4GNGA

Crystal structure of nsd3 tandem phd5-c5hch domains complexed with h3k9me3 peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/nuclear protein
molecule keywords Histone-lysine N-methyltransferase NSD3
publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 95
sequence length 95
chains with identical sequence D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gngA00
3MHSA 2M85A 5G05B 3SOXA 5KH3A 1X4UA 3QZVA 2YUCA 1CHCA 2LQ6A 4FJCA 2KWNA 4YC9A 2JRJA 5G04B 2LN0A 4P5OB 2ECJA 5LKZA 1LDKC 2F42A 3O36A 2CKLB 2OXQC 4IC3A 2AN6A 2QJ0A 1WENA 4A49A 5H1UA 5KH9A 1XWHA 4R8PK 4GNFA 4IC2A 5B8DA 3ASLA 3SHBA 5TABA 2KGGA 2VJFA 3KV6A 4FK5A 4GB0A 1MM3A 2G45A 2NAAA 2ECVA 1WEVA 3L11A 2CT2A 5FB1A 1HYIA 3L1XA 5B79A 3GV4A 5AIUA 1DVPA 5D1KB 2L80A 1K2FA 5AITA 1X4IA 5C11A 2KE1A 3ZPV1 1IYMA 5D1MB 4I7DA 3ZNIA 2C2VS 2UZGA 4A0CD 3O7AA 1HYJA 2L0BA 2KWJA 3SOUA 3M63A 2KREA 4BBQA 2MD7B 4PPEA 4B7YC 2VPEA 4AUQB 4C9ZA 4L58A 4B86C 2YURA 2MT5A 3DPLR 2L5UA 2EGPA 3L1ZB 3GL6A 1JM7B 4BHWA 2KGIA 2MNZA 2MUMA 3I2DA 3HTKC 2C2LA 5TBNA 5B78A 3LQJA 3ZTGA 3KNVA 3C5KA 1WEWA 3LQIA 5LKUA 3HCTA 2H0DA 4AYCA 3N9MA 2VPBA 5TDRA 2M3HA 4PTBA 1WGMA 2VPGA 3N9OA 3FL2A 3M62A 2KFTA 4I7BA 4LKAA 2ECGA 2LGLA 4GNDA 4FO9A 3N9QA 4AP4A 2MD8C 1VYXA 2YYRA 5H9MA 2CSZA 2VP7A 3T6RA 2K17A 2M6MA 2F6JA 4QF3A 3MHHA 5DINA 1X4JA 2L43A 4LLBA 3HCUA 4FIPA 3SOWA 1Z60A 3PURA 2FSAA 2FUIA 2K16A 1MM2A 3T7LA 2XB1A 3O34A 4WZ3B 5H1VA 4GNEA 2ZETC 4S3OC 4N3WA 4GNGA 2E6SA 2VJEA 3RTRB 5KH7A 3DQVR 3C6WA 2KWKA 2VNFA 3ZPVE 2KIZA 2D8SA 4YBTA 1RMDA 2E6RA 2ECIA 4NN2A 4S3OB 5LKTA 1G25A 1BORA 2VJFB 5G0FA 2BAYA 4MSXA 3U5OA 4WZ2A 2Y1NA 3O37A 4I7CA 2PNXA 2IDAA 1WFKA 3NG2A 5LKXA 4YATA 5TDWA 3ZYQA 1ZBDB 1WIMA 2HDPA 4CCGX 2DX8A 5D1LB 2PUYA 4LJNA 2QICA 2ECTA 5C13A 1WEUA 2F6NA 2EODA 1WEEA 2G6QA 4AVXA 3HCSA 2KR4A 2LGGA 2YU4A 2EA6A 2CKLA 4YABA 4UP0A 4A4BA 3U5NA 4Q6FA 2ECWA 2YQLA 1WILA 4A4CA 4MVTA 2YW8A 3KQIA 2FUUA 2MIQA 1WEMA 2MA5A 3IHPA 2Y1MA 2LGVA 4R2YA 2K4DA 4TKPB 1FP0A 2MNYA 1Z6UA 3N9LA 1N87A 4WA6A 2XEUA 3ZVZB 4YAXA 2H0DB 4AYCB 2VPDA 4YBMA 3O33A 1FBVA 4O64A 2LV9A 5J3XA 4ZUXU 2I50A 1V87A 3EB5A 3PUQA 3EB6A 4YADA 5TRBA 1LDJB 2RI7A 1WE9A 2KYUA 5FB0A 1WEQA 2K1JA 4YBSA 5I3LA 4V3KC 4XI1A 2LXPC 2JMIA 3RPGC 2HYED 4LADB 5EYAF 5DKAA 1F62A 2LGKA 3LQHA 1T1HA 2MA6A 4ZDTA 1JM7A 5B77A 3O70A 3O35A 2KWOA 5H1TA 5LCWB 3N9NA 4QF2A 4LK9A 2LRIC 3N9PA 4ZQLA 3RPGB 1WEPA 3LRQA 2KU3A 2VJEB 4L7XA 4UP5A 2YSMA 2JMJA 3V43A 5B75A 4R7EA 4F52B 2Y43A 1Z2QA 2LXHC 5JG6A 2L75A 4UI9B 5FERA 2CSYA 4X3GA 1WESA 3KV5A 3ZVYA 2ECNA 2QIZA 3M99A 1U6GB 2RSDA 2YREA 3VK6A 1E4UA 1JOCA 4W4UA 2YHOA 5B76A 3U5MA 2YSJA 1WEOA 3PHDA 2M1RA 2LDRA 2G43A 2YHNA 1VFYA 5FEYA 2YQMA 2JMDA 1VD4A 2YT5A 4V3LC 3U5PA 4N4FA 4WZ0A 4CA1A
chains in the Genus database with same CATH superfamily
3MHSA 2M85A 5G05B 3SOXA 5KH3A 1X4UA 3QZVA 2YUCA 1CHCA 2LQ6A 4FJCA 2KWNA 4YC9A 2JRJA 2EGMA 5G04B 2LN0A 4P5OB 2ECJA 5LKZA 1LDKC 2F42A 3O36A 2CKLB 2OXQC 4IC3A 2AN6A 2QJ0A 5SVIA 1WENA 4A49A 5H1UA 2XOCA 5KH9A 1XWHA 4R8PK 4GNFA 4IC2A 5B8DA 3DDTA 3ASLA 3SHBA 5TABA 2KGGA 2VJFA 3KV6A 4FK5A 4GB0A 1MM3A 2G45A 3KDEC 2NAAA 2ECVA 1WEVA 3L11A 2CT2A 5FB1A 1HYIA 3L1XA 5B79A 3GV4A 5AIUA 1DVPA 5D1KB 2L80A 1K2FA 5AITA 1X4IA 5C11A 4OGEA 2KE1A 3Q1DA 3ZPV1 1IYMA 5D1MB 2KKYA 4I7DA 3ZNIA 2C2VS 2UZGA 4A0CD 3O7AA 1HYJA 2L0BA 2KWJA 3SOUA 3M63A 3LVRE 2KREA 3FANA 4BBQA 2MD7B 4PPEA 4B7YC 2VPEA 4AUQB 4C9ZA 4L58A 4B86C 2YURA 2MT5A 2RR4A 3DPLR 2L5UA 2EGPA 3L1ZB 3GL6A 2XOYA 1JM7B 4BHWA 2KGIA 3FAOA 2MNZA 2MUMA 3I2DA 2IQJA 3HTKC 2C2LA 5TBNA 5B78A 3LQJA 3ZTGA 2OWAA 3KNVA 3C5KA 1WEWA 3LQIA 5LKUA 3HCTA 2H0DA 4AYCA 3N9MA 2VPBA 5TDRA 2M3HA 5K3QA 4PTBA 1WGMA 2VPGA 3N9OA 3FL2A 3M62A 2KFTA 4I7BA 4LKAA 2ECGA 2LGLA 4GNDA 3LDYA 3LJUX 4FO9A 3SUBA 3M7KA 1DCQA 3N9QA 4AP4A 2MD8C 1VYXA 2KKXA 3DWDA 2YYRA 5H9MA 2CSZA 2VP7A 3T6RA 2K17A 2M6MA 2F6JA 4QF3A 2YVRA 3MHHA 4O62A 5DINA 1X4JA 2L43A 1MBMA 4LLBA 2LAUA 3HCUA 4FIPA 3SOWA 4F1PA 1Z60A 3PURA 2FSAA 2FUIA 2JM3A 2B0OE 2K16A 1MM2A 3T7LA 2XB1A 3O34A 4WZ3B 4Z0RA 5SVXA 5H1VA 4GNEA 2ZETC 4S3OC 4N3WA 4GNGA 2E6SA 2VJEA 5SVIB 3RTRB 5KH7A 3DQVR 3C6WA 2KWKA 2VNFA 3ZPVE 2KIZA 2D8SA 4YBTA 1RMDA 2E6RA 2ECIA 4NN2A 4S3OB 5LKTA 1G25A 1BORA 2VJFB 5G0FA 2BAYA 4MSXA 3U5OA 4WZ2A 3JUEA 2Y1NA 3O37A 4I7CA 2PNXA 2IDAA 3FEHA 3E2DA 1WFKA 3NG2A 5LKXA 2E61A 4YATA 5TDWA 3ZYQA 1ZBDB 1WIMA 2HDPA 4CCGX 2DX8A 5D1LB 3FM8C 2PUYA 4LJNA 2QICA 2ECTA 2JUNA 5C13A 1WEUA 2F6NA 2EODA 1WEEA 2G6QA 4AVXA 3HCSA 2KR4A 2LGGA 2YU4A 2CONA 2EA6A 2CKLA 4YABA 2CRRA 4UP0A 4A4BA 3U5NA 4Q6FA 3H7HA 3PLWA 2ECWA 2YQLA 1WILA 4A4CA 4MVTA 2YW8A 3KQIA 2FUUA 2XOZA 3T9KA 3O47A 2MIQA 1WEMA 4QQ4A 2MA5A 3IHPA 2Y1MA 2FD4A 2LGVA 4R2YA 2K4DA 4TKPB 1FP0A 2MNYA 1Z6UA 3FJUB 2CRWA 3N9LA 1N87A 4WA6A 2XEUA 3ZVZB 4YAXA 2H0DB 4AYCB 2VPDA 4YBMA 3O33A 1FBVA 4O64A 2LV9A 5J3XA 2DJAA 4Z0OA 4ZUXU 2I50A 1V87A 2EXUA 3EB5A 3PUQA 2FFWA 4OGCA 3EB6A 4YADA 4H9DA 5TRBA 1LDJB 2RI7A 1WE9A 2KYUA 2P57A 5FB0A 1WEQA 2K1JA 4YBSA 2L7PA 5I3LA 4V3KC 4XI1A 2LXPC 2DSMA 2JMIA 3RPGC 2HYED 4LADB 5EYAF 5DKAA 1F62A 2LGKA 3LQHA 1T1HA 2MA6A 4ZDTA 2MKEA 1JM7A 5B77A 3O70A 3O35A 2KWOA 5H1TA 5LCWB 3N9NA 4QF2A 4LK9A 2LRIC 3N9PA 4ZQLA 3RPGB 1WEPA 3LRQA 2KU3A 2VJEB 4L7XA 4UP5A 2YSMA 2JMJA 3V43A 5B75A 4R7EA 4F52B 2Y43A 1Z2QA 2LXHC 5JG6A 2L75A 4UI9B 5FERA 2CSYA 4X3GA 2D8UA 1WESA 3KV5A 3ZVYA 2ECNA 2QIZA 3M99A 3MDBC 1U6GB 2RSDA 3LVQE 2YREA 5SVYA 3VK6A 2CSVA 1E4UA 1JOCA 4W4UA 2YHOA 5B76A 3U5MA 2M13A 2YSJA 1WEOA 3PHDA 2M1RA 2LDRA 2G43A 2YHNA 2XP0A 1VFYA 5FEYA 2YQMA 2JMDA 1VD4A 2YT5A 4V3LC 3U5PA 4N4FA 4WZ0A 4CA1A
chains in the Genus database with same CATH topology
3MHSA 2M85A 5G05B 3SOXA 5KH3A 1X4UA 3QZVA 2YUCA 1CHCA 2LQ6A 4FJCA 2KWNA 4YC9A 2JRJA 5G04B 2LN0A 4P5OB 2ECJA 5LKZA 1LDKC 2F42A 3O36A 2CKLB 2OXQC 4IC3A 2AN6A 2QJ0A 1WENA 4A49A 5H1UA 5KH9A 1XWHA 4R8PK 4GNFA 4IC2A 5B8DA 3ASLA 3SHBA 5TABA 2KGGA 2VJFA 3KV6A 4FK5A 4GB0A 1MM3A 2G45A 2NAAA 2ECVA 1WEVA 3L11A 2CT2A 5FB1A 1HYIA 3L1XA 5B79A 3GV4A 5AIUA 1DVPA 5D1KB 2L80A 1K2FA 5AITA 1X4IA 5C11A 2KE1A 3ZPV1 1IYMA 5D1MB 4I7DA 3ZNIA 2C2VS 2UZGA 4A0CD 3O7AA 1HYJA 2L0BA 2KWJA 3SOUA 3M63A 2KREA 4BBQA 2MD7B 4PPEA 4B7YC 2VPEA 4AUQB 4C9ZA 4L58A 4B86C 2YURA 2MT5A 3DPLR 2L5UA 2EGPA 3L1ZB 3GL6A 1JM7B 4BHWA 2KGIA 2MNZA 2MUMA 3I2DA 3HTKC 2C2LA 5TBNA 5B78A 3LQJA 3ZTGA 3KNVA 3C5KA 1WEWA 3LQIA 5LKUA 3HCTA 2H0DA 4AYCA 3N9MA 2VPBA 5TDRA 2M3HA 4PTBA 1WGMA 2VPGA 3N9OA 3FL2A 3M62A 2KFTA 4I7BA 4LKAA 2ECGA 2LGLA 4GNDA 4FO9A 3N9QA 4AP4A 2MD8C 1VYXA 2YYRA 5H9MA 2CSZA 2VP7A 3T6RA 2K17A 2M6MA 2F6JA 4QF3A 3MHHA 5DINA 1X4JA 2L43A 4LLBA 3HCUA 4FIPA 3SOWA 1Z60A 3PURA 2FSAA 2FUIA 2K16A 1MM2A 3T7LA 2XB1A 3O34A 4WZ3B 5H1VA 4GNEA 2ZETC 4S3OC 4N3WA 4GNGA 2E6SA 2VJEA 3RTRB 5KH7A 3DQVR 3C6WA 2KWKA 2VNFA 3ZPVE 2KIZA 2D8SA 4YBTA 1RMDA 2E6RA 2ECIA 4NN2A 4S3OB 5LKTA 1G25A 1BORA 2VJFB 5G0FA 2BAYA 4MSXA 3U5OA 4WZ2A 2Y1NA 3O37A 4I7CA 2PNXA 2IDAA 1WFKA 3NG2A 5LKXA 4YATA 5TDWA 3ZYQA 1ZBDB 1WIMA 2HDPA 4CCGX 2DX8A 5D1LB 2PUYA 4LJNA 2QICA 2ECTA 5C13A 1WEUA 2F6NA 2EODA 1WEEA 2G6QA 4AVXA 3HCSA 2KR4A 2LGGA 2YU4A 2EA6A 2CKLA 4YABA 4UP0A 4A4BA 3U5NA 4Q6FA 2ECWA 2YQLA 1WILA 4A4CA 4MVTA 2YW8A 3KQIA 2FUUA 2MIQA 1WEMA 2MA5A 3IHPA 2Y1MA 2LGVA 4R2YA 2K4DA 4TKPB 1FP0A 2MNYA 1Z6UA 3N9LA 1N87A 4WA6A 2XEUA 3ZVZB 4YAXA 2H0DB 4AYCB 2VPDA 4YBMA 3O33A 1FBVA 4O64A 2LV9A 5J3XA 4ZUXU 2I50A 1V87A 3EB5A 3PUQA 3EB6A 4YADA 5TRBA 1LDJB 2RI7A 1WE9A 2KYUA 5FB0A 1WEQA 2K1JA 4YBSA 5I3LA 4V3KC 4XI1A 2LXPC 2JMIA 3RPGC 2HYED 4LADB 5EYAF 5DKAA 1F62A 2LGKA 3LQHA 1T1HA 2MA6A 4ZDTA 1JM7A 5B77A 3O70A 3O35A 2KWOA 5H1TA 5LCWB 3N9NA 4QF2A 4LK9A 2LRIC 3N9PA 4ZQLA 3RPGB 1WEPA 3LRQA 2KU3A 2VJEB 4L7XA 4UP5A 2YSMA 2JMJA 3V43A 5B75A 4R7EA 4F52B 2Y43A 1Z2QA 2LXHC 5JG6A 2L75A 4UI9B 5FERA 2CSYA 4X3GA 1WESA 3KV5A 3ZVYA 2ECNA 2QIZA 3M99A 1U6GB 2RSDA 2YREA 3VK6A 1E4UA 1JOCA 4W4UA 2YHOA 5B76A 3U5MA 2YSJA 1WEOA 3PHDA 2M1RA 2LDRA 2G43A 2YHNA 1VFYA 5FEYA 2YQMA 2JMDA 1VD4A 2YT5A 4V3LC 3U5PA 4N4FA 4WZ0A 4CA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS A;  2M85 A;  5G05 B;  3SOX A;  5KH3 A;  1X4U A;  3QZV A;  2YUC A;  1CHC A;  2LQ6 A;  4FJC A;  2KWN A;  4YC9 A;  2JRJ A;  5G04 B;  2LN0 A;  4P5O B;  2ECJ A;  5LKZ A;  1LDK C;  2F42 A;  3O36 A;  2CKL B;  2OXQ C;  4IC3 A;  2AN6 A;  2QJ0 A;  1WEN A;  4A49 A;  5H1U A;  5KH9 A;  1XWH A;  4R8P K;  4GNF A;  4IC2 A;  5B8D A;  3ASL A;  3SHB A;  5TAB A;  2KGG A;  2VJF A;  3KV6 A;  4FK5 A;  4GB0 A;  1MM3 A;  2G45 A;  2NAA A;  2ECV A;  1WEV A;  3L11 A;  2CT2 A;  5FB1 A;  1HYI A;  3L1X A;  5B79 A;  3GV4 A;  5AIU A;  1DVP A;  5D1K B;  2L80 A;  1K2F A;  5AIT A;  1X4I A;  5C11 A;  2KE1 A;  3ZPV 1;  1IYM A;  5D1M B;  4I7D A;  3ZNI A;  2C2V S;  2UZG A;  4A0C D;  3O7A A;  1HYJ A;  2L0B A;  2KWJ A;  3SOU A;  3M63 A;  2KRE A;  4BBQ A;  2MD7 B;  4PPE A;  4B7Y C;  2VPE A;  4AUQ B;  4C9Z A;  4L58 A;  4B86 C;  2YUR A;  2MT5 A;  3DPL R;  2L5U A;  2EGP A;  3L1Z B;  3GL6 A;  1JM7 B;  4BHW A;  2KGI A;  2MNZ A;  2MUM A;  3I2D A;  3HTK C;  2C2L A;  5TBN A;  5B78 A;  3LQJ A;  3ZTG A;  3KNV A;  3C5K A;  1WEW A;  3LQI A;  5LKU A;  3HCT A;  2H0D A;  4AYC A;  3N9M A;  2VPB A;  5TDR A;  2M3H A;  4PTB A;  1WGM A;  2VPG A;  3N9O A;  3FL2 A;  3M62 A;  2KFT A;  4I7B A;  4LKA A;  2ECG A;  2LGL A;  4GND A;  4FO9 A;  3N9Q A;  4AP4 A;  2MD8 C;  1VYX A;  2YYR A;  5H9M A;  2CSZ A;  2VP7 A;  3T6R A;  2K17 A;  2M6M A;  2F6J A;  4QF3 A;  3MHH A;  5DIN A;  1X4J A;  2L43 A;  4LLB A;  3HCU A;  4FIP A;  3SOW A;  1Z60 A;  3PUR A;  2FSA A;  2FUI A;  2K16 A;  1MM2 A;  3T7L A;  2XB1 A;  3O34 A;  4WZ3 B;  5H1V A;  4GNE A;  2ZET C;  4S3O C;  4N3W A;  4GNG A;  2E6S A;  2VJE A;  3RTR B;  5KH7 A;  3DQV R;  3C6W A;  2KWK A;  2VNF A;  3ZPV E;  2KIZ A;  2D8S A;  4YBT A;  1RMD A;  2E6R A;  2ECI A;  4NN2 A;  4S3O B;  5LKT A;  1G25 A;  1BOR A;  2VJF B;  5G0F A;  2BAY A;  4MSX A;  3U5O A;  4WZ2 A;  2Y1N A;  3O37 A;  4I7C A;  2PNX A;  2IDA A;  1WFK A;  3NG2 A;  5LKX A;  4YAT A;  5TDW A;  3ZYQ A;  1ZBD B;  1WIM A;  2HDP A;  4CCG X;  2DX8 A;  5D1L B;  2PUY A;  4LJN A;  2QIC A;  2ECT A;  5C13 A;  1WEU A;  2F6N A;  2EOD A;  1WEE A;  2G6Q A;  4AVX A;  3HCS A;  2KR4 A;  2LGG A;  2YU4 A;  2EA6 A;  2CKL A;  4YAB A;  4UP0 A;  4A4B A;  3U5N A;  4Q6F A;  2ECW A;  2YQL A;  1WIL A;  4A4C A;  4MVT A;  2YW8 A;  3KQI A;  2FUU A;  2MIQ A;  1WEM A;  2MA5 A;  3IHP A;  2Y1M A;  2LGV A;  4R2Y A;  2K4D A;  4TKP B;  1FP0 A;  2MNY A;  1Z6U A;  3N9L A;  1N87 A;  4WA6 A;  2XEU A;  3ZVZ B;  4YAX A;  2H0D B;  4AYC B;  2VPD A;  4YBM A;  3O33 A;  1FBV A;  4O64 A;  2LV9 A;  5J3X A;  4ZUX U;  2I50 A;  1V87 A;  3EB5 A;  3PUQ A;  3EB6 A;  4YAD A;  5TRB A;  1LDJ B;  2RI7 A;  1WE9 A;  2KYU A;  5FB0 A;  1WEQ A;  2K1J A;  4YBS A;  5I3L A;  4V3K C;  4XI1 A;  2LXP C;  2JMI A;  3RPG C;  2HYE D;  4LAD B;  5EYA F;  5DKA A;  1F62 A;  2LGK A;  3LQH A;  1T1H A;  2MA6 A;  4ZDT A;  1JM7 A;  5B77 A;  3O70 A;  3O35 A;  2KWO A;  5H1T A;  5LCW B;  3N9N A;  4QF2 A;  4LK9 A;  2LRI C;  3N9P A;  4ZQL A;  3RPG B;  1WEP A;  3LRQ A;  2KU3 A;  2VJE B;  4L7X A;  4UP5 A;  2YSM A;  2JMJ A;  3V43 A;  5B75 A;  4R7E A;  4F52 B;  2Y43 A;  1Z2Q A;  2LXH C;  5JG6 A;  2L75 A;  4UI9 B;  5FER A;  2CSY A;  4X3G A;  1WES A;  3KV5 A;  3ZVY A;  2ECN A;  2QIZ A;  3M99 A;  1U6G B;  2RSD A;  2YRE A;  3VK6 A;  1E4U A;  1JOC A;  4W4U A;  2YHO A;  5B76 A;  3U5M A;  2YSJ A;  1WEO A;  3PHD A;  2M1R A;  2LDR A;  2G43 A;  2YHN A;  1VFY A;  5FEY A;  2YQM A;  2JMD A;  1VD4 A;  2YT5 A;  4V3L C;  3U5P A;  4N4F A;  4WZ0 A;  4CA1 A; 
#chains in the Genus database with same CATH topology
 3MHS A;  2M85 A;  5G05 B;  3SOX A;  5KH3 A;  1X4U A;  3QZV A;  2YUC A;  1CHC A;  2LQ6 A;  4FJC A;  2KWN A;  4YC9 A;  2JRJ A;  2EGM A;  5G04 B;  2LN0 A;  4P5O B;  2ECJ A;  5LKZ A;  1LDK C;  2F42 A;  3O36 A;  2CKL B;  2OXQ C;  4IC3 A;  2AN6 A;  2QJ0 A;  5SVI A;  1WEN A;  4A49 A;  5H1U A;  2XOC A;  5KH9 A;  1XWH A;  4R8P K;  4GNF A;  4IC2 A;  5B8D A;  3DDT A;  3ASL A;  3SHB A;  5TAB A;  2KGG A;  2VJF A;  3KV6 A;  4FK5 A;  4GB0 A;  1MM3 A;  2G45 A;  3KDE C;  2NAA A;  2ECV A;  1WEV A;  3L11 A;  2CT2 A;  5FB1 A;  1HYI A;  3L1X A;  5B79 A;  3GV4 A;  5AIU A;  1DVP A;  5D1K B;  2L80 A;  1K2F A;  5AIT A;  1X4I A;  5C11 A;  4OGE A;  2KE1 A;  3Q1D A;  3ZPV 1;  1IYM A;  5D1M B;  2KKY A;  4I7D A;  3ZNI A;  2C2V S;  2UZG A;  4A0C D;  3O7A A;  1HYJ A;  2L0B A;  2KWJ A;  3SOU A;  3M63 A;  3LVR E;  2KRE A;  3FAN A;  4BBQ A;  2MD7 B;  4PPE A;  4B7Y C;  2VPE A;  4AUQ B;  4C9Z A;  4L58 A;  4B86 C;  2YUR A;  2MT5 A;  2RR4 A;  3DPL R;  2L5U A;  2EGP A;  3L1Z B;  3GL6 A;  2XOY A;  1JM7 B;  4BHW A;  2KGI A;  3FAO A;  2MNZ A;  2MUM A;  3I2D A;  2IQJ A;  3HTK C;  2C2L A;  5TBN A;  5B78 A;  3LQJ A;  3ZTG A;  2OWA A;  3KNV A;  3C5K A;  1WEW A;  3LQI A;  5LKU A;  3HCT A;  2H0D A;  4AYC A;  3N9M A;  2VPB A;  5TDR A;  2M3H A;  5K3Q A;  4PTB A;  1WGM A;  2VPG A;  3N9O A;  3FL2 A;  3M62 A;  2KFT A;  4I7B A;  4LKA A;  2ECG A;  2LGL A;  4GND A;  3LDY A;  3LJU X;  4FO9 A;  3SUB A;  3M7K A;  1DCQ A;  3N9Q A;  4AP4 A;  2MD8 C;  1VYX A;  2KKX A;  3DWD A;  2YYR A;  5H9M A;  2CSZ A;  2VP7 A;  3T6R A;  2K17 A;  2M6M A;  2F6J A;  4QF3 A;  2YVR A;  3MHH A;  4O62 A;  5DIN A;  1X4J A;  2L43 A;  1MBM A;  4LLB A;  2LAU A;  3HCU A;  4FIP A;  3SOW A;  4F1P A;  1Z60 A;  3PUR A;  2FSA A;  2FUI A;  2JM3 A;  2B0O E;  2K16 A;  1MM2 A;  3T7L A;  2XB1 A;  3O34 A;  4WZ3 B;  4Z0R A;  5SVX A;  5H1V A;  4GNE A;  2ZET C;  4S3O C;  4N3W A;  4GNG A;  2E6S A;  2VJE A;  5SVI B;  3RTR B;  5KH7 A;  3DQV R;  3C6W A;  2KWK A;  2VNF A;  3ZPV E;  2KIZ A;  2D8S A;  4YBT A;  1RMD A;  2E6R A;  2ECI A;  4NN2 A;  4S3O B;  5LKT A;  1G25 A;  1BOR A;  2VJF B;  5G0F A;  2BAY A;  4MSX A;  3U5O A;  4WZ2 A;  3JUE A;  2Y1N A;  3O37 A;  4I7C A;  2PNX A;  2IDA A;  3FEH A;  3E2D A;  1WFK A;  3NG2 A;  5LKX A;  2E61 A;  4YAT A;  5TDW A;  3ZYQ A;  1ZBD B;  1WIM A;  2HDP A;  4CCG X;  2DX8 A;  5D1L B;  3FM8 C;  2PUY A;  4LJN A;  2QIC A;  2ECT A;  2JUN A;  5C13 A;  1WEU A;  2F6N A;  2EOD A;  1WEE A;  2G6Q A;  4AVX A;  3HCS A;  2KR4 A;  2LGG A;  2YU4 A;  2CON A;  2EA6 A;  2CKL A;  4YAB A;  2CRR A;  4UP0 A;  4A4B A;  3U5N A;  4Q6F A;  3H7H A;  3PLW A;  2ECW A;  2YQL A;  1WIL A;  4A4C A;  4MVT A;  2YW8 A;  3KQI A;  2FUU A;  2XOZ A;  3T9K A;  3O47 A;  2MIQ A;  1WEM A;  4QQ4 A;  2MA5 A;  3IHP A;  2Y1M A;  2FD4 A;  2LGV A;  4R2Y A;  2K4D A;  4TKP B;  1FP0 A;  2MNY A;  1Z6U A;  3FJU B;  2CRW A;  3N9L A;  1N87 A;  4WA6 A;  2XEU A;  3ZVZ B;  4YAX A;  2H0D B;  4AYC B;  2VPD A;  4YBM A;  3O33 A;  1FBV A;  4O64 A;  2LV9 A;  5J3X A;  2DJA A;  4Z0O A;  4ZUX U;  2I50 A;  1V87 A;  2EXU A;  3EB5 A;  3PUQ A;  2FFW A;  4OGC A;  3EB6 A;  4YAD A;  4H9D A;  5TRB A;  1LDJ B;  2RI7 A;  1WE9 A;  2KYU A;  2P57 A;  5FB0 A;  1WEQ A;  2K1J A;  4YBS A;  2L7P A;  5I3L A;  4V3K C;  4XI1 A;  2LXP C;  2DSM A;  2JMI A;  3RPG C;  2HYE D;  4LAD B;  5EYA F;  5DKA A;  1F62 A;  2LGK A;  3LQH A;  1T1H A;  2MA6 A;  4ZDT A;  2MKE A;  1JM7 A;  5B77 A;  3O70 A;  3O35 A;  2KWO A;  5H1T A;  5LCW B;  3N9N A;  4QF2 A;  4LK9 A;  2LRI C;  3N9P A;  4ZQL A;  3RPG B;  1WEP A;  3LRQ A;  2KU3 A;  2VJE B;  4L7X A;  4UP5 A;  2YSM A;  2JMJ A;  3V43 A;  5B75 A;  4R7E A;  4F52 B;  2Y43 A;  1Z2Q A;  2LXH C;  5JG6 A;  2L75 A;  4UI9 B;  5FER A;  2CSY A;  4X3G A;  2D8U A;  1WES A;  3KV5 A;  3ZVY A;  2ECN A;  2QIZ A;  3M99 A;  3MDB C;  1U6G B;  2RSD A;  3LVQ E;  2YRE A;  5SVY A;  3VK6 A;  2CSV A;  1E4U A;  1JOC A;  4W4U A;  2YHO A;  5B76 A;  3U5M A;  2M13 A;  2YSJ A;  1WEO A;  3PHD A;  2M1R A;  2LDR A;  2G43 A;  2YHN A;  2XP0 A;  1VFY A;  5FEY A;  2YQM A;  2JMD A;  1VD4 A;  2YT5 A;  4V3L C;  3U5P A;  4N4F A;  4WZ0 A;  4CA1 A; 
#chains in the Genus database with same CATH homology
 3MHS A;  2M85 A;  5G05 B;  3SOX A;  5KH3 A;  1X4U A;  3QZV A;  2YUC A;  1CHC A;  2LQ6 A;  4FJC A;  2KWN A;  4YC9 A;  2JRJ A;  5G04 B;  2LN0 A;  4P5O B;  2ECJ A;  5LKZ A;  1LDK C;  2F42 A;  3O36 A;  2CKL B;  2OXQ C;  4IC3 A;  2AN6 A;  2QJ0 A;  1WEN A;  4A49 A;  5H1U A;  5KH9 A;  1XWH A;  4R8P K;  4GNF A;  4IC2 A;  5B8D A;  3ASL A;  3SHB A;  5TAB A;  2KGG A;  2VJF A;  3KV6 A;  4FK5 A;  4GB0 A;  1MM3 A;  2G45 A;  2NAA A;  2ECV A;  1WEV A;  3L11 A;  2CT2 A;  5FB1 A;  1HYI A;  3L1X A;  5B79 A;  3GV4 A;  5AIU A;  1DVP A;  5D1K B;  2L80 A;  1K2F A;  5AIT A;  1X4I A;  5C11 A;  2KE1 A;  3ZPV 1;  1IYM A;  5D1M B;  4I7D A;  3ZNI A;  2C2V S;  2UZG A;  4A0C D;  3O7A A;  1HYJ A;  2L0B A;  2KWJ A;  3SOU A;  3M63 A;  2KRE A;  4BBQ A;  2MD7 B;  4PPE A;  4B7Y C;  2VPE A;  4AUQ B;  4C9Z A;  4L58 A;  4B86 C;  2YUR A;  2MT5 A;  3DPL R;  2L5U A;  2EGP A;  3L1Z B;  3GL6 A;  1JM7 B;  4BHW A;  2KGI A;  2MNZ A;  2MUM A;  3I2D A;  3HTK C;  2C2L A;  5TBN A;  5B78 A;  3LQJ A;  3ZTG A;  3KNV A;  3C5K A;  1WEW A;  3LQI A;  5LKU A;  3HCT A;  2H0D A;  4AYC A;  3N9M A;  2VPB A;  5TDR A;  2M3H A;  4PTB A;  1WGM A;  2VPG A;  3N9O A;  3FL2 A;  3M62 A;  2KFT A;  4I7B A;  4LKA A;  2ECG A;  2LGL A;  4GND A;  4FO9 A;  3N9Q A;  4AP4 A;  2MD8 C;  1VYX A;  2YYR A;  5H9M A;  2CSZ A;  2VP7 A;  3T6R A;  2K17 A;  2M6M A;  2F6J A;  4QF3 A;  3MHH A;  5DIN A;  1X4J A;  2L43 A;  4LLB A;  3HCU A;  4FIP A;  3SOW A;  1Z60 A;  3PUR A;  2FSA A;  2FUI A;  2K16 A;  1MM2 A;  3T7L A;  2XB1 A;  3O34 A;  4WZ3 B;  5H1V A;  4GNE A;  2ZET C;  4S3O C;  4N3W A;  4GNG A;  2E6S A;  2VJE A;  3RTR B;  5KH7 A;  3DQV R;  3C6W A;  2KWK A;  2VNF A;  3ZPV E;  2KIZ A;  2D8S A;  4YBT A;  1RMD A;  2E6R A;  2ECI A;  4NN2 A;  4S3O B;  5LKT A;  1G25 A;  1BOR A;  2VJF B;  5G0F A;  2BAY A;  4MSX A;  3U5O A;  4WZ2 A;  2Y1N A;  3O37 A;  4I7C A;  2PNX A;  2IDA A;  1WFK A;  3NG2 A;  5LKX A;  4YAT A;  5TDW A;  3ZYQ A;  1ZBD B;  1WIM A;  2HDP A;  4CCG X;  2DX8 A;  5D1L B;  2PUY A;  4LJN A;  2QIC A;  2ECT A;  5C13 A;  1WEU A;  2F6N A;  2EOD A;  1WEE A;  2G6Q A;  4AVX A;  3HCS A;  2KR4 A;  2LGG A;  2YU4 A;  2EA6 A;  2CKL A;  4YAB A;  4UP0 A;  4A4B A;  3U5N A;  4Q6F A;  2ECW A;  2YQL A;  1WIL A;  4A4C A;  4MVT A;  2YW8 A;  3KQI A;  2FUU A;  2MIQ A;  1WEM A;  2MA5 A;  3IHP A;  2Y1M A;  2LGV A;  4R2Y A;  2K4D A;  4TKP B;  1FP0 A;  2MNY A;  1Z6U A;  3N9L A;  1N87 A;  4WA6 A;  2XEU A;  3ZVZ B;  4YAX A;  2H0D B;  4AYC B;  2VPD A;  4YBM A;  3O33 A;  1FBV A;  4O64 A;  2LV9 A;  5J3X A;  4ZUX U;  2I50 A;  1V87 A;  3EB5 A;  3PUQ A;  3EB6 A;  4YAD A;  5TRB A;  1LDJ B;  2RI7 A;  1WE9 A;  2KYU A;  5FB0 A;  1WEQ A;  2K1J A;  4YBS A;  5I3L A;  4V3K C;  4XI1 A;  2LXP C;  2JMI A;  3RPG C;  2HYE D;  4LAD B;  5EYA F;  5DKA A;  1F62 A;  2LGK A;  3LQH A;  1T1H A;  2MA6 A;  4ZDT A;  1JM7 A;  5B77 A;  3O70 A;  3O35 A;  2KWO A;  5H1T A;  5LCW B;  3N9N A;  4QF2 A;  4LK9 A;  2LRI C;  3N9P A;  4ZQL A;  3RPG B;  1WEP A;  3LRQ A;  2KU3 A;  2VJE B;  4L7X A;  4UP5 A;  2YSM A;  2JMJ A;  3V43 A;  5B75 A;  4R7E A;  4F52 B;  2Y43 A;  1Z2Q A;  2LXH C;  5JG6 A;  2L75 A;  4UI9 B;  5FER A;  2CSY A;  4X3G A;  1WES A;  3KV5 A;  3ZVY A;  2ECN A;  2QIZ A;  3M99 A;  1U6G B;  2RSD A;  2YRE A;  3VK6 A;  1E4U A;  1JOC A;  4W4U A;  2YHO A;  5B76 A;  3U5M A;  2YSJ A;  1WEO A;  3PHD A;  2M1R A;  2LDR A;  2G43 A;  2YHN A;  1VFY A;  5FEY A;  2YQM A;  2JMD A;  1VD4 A;  2YT5 A;  4V3L C;  3U5P A;  4N4F A;  4WZ0 A;  4CA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...