5B77A

Crystal structrue of moz double phd finger in complex with histone h3 propionylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b77A00
2L5UA 2K4DA 2F6JA 1WFKA 2YQLA 2F6NA 4MVTA 3I2DA 3O33A 3ZPVE 4LJNA 4PTBA 1FP0A 4CCGX 4GNEA 1LDJB 4L58A 4NN2A 4IC3A 1FBVA 5DKAA 3ZVZB 4R8PK 4YBMA 2KWKA 2ZETC 4V3LC 2CSYA 2FSAA 3O37A 4GNFA 1K2FA 2F42A 4GNDA 5G0FA 3KNVA 4I7CA 1X4JA 4V3KC 4BHWA 2Y1MA 5C13A 2LGLA 2CSZA 2ECNA 2ECGA 2RSDA 3VK6A 1HYJA 2XB1A 2YYRA 3LQJA 1WEQA 1WENA 2YU4A 4GNGA 4A4CA 5TRBA 1XWHA 3O36A 1BORA 2KE1A 4ZDTA 5H1VA 5B8DA 2YHOA 2KGIA 2EGPA 3PURA 5H1TA 5TABA 2VPBA 4ZQLA 5G04B 5G05B 2JRJA 4WZ2A 5FEYA 3KV5A 2QIZA 5TDRA 1X4IA 2KYUA 5D1KB 1WEEA 2K17A 2H0DA 4TKPB 2KR4A 4A4BA 3LQHA 2LRIC 1WEVA 2KIZA 4XI1A 3HCTA 4FK5A 1JM7B 1DVPA 2K1JA 1WGMA 2LDRA 3SOXA 2KWJA 2BAYA 5D1MB 2VNFA 5FB0A 2L75A 1WE9A 3L11A 3N9MA 1RMDA 1WEUA 2Y1NA 3MHSA 4YAXA 4WZ0A 2KFTA 3N9NA 1Z6UA 2VP7A 2PNXA 5DINA 3O7AA 4LLBA 3ZYQA 4AP4A 1WIMA 3DQVR 4ZUXU 1IYMA 3RPGB 4N3WA 4FIPA 2UZGA 4UP0A 1G25A 2LQ6A 1ZBDB 4AYCB 5C11A 4I7DA 4X3GA 2M3HA 2KWNA 2K16A 2MD8C 1T1HA 4O64A 2D8SA 4QF3A 1VYXA 2L0BA 2VJEB 3L1XA 3LQIA 5LKTA 2KGGA 1WEWA 2RI7A 2JMIA 2M6MA 3C5KA 4FO9A 2YSMA 3C6WA 2L43A 2I50A 2LV9A 2LN0A 2C2LA 2ECJA 3T6RA 4I7BA 2ECTA 2MNZA 1VFYA 3FL2A 5TDWA 4S3OC 4B7YC 5KH9A 2VPDA 3U5OA 3HTKC 3HCUA 3KV6A 2CT2A 5B77A 2YW8A 4WA6A 4WZ3B 1WESA 2KWOA 1VD4A 2VJFB 3EB5A 2ECWA 2EODA 4YADA 3M63A 2G6QA 2EA6A 5B78A 4LADB 4PPEA 2XEUA 2OXQC 1V87A 3RTRB 2MUMA 5B75A 2YSJA 2YHNA 2Y43A 4LKAA 2M1RA 2MT5A 4W4UA 1Z2QA 3LRQA 2JMJA 4P5OB 5LCWB 4LK9A 3IHPA 1WEOA 4R7EA 3DPLR 2YURA 1WEMA 1F62A 2L80A 3M99A 3PUQA 4N4FA 4QF2A 5KH7A 3SHBA 2MIQA 4GB0A 2YREA 2NAAA 2YQMA 2DX8A 4Q6FA 4UI9B 4YBTA 5AITA 2MA5A 3N9LA 2ECIA 5H9MA 5LKUA 2AN6A 3U5PA 4IC2A 1CHCA 1Z60A 1MM2A 3SOUA 5KH3A 1JM7A 4BBQA 3U5NA 3SOWA 4YABA 5FERA 1MM3A 2JMDA 2H0DB 5B76A 3KQIA 2YUCA 2HYED 3O35A 2MNYA 5LKXA 1X4UA 5EYAF 3N9OA 2PUYA 3PHDA 2CKLA 3T7LA 1HYIA 3V43A 1E4UA 1U6GB 2VPEA 2KREA 5D1LB 4YC9A 3O70A 3ZTGA 2G45A 3HCSA 1WILA 2KU3A 4YATA 2LGVA 4A49A 1JOCA 2VPGA 1LDKC 3ZVYA 3MHHA 3M62A 4B86C 4AYCA 2ECVA 2C2VS 2HDPA 5H1UA 2QICA 2MD7B 2G43A 2LGKA 2LXPC 3ZNIA 3NG2A 2E6SA 3EB6A 2FUIA 2LXHC 2QJ0A 3RPGC 5FB1A 5JG6A 4FJCA 2VJEA 2IDAA 3QZVA 4MSXA 4YBSA 4AVXA 3N9QA 2E6RA 3ZPV1 4A0CD 3GL6A 3O34A 2LGGA 3N9PA 4S3OB 4CA1A 2YT5A 2FUUA 5LKZA 2MA6A 4AUQB 4L7XA 4C9ZA 3L1ZB 5AIUA 3U5MA 5B79A 3GV4A 5TBNA 4F52B 4R2YA 3ASLA 2CKLB 2VJFA 5I3LA 1WEPA 4UP5A 1N87A 5J3XA 2M85A
chains in the Genus database with same CATH superfamily
2L5UA 2K4DA 2F6JA 1WFKA 2YQLA 2F6NA 4MVTA 3I2DA 3O33A 3ZPVE 4LJNA 2E61A 4PTBA 1FP0A 4CCGX 4GNEA 4F1PA 1LDJB 4L58A 4NN2A 4IC3A 1FBVA 5DKAA 3ZVZB 4R8PK 2KKYA 4YBMA 2KWKA 2ZETC 4V3LC 2CSYA 2FSAA 2L7PA 3O37A 4GNFA 1K2FA 2F42A 4GNDA 3KNVA 5G0FA 4I7CA 1X4JA 4V3KC 4BHWA 2Y1MA 5C13A 2LGLA 2CSZA 2ECNA 2ECGA 2RSDA 3VK6A 1HYJA 2XB1A 2YYRA 5K3QA 3LQJA 1WEQA 1WENA 2MKEA 2YU4A 4GNGA 4A4CA 5TRBA 1XWHA 3O36A 1BORA 2KE1A 4ZDTA 5H1VA 2JM3A 5B8DA 2YHOA 2KGIA 2EGPA 3PURA 5H1TA 5TABA 2VPBA 4ZQLA 5G04B 5G05B 2JRJA 4WZ2A 5FEYA 3KV5A 2QIZA 5TDRA 1X4IA 2KYUA 5D1KB 1WEEA 3PLWA 3FEHA 2K17A 2H0DA 3O47A 4TKPB 2KR4A 3E2DA 4A4BA 3LQHA 2LRIC 1WEVA 2KIZA 4XI1A 3HCTA 3Q1DA 4FK5A 5SVIB 1JM7B 3H7HA 1DVPA 2K1JA 2EGMA 1WGMA 2LDRA 2XP0A 3SOXA 2KWJA 2BAYA 5D1MB 2VNFA 5FB0A 3FAOA 3T9KA 2L75A 1WE9A 3L11A 3N9MA 1RMDA 2XOCA 2CRRA 2JUNA 1WEUA 2Y1NA 3MHSA 4YAXA 4WZ0A 4OGCA 3FJUB 2KFTA 3N9NA 1Z6UA 3LVRE 2VP7A 2PNXA 5DINA 3O7AA 4LLBA 3ZYQA 4AP4A 3M7KA 3KDEC 1WIMA 3DQVR 4ZUXU 1IYMA 3RPGB 4N3WA 4FIPA 2UZGA 4UP0A 1G25A 2YVRA 2LQ6A 1ZBDB 4AYCB 3LDYA 5C11A 4I7DA 4X3GA 2M3HA 2KWNA 2K16A 2MD8C 4QQ4A 1T1HA 4O64A 2D8SA 3JUEA 4QF3A 1VYXA 2L0BA 2VJEB 4Z0RA 3L1XA 3FM8C 2M13A 3LQIA 5LKTA 2KGGA 2IQJA 1WEWA 2FD4A 2JMIA 2RI7A 2M6MA 3C5KA 4FO9A 2YSMA 3C6WA 2L43A 3FANA 2I50A 2LV9A 2LN0A 2C2LA 2ECJA 3T6RA 4I7BA 2ECTA 2MNZA 1VFYA 3FL2A 5TDWA 4S3OC 4B7YC 5KH9A 2VPDA 3U5OA 3HTKC 3HCUA 3KV6A 2CT2A 5B77A 2FFWA 2YW8A 4WA6A 4WZ3B 2RR4A 2EXUA 1WESA 2KWOA 2LAUA 1VD4A 2VJFB 3EB5A 2ECWA 2EODA 4YADA 3M63A 2G6QA 2DJAA 2EA6A 5B78A 4LADB 4PPEA 2XEUA 2B0OE 2OXQC 1V87A 3RTRB 2MUMA 5B75A 2YSJA 2YHNA 2Y43A 3MDBC 4LKAA 2M1RA 2MT5A 5SVYA 4W4UA 1Z2QA 3LRQA 2JMJA 4P5OB 5LCWB 1DCQA 4LK9A 3IHPA 1WEOA 4R7EA 3DPLR 2CSVA 2YURA 1WEMA 1F62A 2L80A 3M99A 3PUQA 4H9DA 4N4FA 4QF2A 5KH7A 3LJUX 2MIQA 3SHBA 4GB0A 2CRWA 2XOYA 2YREA 2NAAA 2YQMA 2DX8A 4Q6FA 2OWAA 4UI9B 4YBTA 5AITA 2MA5A 3N9LA 2ECIA 5H9MA 5LKUA 2AN6A 3U5PA 4IC2A 1CHCA 1Z60A 1MM2A 3SOUA 5KH3A 5SVIA 1JM7A 4BBQA 4Z0OA 3U5NA 3SOWA 1MBMA 4YABA 1MM3A 2JMDA 2H0DB 5FERA 5B76A 3KQIA 2YUCA 2P57A 2HYED 5SVXA 3O35A 3SUBA 2MNYA 5LKXA 1X4UA 3DDTA 2DSMA 5EYAF 3N9OA 2PUYA 3PHDA 2CKLA 3T7LA 1HYIA 3V43A 1E4UA 1U6GB 2VPEA 2KREA 5D1LB 2D8UA 4YC9A 3O70A 3ZTGA 2G45A 3HCSA 1WILA 2KU3A 4YATA 2LGVA 4A49A 1JOCA 2VPGA 1LDKC 3ZVYA 3MHHA 2CONA 3M62A 4B86C 4AYCA 2ECVA 2C2VS 2HDPA 5H1UA 2QICA 2MD7B 2G43A 2LGKA 2LXPC 3ZNIA 3NG2A 2E6SA 3EB6A 3DWDA 2FUIA 2LXHC 2QJ0A 2KKXA 3RPGC 5FB1A 5JG6A 4OGEA 4FJCA 2VJEA 2IDAA 3QZVA 4MSXA 4YBSA 4AVXA 3LVQE 3N9QA 2E6RA 3ZPV1 4A0CD 3GL6A 3O34A 2LGGA 4O62A 3N9PA 4S3OB 4CA1A 2YT5A 2FUUA 5LKZA 2MA6A 4AUQB 4L7XA 4C9ZA 3L1ZB 5AIUA 3U5MA 5B79A 3GV4A 5TBNA 4F52B 4R2YA 3ASLA 2CKLB 2XOZA 2VJFA 5I3LA 1WEPA 4UP5A 1N87A 5J3XA 2M85A
chains in the Genus database with same CATH topology
2L5UA 2K4DA 2F6JA 1WFKA 2YQLA 2F6NA 4MVTA 3I2DA 3O33A 3ZPVE 4LJNA 4PTBA 1FP0A 4CCGX 4GNEA 1LDJB 4L58A 4NN2A 4IC3A 1FBVA 5DKAA 3ZVZB 4R8PK 4YBMA 2KWKA 2ZETC 4V3LC 2CSYA 2FSAA 3O37A 4GNFA 1K2FA 2F42A 4GNDA 5G0FA 3KNVA 4I7CA 1X4JA 4V3KC 4BHWA 2Y1MA 5C13A 2LGLA 2CSZA 2ECNA 2ECGA 2RSDA 3VK6A 1HYJA 2XB1A 2YYRA 3LQJA 1WEQA 1WENA 2YU4A 4GNGA 4A4CA 5TRBA 1XWHA 3O36A 1BORA 2KE1A 4ZDTA 5H1VA 5B8DA 2YHOA 2KGIA 2EGPA 3PURA 5H1TA 5TABA 2VPBA 4ZQLA 5G04B 5G05B 2JRJA 4WZ2A 5FEYA 3KV5A 2QIZA 5TDRA 1X4IA 2KYUA 5D1KB 1WEEA 2K17A 2H0DA 4TKPB 2KR4A 4A4BA 3LQHA 2LRIC 1WEVA 2KIZA 4XI1A 3HCTA 4FK5A 1JM7B 1DVPA 2K1JA 1WGMA 2LDRA 3SOXA 2KWJA 2BAYA 5D1MB 2VNFA 5FB0A 2L75A 1WE9A 3L11A 3N9MA 1RMDA 1WEUA 2Y1NA 3MHSA 4YAXA 4WZ0A 2KFTA 3N9NA 1Z6UA 2VP7A 2PNXA 5DINA 3O7AA 4LLBA 3ZYQA 4AP4A 1WIMA 3DQVR 4ZUXU 1IYMA 3RPGB 4N3WA 4FIPA 2UZGA 4UP0A 1G25A 2LQ6A 1ZBDB 4AYCB 5C11A 4I7DA 4X3GA 2M3HA 2KWNA 2K16A 2MD8C 1T1HA 4O64A 2D8SA 4QF3A 1VYXA 2L0BA 2VJEB 3L1XA 3LQIA 5LKTA 2KGGA 1WEWA 2RI7A 2JMIA 2M6MA 3C5KA 4FO9A 2YSMA 3C6WA 2L43A 2I50A 2LV9A 2LN0A 2C2LA 2ECJA 3T6RA 4I7BA 2ECTA 2MNZA 1VFYA 3FL2A 5TDWA 4S3OC 4B7YC 5KH9A 2VPDA 3U5OA 3HTKC 3HCUA 3KV6A 2CT2A 5B77A 2YW8A 4WA6A 4WZ3B 1WESA 2KWOA 1VD4A 2VJFB 3EB5A 2ECWA 2EODA 4YADA 3M63A 2G6QA 2EA6A 5B78A 4LADB 4PPEA 2XEUA 2OXQC 1V87A 3RTRB 2MUMA 5B75A 2YSJA 2YHNA 2Y43A 4LKAA 2M1RA 2MT5A 4W4UA 1Z2QA 3LRQA 2JMJA 4P5OB 5LCWB 4LK9A 3IHPA 1WEOA 4R7EA 3DPLR 2YURA 1WEMA 1F62A 2L80A 3M99A 3PUQA 4N4FA 4QF2A 5KH7A 3SHBA 2MIQA 4GB0A 2YREA 2NAAA 2YQMA 2DX8A 4Q6FA 4UI9B 4YBTA 5AITA 2MA5A 3N9LA 2ECIA 5H9MA 5LKUA 2AN6A 3U5PA 4IC2A 1CHCA 1Z60A 1MM2A 3SOUA 5KH3A 1JM7A 4BBQA 3U5NA 3SOWA 4YABA 5FERA 1MM3A 2JMDA 2H0DB 5B76A 3KQIA 2YUCA 2HYED 3O35A 2MNYA 5LKXA 1X4UA 5EYAF 3N9OA 2PUYA 3PHDA 2CKLA 3T7LA 1HYIA 3V43A 1E4UA 1U6GB 2VPEA 2KREA 5D1LB 4YC9A 3O70A 3ZTGA 2G45A 3HCSA 1WILA 2KU3A 4YATA 2LGVA 4A49A 1JOCA 2VPGA 1LDKC 3ZVYA 3MHHA 3M62A 4B86C 4AYCA 2ECVA 2C2VS 2HDPA 5H1UA 2QICA 2MD7B 2G43A 2LGKA 2LXPC 3ZNIA 3NG2A 2E6SA 3EB6A 2FUIA 2LXHC 2QJ0A 3RPGC 5FB1A 5JG6A 4FJCA 2VJEA 2IDAA 3QZVA 4MSXA 4YBSA 4AVXA 3N9QA 2E6RA 3ZPV1 4A0CD 3GL6A 3O34A 2LGGA 3N9PA 4S3OB 4CA1A 2YT5A 2FUUA 5LKZA 2MA6A 4AUQB 4L7XA 4C9ZA 3L1ZB 5AIUA 3U5MA 5B79A 3GV4A 5TBNA 4F52B 4R2YA 3ASLA 2CKLB 2VJFA 5I3LA 1WEPA 4UP5A 1N87A 5J3XA 2M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5U A;  2K4D A;  2F6J A;  1WFK A;  2YQL A;  2F6N A;  4MVT A;  3I2D A;  3O33 A;  3ZPV E;  4LJN A;  4PTB A;  1FP0 A;  4CCG X;  4GNE A;  1LDJ B;  4L58 A;  4NN2 A;  4IC3 A;  1FBV A;  5DKA A;  3ZVZ B;  4R8P K;  4YBM A;  2KWK A;  2ZET C;  4V3L C;  2CSY A;  2FSA A;  3O37 A;  4GNF A;  1K2F A;  2F42 A;  4GND A;  5G0F A;  3KNV A;  4I7C A;  1X4J A;  4V3K C;  4BHW A;  2Y1M A;  5C13 A;  2LGL A;  2CSZ A;  2ECN A;  2ECG A;  2RSD A;  3VK6 A;  1HYJ A;  2XB1 A;  2YYR A;  3LQJ A;  1WEQ A;  1WEN A;  2YU4 A;  4GNG A;  4A4C A;  5TRB A;  1XWH A;  3O36 A;  1BOR A;  2KE1 A;  4ZDT A;  5H1V A;  5B8D A;  2YHO A;  2KGI A;  2EGP A;  3PUR A;  5H1T A;  5TAB A;  2VPB A;  4ZQL A;  5G04 B;  5G05 B;  2JRJ A;  4WZ2 A;  5FEY A;  3KV5 A;  2QIZ A;  5TDR A;  1X4I A;  2KYU A;  5D1K B;  1WEE A;  2K17 A;  2H0D A;  4TKP B;  2KR4 A;  4A4B A;  3LQH A;  2LRI C;  1WEV A;  2KIZ A;  4XI1 A;  3HCT A;  4FK5 A;  1JM7 B;  1DVP A;  2K1J A;  1WGM A;  2LDR A;  3SOX A;  2KWJ A;  2BAY A;  5D1M B;  2VNF A;  5FB0 A;  2L75 A;  1WE9 A;  3L11 A;  3N9M A;  1RMD A;  1WEU A;  2Y1N A;  3MHS A;  4YAX A;  4WZ0 A;  2KFT A;  3N9N A;  1Z6U A;  2VP7 A;  2PNX A;  5DIN A;  3O7A A;  4LLB A;  3ZYQ A;  4AP4 A;  1WIM A;  3DQV R;  4ZUX U;  1IYM A;  3RPG B;  4N3W A;  4FIP A;  2UZG A;  4UP0 A;  1G25 A;  2LQ6 A;  1ZBD B;  4AYC B;  5C11 A;  4I7D A;  4X3G A;  2M3H A;  2KWN A;  2K16 A;  2MD8 C;  1T1H A;  4O64 A;  2D8S A;  4QF3 A;  1VYX A;  2L0B A;  2VJE B;  3L1X A;  3LQI A;  5LKT A;  2KGG A;  1WEW A;  2RI7 A;  2JMI A;  2M6M A;  3C5K A;  4FO9 A;  2YSM A;  3C6W A;  2L43 A;  2I50 A;  2LV9 A;  2LN0 A;  2C2L A;  2ECJ A;  3T6R A;  4I7B A;  2ECT A;  2MNZ A;  1VFY A;  3FL2 A;  5TDW A;  4S3O C;  4B7Y C;  5KH9 A;  2VPD A;  3U5O A;  3HTK C;  3HCU A;  3KV6 A;  2CT2 A;  5B77 A;  2YW8 A;  4WA6 A;  4WZ3 B;  1WES A;  2KWO A;  1VD4 A;  2VJF B;  3EB5 A;  2ECW A;  2EOD A;  4YAD A;  3M63 A;  2G6Q A;  2EA6 A;  5B78 A;  4LAD B;  4PPE A;  2XEU A;  2OXQ C;  1V87 A;  3RTR B;  2MUM A;  5B75 A;  2YSJ A;  2YHN A;  2Y43 A;  4LKA A;  2M1R A;  2MT5 A;  4W4U A;  1Z2Q A;  3LRQ A;  2JMJ A;  4P5O B;  5LCW B;  4LK9 A;  3IHP A;  1WEO A;  4R7E A;  3DPL R;  2YUR A;  1WEM A;  1F62 A;  2L80 A;  3M99 A;  3PUQ A;  4N4F A;  4QF2 A;  5KH7 A;  3SHB A;  2MIQ A;  4GB0 A;  2YRE A;  2NAA A;  2YQM A;  2DX8 A;  4Q6F A;  4UI9 B;  4YBT A;  5AIT A;  2MA5 A;  3N9L A;  2ECI A;  5H9M A;  5LKU A;  2AN6 A;  3U5P A;  4IC2 A;  1CHC A;  1Z60 A;  1MM2 A;  3SOU A;  5KH3 A;  1JM7 A;  4BBQ A;  3U5N A;  3SOW A;  4YAB A;  5FER A;  1MM3 A;  2JMD A;  2H0D B;  5B76 A;  3KQI A;  2YUC A;  2HYE D;  3O35 A;  2MNY A;  5LKX A;  1X4U A;  5EYA F;  3N9O A;  2PUY A;  3PHD A;  2CKL A;  3T7L A;  1HYI A;  3V43 A;  1E4U A;  1U6G B;  2VPE A;  2KRE A;  5D1L B;  4YC9 A;  3O70 A;  3ZTG A;  2G45 A;  3HCS A;  1WIL A;  2KU3 A;  4YAT A;  2LGV A;  4A49 A;  1JOC A;  2VPG A;  1LDK C;  3ZVY A;  3MHH A;  3M62 A;  4B86 C;  4AYC A;  2ECV A;  2C2V S;  2HDP A;  5H1U A;  2QIC A;  2MD7 B;  2G43 A;  2LGK A;  2LXP C;  3ZNI A;  3NG2 A;  2E6S A;  3EB6 A;  2FUI A;  2LXH C;  2QJ0 A;  3RPG C;  5FB1 A;  5JG6 A;  4FJC A;  2VJE A;  2IDA A;  3QZV A;  4MSX A;  4YBS A;  4AVX A;  3N9Q A;  2E6R A;  3ZPV 1;  4A0C D;  3GL6 A;  3O34 A;  2LGG A;  3N9P A;  4S3O B;  4CA1 A;  2YT5 A;  2FUU A;  5LKZ A;  2MA6 A;  4AUQ B;  4L7X A;  4C9Z A;  3L1Z B;  5AIU A;  3U5M A;  5B79 A;  3GV4 A;  5TBN A;  4F52 B;  4R2Y A;  3ASL A;  2CKL B;  2VJF A;  5I3L A;  1WEP A;  4UP5 A;  1N87 A;  5J3X A;  2M85 A; 
#chains in the Genus database with same CATH topology
 2L5U A;  2K4D A;  2F6J A;  1WFK A;  2YQL A;  2F6N A;  4MVT A;  3I2D A;  3O33 A;  3ZPV E;  4LJN A;  2E61 A;  4PTB A;  1FP0 A;  4CCG X;  4GNE A;  4F1P A;  1LDJ B;  4L58 A;  4NN2 A;  4IC3 A;  1FBV A;  5DKA A;  3ZVZ B;  4R8P K;  2KKY A;  4YBM A;  2KWK A;  2ZET C;  4V3L C;  2CSY A;  2FSA A;  2L7P A;  3O37 A;  4GNF A;  1K2F A;  2F42 A;  4GND A;  3KNV A;  5G0F A;  4I7C A;  1X4J A;  4V3K C;  4BHW A;  2Y1M A;  5C13 A;  2LGL A;  2CSZ A;  2ECN A;  2ECG A;  2RSD A;  3VK6 A;  1HYJ A;  2XB1 A;  2YYR A;  5K3Q A;  3LQJ A;  1WEQ A;  1WEN A;  2MKE A;  2YU4 A;  4GNG A;  4A4C A;  5TRB A;  1XWH A;  3O36 A;  1BOR A;  2KE1 A;  4ZDT A;  5H1V A;  2JM3 A;  5B8D A;  2YHO A;  2KGI A;  2EGP A;  3PUR A;  5H1T A;  5TAB A;  2VPB A;  4ZQL A;  5G04 B;  5G05 B;  2JRJ A;  4WZ2 A;  5FEY A;  3KV5 A;  2QIZ A;  5TDR A;  1X4I A;  2KYU A;  5D1K B;  1WEE A;  3PLW A;  3FEH A;  2K17 A;  2H0D A;  3O47 A;  4TKP B;  2KR4 A;  3E2D A;  4A4B A;  3LQH A;  2LRI C;  1WEV A;  2KIZ A;  4XI1 A;  3HCT A;  3Q1D A;  4FK5 A;  5SVI B;  1JM7 B;  3H7H A;  1DVP A;  2K1J A;  2EGM A;  1WGM A;  2LDR A;  2XP0 A;  3SOX A;  2KWJ A;  2BAY A;  5D1M B;  2VNF A;  5FB0 A;  3FAO A;  3T9K A;  2L75 A;  1WE9 A;  3L11 A;  3N9M A;  1RMD A;  2XOC A;  2CRR A;  2JUN A;  1WEU A;  2Y1N A;  3MHS A;  4YAX A;  4WZ0 A;  4OGC A;  3FJU B;  2KFT A;  3N9N A;  1Z6U A;  3LVR E;  2VP7 A;  2PNX A;  5DIN A;  3O7A A;  4LLB A;  3ZYQ A;  4AP4 A;  3M7K A;  3KDE C;  1WIM A;  3DQV R;  4ZUX U;  1IYM A;  3RPG B;  4N3W A;  4FIP A;  2UZG A;  4UP0 A;  1G25 A;  2YVR A;  2LQ6 A;  1ZBD B;  4AYC B;  3LDY A;  5C11 A;  4I7D A;  4X3G A;  2M3H A;  2KWN A;  2K16 A;  2MD8 C;  4QQ4 A;  1T1H A;  4O64 A;  2D8S A;  3JUE A;  4QF3 A;  1VYX A;  2L0B A;  2VJE B;  4Z0R A;  3L1X A;  3FM8 C;  2M13 A;  3LQI A;  5LKT A;  2KGG A;  2IQJ A;  1WEW A;  2FD4 A;  2JMI A;  2RI7 A;  2M6M A;  3C5K A;  4FO9 A;  2YSM A;  3C6W A;  2L43 A;  3FAN A;  2I50 A;  2LV9 A;  2LN0 A;  2C2L A;  2ECJ A;  3T6R A;  4I7B A;  2ECT A;  2MNZ A;  1VFY A;  3FL2 A;  5TDW A;  4S3O C;  4B7Y C;  5KH9 A;  2VPD A;  3U5O A;  3HTK C;  3HCU A;  3KV6 A;  2CT2 A;  5B77 A;  2FFW A;  2YW8 A;  4WA6 A;  4WZ3 B;  2RR4 A;  2EXU A;  1WES A;  2KWO A;  2LAU A;  1VD4 A;  2VJF B;  3EB5 A;  2ECW A;  2EOD A;  4YAD A;  3M63 A;  2G6Q A;  2DJA A;  2EA6 A;  5B78 A;  4LAD B;  4PPE A;  2XEU A;  2B0O E;  2OXQ C;  1V87 A;  3RTR B;  2MUM A;  5B75 A;  2YSJ A;  2YHN A;  2Y43 A;  3MDB C;  4LKA A;  2M1R A;  2MT5 A;  5SVY A;  4W4U A;  1Z2Q A;  3LRQ A;  2JMJ A;  4P5O B;  5LCW B;  1DCQ A;  4LK9 A;  3IHP A;  1WEO A;  4R7E A;  3DPL R;  2CSV A;  2YUR A;  1WEM A;  1F62 A;  2L80 A;  3M99 A;  3PUQ A;  4H9D A;  4N4F A;  4QF2 A;  5KH7 A;  3LJU X;  2MIQ A;  3SHB A;  4GB0 A;  2CRW A;  2XOY A;  2YRE A;  2NAA A;  2YQM A;  2DX8 A;  4Q6F A;  2OWA A;  4UI9 B;  4YBT A;  5AIT A;  2MA5 A;  3N9L A;  2ECI A;  5H9M A;  5LKU A;  2AN6 A;  3U5P A;  4IC2 A;  1CHC A;  1Z60 A;  1MM2 A;  3SOU A;  5KH3 A;  5SVI A;  1JM7 A;  4BBQ A;  4Z0O A;  3U5N A;  3SOW A;  1MBM A;  4YAB A;  1MM3 A;  2JMD A;  2H0D B;  5FER A;  5B76 A;  3KQI A;  2YUC A;  2P57 A;  2HYE D;  5SVX A;  3O35 A;  3SUB A;  2MNY A;  5LKX A;  1X4U A;  3DDT A;  2DSM A;  5EYA F;  3N9O A;  2PUY A;  3PHD A;  2CKL A;  3T7L A;  1HYI A;  3V43 A;  1E4U A;  1U6G B;  2VPE A;  2KRE A;  5D1L B;  2D8U A;  4YC9 A;  3O70 A;  3ZTG A;  2G45 A;  3HCS A;  1WIL A;  2KU3 A;  4YAT A;  2LGV A;  4A49 A;  1JOC A;  2VPG A;  1LDK C;  3ZVY A;  3MHH A;  2CON A;  3M62 A;  4B86 C;  4AYC A;  2ECV A;  2C2V S;  2HDP A;  5H1U A;  2QIC A;  2MD7 B;  2G43 A;  2LGK A;  2LXP C;  3ZNI A;  3NG2 A;  2E6S A;  3EB6 A;  3DWD A;  2FUI A;  2LXH C;  2QJ0 A;  2KKX A;  3RPG C;  5FB1 A;  5JG6 A;  4OGE A;  4FJC A;  2VJE A;  2IDA A;  3QZV A;  4MSX A;  4YBS A;  4AVX A;  3LVQ E;  3N9Q A;  2E6R A;  3ZPV 1;  4A0C D;  3GL6 A;  3O34 A;  2LGG A;  4O62 A;  3N9P A;  4S3O B;  4CA1 A;  2YT5 A;  2FUU A;  5LKZ A;  2MA6 A;  4AUQ B;  4L7X A;  4C9Z A;  3L1Z B;  5AIU A;  3U5M A;  5B79 A;  3GV4 A;  5TBN A;  4F52 B;  4R2Y A;  3ASL A;  2CKL B;  2XOZ A;  2VJF A;  5I3L A;  1WEP A;  4UP5 A;  1N87 A;  5J3X A;  2M85 A; 
#chains in the Genus database with same CATH homology
 2L5U A;  2K4D A;  2F6J A;  1WFK A;  2YQL A;  2F6N A;  4MVT A;  3I2D A;  3O33 A;  3ZPV E;  4LJN A;  4PTB A;  1FP0 A;  4CCG X;  4GNE A;  1LDJ B;  4L58 A;  4NN2 A;  4IC3 A;  1FBV A;  5DKA A;  3ZVZ B;  4R8P K;  4YBM A;  2KWK A;  2ZET C;  4V3L C;  2CSY A;  2FSA A;  3O37 A;  4GNF A;  1K2F A;  2F42 A;  4GND A;  5G0F A;  3KNV A;  4I7C A;  1X4J A;  4V3K C;  4BHW A;  2Y1M A;  5C13 A;  2LGL A;  2CSZ A;  2ECN A;  2ECG A;  2RSD A;  3VK6 A;  1HYJ A;  2XB1 A;  2YYR A;  3LQJ A;  1WEQ A;  1WEN A;  2YU4 A;  4GNG A;  4A4C A;  5TRB A;  1XWH A;  3O36 A;  1BOR A;  2KE1 A;  4ZDT A;  5H1V A;  5B8D A;  2YHO A;  2KGI A;  2EGP A;  3PUR A;  5H1T A;  5TAB A;  2VPB A;  4ZQL A;  5G04 B;  5G05 B;  2JRJ A;  4WZ2 A;  5FEY A;  3KV5 A;  2QIZ A;  5TDR A;  1X4I A;  2KYU A;  5D1K B;  1WEE A;  2K17 A;  2H0D A;  4TKP B;  2KR4 A;  4A4B A;  3LQH A;  2LRI C;  1WEV A;  2KIZ A;  4XI1 A;  3HCT A;  4FK5 A;  1JM7 B;  1DVP A;  2K1J A;  1WGM A;  2LDR A;  3SOX A;  2KWJ A;  2BAY A;  5D1M B;  2VNF A;  5FB0 A;  2L75 A;  1WE9 A;  3L11 A;  3N9M A;  1RMD A;  1WEU A;  2Y1N A;  3MHS A;  4YAX A;  4WZ0 A;  2KFT A;  3N9N A;  1Z6U A;  2VP7 A;  2PNX A;  5DIN A;  3O7A A;  4LLB A;  3ZYQ A;  4AP4 A;  1WIM A;  3DQV R;  4ZUX U;  1IYM A;  3RPG B;  4N3W A;  4FIP A;  2UZG A;  4UP0 A;  1G25 A;  2LQ6 A;  1ZBD B;  4AYC B;  5C11 A;  4I7D A;  4X3G A;  2M3H A;  2KWN A;  2K16 A;  2MD8 C;  1T1H A;  4O64 A;  2D8S A;  4QF3 A;  1VYX A;  2L0B A;  2VJE B;  3L1X A;  3LQI A;  5LKT A;  2KGG A;  1WEW A;  2RI7 A;  2JMI A;  2M6M A;  3C5K A;  4FO9 A;  2YSM A;  3C6W A;  2L43 A;  2I50 A;  2LV9 A;  2LN0 A;  2C2L A;  2ECJ A;  3T6R A;  4I7B A;  2ECT A;  2MNZ A;  1VFY A;  3FL2 A;  5TDW A;  4S3O C;  4B7Y C;  5KH9 A;  2VPD A;  3U5O A;  3HTK C;  3HCU A;  3KV6 A;  2CT2 A;  5B77 A;  2YW8 A;  4WA6 A;  4WZ3 B;  1WES A;  2KWO A;  1VD4 A;  2VJF B;  3EB5 A;  2ECW A;  2EOD A;  4YAD A;  3M63 A;  2G6Q A;  2EA6 A;  5B78 A;  4LAD B;  4PPE A;  2XEU A;  2OXQ C;  1V87 A;  3RTR B;  2MUM A;  5B75 A;  2YSJ A;  2YHN A;  2Y43 A;  4LKA A;  2M1R A;  2MT5 A;  4W4U A;  1Z2Q A;  3LRQ A;  2JMJ A;  4P5O B;  5LCW B;  4LK9 A;  3IHP A;  1WEO A;  4R7E A;  3DPL R;  2YUR A;  1WEM A;  1F62 A;  2L80 A;  3M99 A;  3PUQ A;  4N4F A;  4QF2 A;  5KH7 A;  3SHB A;  2MIQ A;  4GB0 A;  2YRE A;  2NAA A;  2YQM A;  2DX8 A;  4Q6F A;  4UI9 B;  4YBT A;  5AIT A;  2MA5 A;  3N9L A;  2ECI A;  5H9M A;  5LKU A;  2AN6 A;  3U5P A;  4IC2 A;  1CHC A;  1Z60 A;  1MM2 A;  3SOU A;  5KH3 A;  1JM7 A;  4BBQ A;  3U5N A;  3SOW A;  4YAB A;  5FER A;  1MM3 A;  2JMD A;  2H0D B;  5B76 A;  3KQI A;  2YUC A;  2HYE D;  3O35 A;  2MNY A;  5LKX A;  1X4U A;  5EYA F;  3N9O A;  2PUY A;  3PHD A;  2CKL A;  3T7L A;  1HYI A;  3V43 A;  1E4U A;  1U6G B;  2VPE A;  2KRE A;  5D1L B;  4YC9 A;  3O70 A;  3ZTG A;  2G45 A;  3HCS A;  1WIL A;  2KU3 A;  4YAT A;  2LGV A;  4A49 A;  1JOC A;  2VPG A;  1LDK C;  3ZVY A;  3MHH A;  3M62 A;  4B86 C;  4AYC A;  2ECV A;  2C2V S;  2HDP A;  5H1U A;  2QIC A;  2MD7 B;  2G43 A;  2LGK A;  2LXP C;  3ZNI A;  3NG2 A;  2E6S A;  3EB6 A;  2FUI A;  2LXH C;  2QJ0 A;  3RPG C;  5FB1 A;  5JG6 A;  4FJC A;  2VJE A;  2IDA A;  3QZV A;  4MSX A;  4YBS A;  4AVX A;  3N9Q A;  2E6R A;  3ZPV 1;  4A0C D;  3GL6 A;  3O34 A;  2LGG A;  3N9P A;  4S3O B;  4CA1 A;  2YT5 A;  2FUU A;  5LKZ A;  2MA6 A;  4AUQ B;  4L7X A;  4C9Z A;  3L1Z B;  5AIU A;  3U5M A;  5B79 A;  3GV4 A;  5TBN A;  4F52 B;  4R2Y A;  3ASL A;  2CKL B;  2VJF A;  5I3L A;  1WEP A;  4UP5 A;  1N87 A;  5J3X A;  2M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...