4UA 1WEOA 1N87A 3N9LA 1DCQA 3IHPA 4Z0RA 3T7LA 3N9PA 2IDAA 3O36A 5SVXA 1WEPA 5LKUA 4ZUXU 3N9OA 2CSZA 4LK9A 3LQJA 4O64A 3LVRE 4W4UA 1WEQA 1XWHA 2YUCA 2NAAA 3ZYQA 3QZVA 3L1ZB 5J3XA 3N9NA 4BBQA 2QICA 1WIMA 4GNFA 4ZDTA 2ECVA 2XEUA 3ZTGA 2H0DB 5H9MA 2DJAA 3LJUX 2VPDA 1WEEA 3VK6A 2VJFB 3O34A 1E4UA 2Y1MA 2DX8A 2UZGA 5LKXA 3C5KA 3DPLR 3FM8C 3L11A 2ECWA 1IYMA 4L58A 2B0OE 2K17A 3PURA 2HDPA 3O70A 4R2YA 2ECIA 2FFWA 4I7CA 3U5OA 3LQHA 1CHCA 3M99A 3LQIA 2G6QA 2BAYA 4B7YC 2XB1A 5FB1A 2RR4A 2CT2A 4YAXA 2MA5A 2YQLA 1MM2A 4A4BA 4O62A 4YATA 2VNFA 5KH9A 3SOUA 2YQMA 3T9KA 2VPGA 5B79A 4S3OC 4UI9B 5SVIB 4OGEA 2LN0A 4XI1A 1F62A 1V87A 3PHDA 4PTBA 4BHWA 4PPEA 2M3HA 1WEUA 4B86C 3EB6A 3HCUA 4AP4A 2YU4A 2AN6A 2JMIA 2P57A 2JM3A
chains in the Genus database with same CATH topology
5TABA 4IC2A 1JM7A 2F6NA 1WENA 1WE9A 2JRJA 2C2LA 2LRIC 2MD7B 4MSXA 3KQIA 2PNXA 2YSJA 3ASLA 4GNEA 3ZVZB 2MA6A 2K1JA 3GV4A 1DVPA 4F52B 2ZETC 4WZ0A 4QF2A 1WEMA 2Y1NA 5FEYA 5G0FA 4S3OB 2KFTA 3KNVA 2L75A 2F42A 4LADB 2LV9A 1MM3A 2HYED 2PUYA 2F6JA 1VFYA 1X4IA 2KR4A 2FUUA 3O37A 5JG6A 3O35A 4NN2A 5EYAF 1FP0A 3ZVYA 2YSMA 1WILA 5KH7A 4A49A 2ECNA 1HYIA 2YW8A 4LJNA 2KIZA 2D8SA 2QIZA 2ECJA 3NG2A 4AUQB 2YT5A 2VJEB 2KYUA 2LXHC 3PUQA 4I7BA 2CSYA 4LKAA 3RTRB 4IC3A 2M6MA 4I7DA 2EGPA 1FBVA 2M85A 2KREA 5G05B 4AYCB 2E6SA 5H1UA 2FUIA 4FJCA 2JMJA 3FL2A 1Z6UA 1X4JA 1WGMA 2MUMA 2LXPC 4UP5A 2Y43A 1WESA 2YURA 2CKLA 5LKTA 1T1HA 5DINA 5KH3A 2L5UA 2KWNA 4GNDA 2LGVA 5LCWB 2MT5A 4YC9A 2M1RA 4YBMA 3C6WA 1Z2QA 1VD4A 2VPBA 2FSAA 1Z60A 4Q6FA 5C11A 5C13A 5FB0A 2I50A 1WFKA 4FIPA 1ZBDB 4A0CD 1U6GB 3I2DA 2MNYA 4FK5A 3SOXA 5B8DA 3ZPVE 4V3KC 5TRBA 3U5PA 3M63A 3ZNIA 2L0BA 3MHSA 1RMDA 5B75A 4N4FA 2KE1A 2YREA 3DQVR 5B76A 4MVTA 4YADA 3HCSA 4WZ2A 2KWJA 5H1TA 2LGLA 4V3LC 5B78A 3EB5A 4R8PK 5D1LB 2E6RA 2LGGA 4QF3A 5G04B 4WZ3B 5TDRA 3KV5A 4CCGX 1LDJB 4YBSA 2K16A 4C9ZA 3RPGC 3O33A 5H1VA 4YBTA 5I3LA 1LDKC 4P5OB 3HTKC 4FO9A 5FERA 4N3WA 2KU3A 5DKAA 5AIUA 2MNZA 2OXQC 3GL6A 2EODA 1BORA 4WA6A 4A4CA 3KV6A 4X3GA 2RI7A 4YABA 2H0DA 2EA6A 2L43A 2CKLB 4R7EA 2VJFA 5TBNA 1K2FA 4L7XA 2ECTA 1JOCA 2G43A 2LGKA 2ECGA 3M62A 2MD8C 3U5NA 1WEVA 2G45A 1JM7B 2VJEA 2C2VS 3N9MA 2RSDA 3RPGB 5AITA 5D1KB 1HYJA 4CA1A 3SOWA 3MHHA 3L1XA 1VYXA 4AYCA 2VPEA 5LKZA 1G25A 3LRQA 2KWKA 4UP0A 4ZQLA 2VP7A 4GB0A 4AVXA 2YHOA 2KGIA 4LLBA 5TDWA 2KWOA 3SHBA 2JMDA 2K4DA 5D1MB 2LQ6A 3U5MA 3ZPV1 2L80A 2LDRA 2YYRA 2MIQA 2YHNA 4TKPB 3N9QA 4GNGA 2KGGA 2QJ0A 3HCTA 5B77A 3O7AA 3V43A 3T6RA 1WEWA 1X4UA 1WEOA 1N87A 3N9LA 3IHPA 3T7LA 3N9PA 2IDAA 3O36A 1WEPA 5LKUA 4ZUXU 3N9OA 2CSZA 4LK9A 3LQJA 4O64A 4W4UA 1WEQA 1XWHA 2YUCA 2NAAA 3ZYQA 3QZVA 3L1ZB 5J3XA 3N9NA 4BBQA 2QICA 1WIMA 4GNFA 4ZDTA 2ECVA 2XEUA 3ZTGA 2H0DB 5H9MA 2VPDA 1WEEA 3VK6A 2VJFB 3O34A 1E4UA 2Y1MA 2DX8A 2UZGA 5LKXA 3C5KA 3DPLR 3L11A 2ECWA 1IYMA 4L58A 2K17A 3PURA 2HDPA 3O70A 4R2YA 2ECIA 4I7CA 3U5OA 3LQHA 1CHCA 3M99A 3LQIA 2G6QA 2BAYA 4B7YC 2XB1A 5FB1A 2CT2A 4YAXA 2MA5A 2YQLA 1MM2A 4A4BA 4YATA 2VNFA 5KH9A 3SOUA 2YQMA 2VPGA 5B79A 4S3OC 4UI9B 2LN0A 4XI1A 1F62A 1V87A 3PHDA 4PTBA 4BHWA 4PPEA 2M3HA 1WEUA 4B86C 3EB6A 3HCUA 4AP4A 2YU4A 2AN6A 2JMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TAB A;  4IC2 A;  1JM7 A;  2F6N A;  1WEN A;  1WE9 A;  2JRJ A;  2C2L A;  2LRI C;  2MD7 B;  4MSX A;  3KQI A;  2PNX A;  2YSJ A;  3ASL A;  4GNE A;  3ZVZ B;  2MA6 A;  2K1J A;  3GV4 A;  1DVP A;  4F52 B;  2ZET C;  4WZ0 A;  4QF2 A;  1WEM A;  2Y1N A;  5FEY A;  5G0F A;  4S3O B;  2KFT A;  3KNV A;  2L75 A;  2F42 A;  4LAD B;  2LV9 A;  1MM3 A;  2HYE D;  2PUY A;  2F6J A;  1VFY A;  1X4I A;  2KR4 A;  2FUU A;  3O37 A;  5JG6 A;  3O35 A;  4NN2 A;  5EYA F;  1FP0 A;  3ZVY A;  2YSM A;  1WIL A;  5KH7 A;  4A49 A;  2ECN A;  1HYI A;  2YW8 A;  4LJN A;  2KIZ A;  2D8S A;  2QIZ A;  2ECJ A;  3NG2 A;  4AUQ B;  2YT5 A;  2VJE B;  2KYU A;  2LXH C;  3PUQ A;  4I7B A;  2CSY A;  4LKA A;  3RTR B;  4IC3 A;  2M6M A;  4I7D A;  2EGP A;  1FBV A;  2M85 A;  2KRE A;  5G05 B;  4AYC B;  2E6S A;  5H1U A;  2FUI A;  4FJC A;  2JMJ A;  3FL2 A;  1Z6U A;  1X4J A;  1WGM A;  2MUM A;  2LXP C;  4UP5 A;  2Y43 A;  1WES A;  2YUR A;  2CKL A;  5LKT A;  1T1H A;  5DIN A;  5KH3 A;  2L5U A;  2KWN A;  4GND A;  2LGV A;  5LCW B;  2MT5 A;  4YC9 A;  2M1R A;  4YBM A;  3C6W A;  1Z2Q A;  1VD4 A;  2VPB A;  2FSA A;  1Z60 A;  4Q6F A;  5C11 A;  5C13 A;  5FB0 A;  2I50 A;  1WFK A;  4FIP A;  1ZBD B;  4A0C D;  1U6G B;  3I2D A;  2MNY A;  4FK5 A;  3SOX A;  5B8D A;  3ZPV E;  4V3K C;  5TRB A;  3U5P A;  3M63 A;  3ZNI A;  2L0B A;  3MHS A;  1RMD A;  5B75 A;  4N4F A;  2KE1 A;  2YRE A;  3DQV R;  5B76 A;  4MVT A;  4YAD A;  3HCS A;  4WZ2 A;  2KWJ A;  5H1T A;  2LGL A;  4V3L C;  5B78 A;  3EB5 A;  4R8P K;  5D1L B;  2E6R A;  2LGG A;  4QF3 A;  5G04 B;  4WZ3 B;  5TDR A;  3KV5 A;  4CCG X;  1LDJ B;  4YBS A;  2K16 A;  4C9Z A;  3RPG C;  3O33 A;  5H1V A;  4YBT A;  5I3L A;  1LDK C;  4P5O B;  3HTK C;  4FO9 A;  5FER A;  4N3W A;  2KU3 A;  5DKA A;  5AIU A;  2MNZ A;  2OXQ C;  3GL6 A;  2EOD A;  1BOR A;  4WA6 A;  4A4C A;  3KV6 A;  4X3G A;  2RI7 A;  4YAB A;  2H0D A;  2EA6 A;  2L43 A;  2CKL B;  4R7E A;  2VJF A;  5TBN A;  1K2F A;  4L7X A;  2ECT A;  1JOC A;  2G43 A;  2LGK A;  2ECG A;  3M62 A;  2MD8 C;  3U5N A;  1WEV A;  2G45 A;  1JM7 B;  2VJE A;  2C2V S;  3N9M A;  2RSD A;  3RPG B;  5AIT A;  5D1K B;  1HYJ A;  4CA1 A;  3SOW A;  3MHH A;  3L1X A;  1VYX A;  4AYC A;  2VPE A;  5LKZ A;  1G25 A;  3LRQ A;  2KWK A;  4UP0 A;  4ZQL A;  2VP7 A;  4GB0 A;  4AVX A;  2YHO A;  2KGI A;  4LLB A;  5TDW A;  2KWO A;  3SHB A;  2JMD A;  2K4D A;  5D1M B;  2LQ6 A;  3U5M A;  3ZPV 1;  2L80 A;  2LDR A;  2YYR A;  2MIQ A;  2YHN A;  4TKP B;  3N9Q A;  4GNG A;  2KGG A;  2QJ0 A;  3HCT A;  5B77 A;  3O7A A;  3V43 A;  3T6R A;  1WEW A;  1X4U A;  1WEO A;  1N87 A;  3N9L A;  3IHP A;  3T7L A;  3N9P A;  2IDA A;  3O36 A;  1WEP A;  5LKU A;  4ZUX U;  3N9O A;  2CSZ A;  4LK9 A;  3LQJ A;  4O64 A;  4W4U A;  1WEQ A;  1XWH A;  2YUC A;  2NAA A;  3ZYQ A;  3QZV A;  3L1Z B;  5J3X A;  3N9N A;  4BBQ A;  2QIC A;  1WIM A;  4GNF A;  4ZDT A;  2ECV A;  2XEU A;  3ZTG A;  2H0D B;  5H9M A;  2VPD A;  1WEE A;  3VK6 A;  2VJF B;  3O34 A;  1E4U A;  2Y1M A;  2DX8 A;  2UZG A;  5LKX A;  3C5K A;  3DPL R;  3L11 A;  2ECW A;  1IYM A;  4L58 A;  2K17 A;  3PUR A;  2HDP A;  3O70 A;  4R2Y A;  2ECI A;  4I7C A;  3U5O A;  3LQH A;  1CHC A;  3M99 A;  3LQI A;  2G6Q A;  2BAY A;  4B7Y C;  2XB1 A;  5FB1 A;  2CT2 A;  4YAX A;  2MA5 A;  2YQL A;  1MM2 A;  4A4B A;  4YAT A;  2VNF A;  5KH9 A;  3SOU A;  2YQM A;  2VPG A;  5B79 A;  4S3O C;  4UI9 B;  2LN0 A;  4XI1 A;  1F62 A;  1V87 A;  3PHD A;  4PTB A;  4BHW A;  4PPE A;  2M3H A;  1WEU A;  4B86 C;  3EB6 A;  3HCU A;  4AP4 A;  2YU4 A;  2AN6 A;  2JMI A; 
#chains in the Genus database with same CATH topology
 5TAB A;  4IC2 A;  1JM7 A;  2F6N A;  3DDT A;  1WEN A;  1WE9 A;  2JRJ A;  2C2L A;  2LRI C;  2MD7 B;  4MSX A;  3KQI A;  2PNX A;  2YSJ A;  2D8U A;  3ASL A;  4GNE A;  3ZVZ B;  2EGM A;  5SVY A;  2MA6 A;  2K1J A;  3GV4 A;  1DVP A;  4F52 B;  2ZET C;  4WZ0 A;  4QF2 A;  1WEM A;  2YVR A;  2Y1N A;  5FEY A;  5G0F A;  3MDB C;  4S3O B;  2KFT A;  3LVQ E;  3KNV A;  2L75 A;  2F42 A;  4LAD B;  3DWD A;  2LV9 A;  1MM3 A;  2HYE D;  2PUY A;  2F6J A;  1VFY A;  1X4I A;  2KR4 A;  2FUU A;  3FAO A;  3O37 A;  5JG6 A;  3O35 A;  3KDE C;  4NN2 A;  5EYA F;  2XP0 A;  2KKY A;  1FP0 A;  4QQ4 A;  3ZVY A;  2YSM A;  1WIL A;  5KH7 A;  4A49 A;  2ECN A;  1HYI A;  2YW8 A;  2XOC A;  4LJN A;  2KIZ A;  2D8S A;  2QIZ A;  2ECJ A;  3NG2 A;  4AUQ B;  2YT5 A;  2VJE B;  2KYU A;  2LXH C;  3PUQ A;  4I7B A;  2CSY A;  4LKA A;  3FAN A;  3RTR B;  4IC3 A;  2M6M A;  4I7D A;  2EGP A;  4OGC A;  1FBV A;  2OWA A;  2M85 A;  2KRE A;  5G05 B;  4AYC B;  2E6S A;  2CRR A;  5H1U A;  3M7K A;  2FUI A;  4FJC A;  2LAU A;  2JMJ A;  3FL2 A;  1Z6U A;  3LDY A;  1X4J A;  1WGM A;  2MUM A;  3H7H A;  2IQJ A;  2LXP C;  4UP5 A;  2JUN A;  2Y43 A;  1WES A;  2YUR A;  2CKL A;  5LKT A;  1T1H A;  5DIN A;  5KH3 A;  2L5U A;  4F1P A;  2KWN A;  4GND A;  2LGV A;  2EXU A;  5LCW B;  2MT5 A;  4YC9 A;  2M1R A;  4YBM A;  3C6W A;  1Z2Q A;  1VD4 A;  2VPB A;  2FSA A;  1Z60 A;  3JUE A;  4Q6F A;  5C11 A;  5C13 A;  5FB0 A;  5SVI A;  2I50 A;  1WFK A;  4FIP A;  1ZBD B;  4A0C D;  1U6G B;  3I2D A;  2MNY A;  4FK5 A;  3SOX A;  5B8D A;  3ZPV E;  2MKE A;  4V3K C;  5TRB A;  3U5P A;  3M63 A;  3ZNI A;  2L0B A;  4H9D A;  3MHS A;  1RMD A;  5B75 A;  4N4F A;  2KE1 A;  2YRE A;  3DQV R;  5B76 A;  4Z0O A;  4MVT A;  4YAD A;  3HCS A;  4WZ2 A;  2KWJ A;  5H1T A;  2LGL A;  4V3L C;  3SUB A;  5B78 A;  3EB5 A;  4R8P K;  2FD4 A;  5D1L B;  2E6R A;  2LGG A;  4QF3 A;  5G04 B;  2CRW A;  4WZ3 B;  5TDR A;  3KV5 A;  4CCG X;  1LDJ B;  4YBS A;  3FJU B;  2K16 A;  4C9Z A;  3RPG C;  3O33 A;  2XOZ A;  5H1V A;  4YBT A;  5I3L A;  1LDK C;  4P5O B;  3HTK C;  4FO9 A;  5FER A;  4N3W A;  3Q1D A;  2KU3 A;  5DKA A;  5AIU A;  2MNZ A;  2OXQ C;  3GL6 A;  2EOD A;  1BOR A;  4WA6 A;  4A4C A;  3KV6 A;  4X3G A;  2KKX A;  2RI7 A;  4YAB A;  2L7P A;  2CSV A;  2H0D A;  2EA6 A;  2E61 A;  1MBM A;  2L43 A;  2CKL B;  4R7E A;  2VJF A;  5TBN A;  2CON A;  1K2F A;  4L7X A;  2ECT A;  1JOC A;  2G43 A;  2LGK A;  2ECG A;  3M62 A;  2MD8 C;  3U5N A;  1WEV A;  2G45 A;  5K3Q A;  1JM7 B;  2VJE A;  2C2V S;  3N9M A;  2RSD A;  3RPG B;  5AIT A;  5D1K B;  1HYJ A;  4CA1 A;  3SOW A;  3MHH A;  3L1X A;  1VYX A;  4AYC A;  2VPE A;  5LKZ A;  1G25 A;  3LRQ A;  3FEH A;  2KWK A;  4UP0 A;  2DSM A;  4ZQL A;  3O47 A;  2VP7 A;  4GB0 A;  4AVX A;  2YHO A;  2KGI A;  4LLB A;  5TDW A;  2KWO A;  3SHB A;  2JMD A;  2M13 A;  2K4D A;  5D1M B;  2LQ6 A;  3U5M A;  3ZPV 1;  2L80 A;  2LDR A;  3PLW A;  2YYR A;  2MIQ A;  2YHN A;  3E2D A;  4TKP B;  3N9Q A;  4GNG A;  2KGG A;  2QJ0 A;  3HCT A;  2XOY A;  5B77 A;  3O7A A;  3V43 A;  3T6R A;  1WEW A;  1X4U A;  1WEO A;  1N87 A;  3N9L A;  1DCQ A;  3IHP A;  4Z0R A;  3T7L A;  3N9P A;  2IDA A;  3O36 A;  5SVX A;  1WEP A;  5LKU A;  4ZUX U;  3N9O A;  2CSZ A;  4LK9 A;  3LQJ A;  4O64 A;  3LVR E;  4W4U A;  1WEQ A;  1XWH A;  2YUC A;  2NAA A;  3ZYQ A;  3QZV A;  3L1Z B;  5J3X A;  3N9N A;  4BBQ A;  2QIC A;  1WIM A;  4GNF A;  4ZDT A;  2ECV A;  2XEU A;  3ZTG A;  2H0D B;  5H9M A;  2DJA A;  3LJU X;  2VPD A;  1WEE A;  3VK6 A;  2VJF B;  3O34 A;  1E4U A;  2Y1M A;  2DX8 A;  2UZG A;  5LKX A;  3C5K A;  3DPL R;  3FM8 C;  3L11 A;  2ECW A;  1IYM A;  4L58 A;  2B0O E;  2K17 A;  3PUR A;  2HDP A;  3O70 A;  4R2Y A;  2ECI A;  2FFW A;  4I7C A;  3U5O A;  3LQH A;  1CHC A;  3M99 A;  3LQI A;  2G6Q A;  2BAY A;  4B7Y C;  2XB1 A;  5FB1 A;  2RR4 A;  2CT2 A;  4YAX A;  2MA5 A;  2YQL A;  1MM2 A;  4A4B A;  4O62 A;  4YAT A;  2VNF A;  5KH9 A;  3SOU A;  2YQM A;  3T9K A;  2VPG A;  5B79 A;  4S3O C;  4UI9 B;  5SVI B;  4OGE A;  2LN0 A;  4XI1 A;  1F62 A;  1V87 A;  3PHD A;  4PTB A;  4BHW A;  4PPE A;  2M3H A;  1WEU A;  4B86 C;  3EB6 A;  3HCU A;  4AP4 A;  2YU4 A;  2AN6 A;  2JMI A;  2P57 A;  2JM3 A; 
#chains in the Genus database with same CATH homology
 5TAB A;  4IC2 A;  1JM7 A;  2F6N A;  1WEN A;  1WE9 A;  2JRJ A;  2C2L A;  2LRI C;  2MD7 B;  4MSX A;  3KQI A;  2PNX A;  2YSJ A;  3ASL A;  4GNE A;  3ZVZ B;  2MA6 A;  2K1J A;  3GV4 A;  1DVP A;  4F52 B;  2ZET C;  4WZ0 A;  4QF2 A;  1WEM A;  2Y1N A;  5FEY A;  5G0F A;  4S3O B;  2KFT A;  3KNV A;  2L75 A;  2F42 A;  4LAD B;  2LV9 A;  1MM3 A;  2HYE D;  2PUY A;  2F6J A;  1VFY A;  1X4I A;  2KR4 A;  2FUU A;  3O37 A;  5JG6 A;  3O35 A;  4NN2 A;  5EYA F;  1FP0 A;  3ZVY A;  2YSM A;  1WIL A;  5KH7 A;  4A49 A;  2ECN A;  1HYI A;  2YW8 A;  4LJN A;  2KIZ A;  2D8S A;  2QIZ A;  2ECJ A;  3NG2 A;  4AUQ B;  2YT5 A;  2VJE B;  2KYU A;  2LXH C;  3PUQ A;  4I7B A;  2CSY A;  4LKA A;  3RTR B;  4IC3 A;  2M6M A;  4I7D A;  2EGP A;  1FBV A;  2M85 A;  2KRE A;  5G05 B;  4AYC B;  2E6S A;  5H1U A;  2FUI A;  4FJC A;  2JMJ A;  3FL2 A;  1Z6U A;  1X4J A;  1WGM A;  2MUM A;  2LXP C;  4UP5 A;  2Y43 A;  1WES A;  2YUR A;  2CKL A;  5LKT A;  1T1H A;  5DIN A;  5KH3 A;  2L5U A;  2KWN A;  4GND A;  2LGV A;  5LCW B;  2MT5 A;  4YC9 A;  2M1R A;  4YBM A;  3C6W A;  1Z2Q A;  1VD4 A;  2VPB A;  2FSA A;  1Z60 A;  4Q6F A;  5C11 A;  5C13 A;  5FB0 A;  2I50 A;  1WFK A;  4FIP A;  1ZBD B;  4A0C D;  1U6G B;  3I2D A;  2MNY A;  4FK5 A;  3SOX A;  5B8D A;  3ZPV E;  4V3K C;  5TRB A;  3U5P A;  3M63 A;  3ZNI A;  2L0B A;  3MHS A;  1RMD A;  5B75 A;  4N4F A;  2KE1 A;  2YRE A;  3DQV R;  5B76 A;  4MVT A;  4YAD A;  3HCS A;  4WZ2 A;  2KWJ A;  5H1T A;  2LGL A;  4V3L C;  5B78 A;  3EB5 A;  4R8P K;  5D1L B;  2E6R A;  2LGG A;  4QF3 A;  5G04 B;  4WZ3 B;  5TDR A;  3KV5 A;  4CCG X;  1LDJ B;  4YBS A;  2K16 A;  4C9Z A;  3RPG C;  3O33 A;  5H1V A;  4YBT A;  5I3L A;  1LDK C;  4P5O B;  3HTK C;  4FO9 A;  5FER A;  4N3W A;  2KU3 A;  5DKA A;  5AIU A;  2MNZ A;  2OXQ C;  3GL6 A;  2EOD A;  1BOR A;  4WA6 A;  4A4C A;  3KV6 A;  4X3G A;  2RI7 A;  4YAB A;  2H0D A;  2EA6 A;  2L43 A;  2CKL B;  4R7E A;  2VJF A;  5TBN A;  1K2F A;  4L7X A;  2ECT A;  1JOC A;  2G43 A;  2LGK A;  2ECG A;  3M62 A;  2MD8 C;  3U5N A;  1WEV A;  2G45 A;  1JM7 B;  2VJE A;  2C2V S;  3N9M A;  2RSD A;  3RPG B;  5AIT A;  5D1K B;  1HYJ A;  4CA1 A;  3SOW A;  3MHH A;  3L1X A;  1VYX A;  4AYC A;  2VPE A;  5LKZ A;  1G25 A;  3LRQ A;  2KWK A;  4UP0 A;  4ZQL A;  2VP7 A;  4GB0 A;  4AVX A;  2YHO A;  2KGI A;  4LLB A;  5TDW A;  2KWO A;  3SHB A;  2JMD A;  2K4D A;  5D1M B;  2LQ6 A;  3U5M A;  3ZPV 1;  2L80 A;  2LDR A;  2YYR A;  2MIQ A;  2YHN A;  4TKP B;  3N9Q A;  4GNG A;  2KGG A;  2QJ0 A;  3HCT A;  5B77 A;  3O7A A;  3V43 A;  3T6R A;  1WEW A;  1X4U A;  1WEO A;  1N87 A;  3N9L A;  3IHP A;  3T7L A;  3N9P A;  2IDA A;  3O36 A;  1WEP A;  5LKU A;  4ZUX U;  3N9O A;  2CSZ A;  4LK9 A;  3LQJ A;  4O64 A;  4W4U A;  1WEQ A;  1XWH A;  2YUC A;  2NAA A;  3ZYQ A;  3QZV A;  3L1Z B;  5J3X A;  3N9N A;  4BBQ A;  2QIC A;  1WIM A;  4GNF A;  4ZDT A;  2ECV A;  2XEU A;  3ZTG A;  2H0D B;  5H9M A;  2VPD A;  1WEE A;  3VK6 A;  2VJF B;  3O34 A;  1E4U A;  2Y1M A;  2DX8 A;  2UZG A;  5LKX A;  3C5K A;  3DPL R;  3L11 A;  2ECW A;  1IYM A;  4L58 A;  2K17 A;  3PUR A;  2HDP A;  3O70 A;  4R2Y A;  2ECI A;  4I7C A;  3U5O A;  3LQH A;  1CHC A;  3M99 A;  3LQI A;  2G6Q A;  2BAY A;  4B7Y C;  2XB1 A;  5FB1 A;  2CT2 A;  4YAX A;  2MA5 A;  2YQL A;  1MM2 A;  4A4B A;  4YAT A;  2VNF A;  5KH9 A;  3SOU A;  2YQM A;  2VPG A;  5B79 A;  4S3O C;  4UI9 B;  2LN0 A;  4XI1 A;  1F62 A;  1V87 A;  3PHD A;  4PTB A;  4BHW A;  4PPE A;  2M3H A;  1WEU A;  4B86 C;  3EB6 A;  3HCU A;  4AP4 A;  2YU4 A;  2AN6 A;  2JMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...