5B77A

Crystal structrue of moz double phd finger in complex with histone h3 propionylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b77A00
1F62A 3N9PA 5TDRA 4GNDA 4X3GA 1U6GB 2JMIA 3HCTA 3M99A 2BAYA 3RPGB 2I50A 2MNYA 5J3XA 4B7YC 3N9MA 2M3HA 4F52B 2YQLA 2EODA 4QF2A 2VJEB 4WA6A 3KQIA 2ECIA 5LKZA 2L0BA 2VP7A 4ZQLA 3KV6A 4S3OB 3LQJA 2LN0A 3NG2A 2ECGA 3ZVYA 1IYMA 4LJNA 5LKTA 2YW8A 3ZTGA 3C6WA 3PHDA 1Z60A 5B79A 5FEYA 5LCWB 5I3LA 1WEEA 4L7XA 5FB1A 2KIZA 2VJFA 1JOCA 5DINA 4I7DA 2PNXA 1WESA 2LXPC 2D8SA 5JG6A 2KWOA 5D1MB 5KH7A 2HDPA 1MM3A 1V87A 1HYIA 2M6MA 3L11A 5AIUA 3LQHA 5H1UA 3N9OA 2K1JA 5FERA 2CKLA 2E6RA 1WEOA 3ZNIA 1WEWA 2OXQC 2MD7B 4B86C 5G05B 4CA1A 4GB0A 3DQVR 2FUIA 3SHBA 1X4UA 3MHSA 3HCUA 4AVXA 2VPEA 2H0DB 4YATA 3RPGC 3N9QA 5H1TA 2YURA 5G0FA 5C11A 2ECTA 4N4FA 2RSDA 1ZBDB 2KU3A 2MUMA 2M1RA 1LDJB 2CKLB 2FSAA 1LDKC 4YBMA 3V43A 4YAXA 4A4BA 4S3OC 2EA6A 2LGGA 2VNFA 3GL6A 2K4DA 4AYCB 3M63A 5DKAA 4V3KC 2MD8C 2VPBA 2L80A 3O34A 3O36A 1JM7A 4V3LC 3KNVA 4XI1A 4YBSA 3PURA 4YABA 2KREA 2MA6A 1Z6UA 3LQIA 2Y43A 2FUUA 1RMDA 2ECWA 4MVTA 4BHWA 2JRJA 5KH9A 2LXHC 3ASLA 3QZVA 3I2DA 3ZPVE 2LGVA 1WGMA 4L58A 4Q6FA 4WZ2A 1CHCA 2DX8A 4I7BA 5H1VA 5TABA 2YT5A 5B77A 3N9NA 4W4UA 2F6NA 1X4JA 1WIMA 2MA5A 3RTRB 2VPGA 2YHOA 4FIPA 2YSJA 2YYRA 1VFYA 4CCGX 5FB0A 4GNEA 5G04B 2QICA 2LQ6A 4N3WA 2M85A 2LV9A 1HYJA 2LDRA 1VYXA 3O7AA 4LADB 4GNGA 4C9ZA 5TBNA 2KGIA 1K2FA 4YBTA 1XWHA 2YREA 2IDAA 3U5MA 3O35A 1WENA 2YUCA 2YU4A 2VJFB 2XB1A 2YSMA 2G45A 3U5NA 3PUQA 4A49A 3SOUA 1T1HA 2L75A 2VJEA 5EYAF 2KWKA 5B75A 2KWJA 2CT2A 3O33A 2LGLA 4TKPB 4R7EA 4IC2A 4BBQA 3FL2A 2K16A 2UZGA 2JMDA 4LLBA 4WZ0A 2C2VS 1N87A 2E6SA 5B78A 3U5PA 1DVPA 2CSZA 2JMJA 3MHHA 5B8DA 2PUYA 2RI7A 2KGGA 3SOXA 3EB6A 4P5OB 2F42A 2ZETC 3O70A 4UP5A 2VPDA 1MM2A 3ZVZB 2Y1MA 3LRQA 4MSXA 4FK5A 5D1LB 2MT5A 4FO9A 3C5KA 1VD4A 5C13A 4I7CA 1WEQA 4WZ3B 1WEMA 2KWNA 2CSYA 4R8PK 1BORA 5H9MA 1WEVA 4ZUXU 1WEPA 2KFTA 4UI9B 4AUQB 5B76A 2LRIC 1WE9A 1WFKA 3HCSA 2ECNA 2C2LA 5AITA 5KH3A 5D1KB 3L1XA 2AN6A 5LKXA 4YADA 3M62A 4LKAA 1WILA 3EB5A 4QF3A 3GV4A 3O37A 4O64A 1JM7B 2H0DA 2YQMA 4A4CA 5LKUA 4UP0A 4R2YA 3T7LA 2YHNA 2F6JA 2QIZA 4ZDTA 2ECJA 3L1ZB 2MIQA 2KYUA 2LGKA 3HTKC 3IHPA 4PPEA 4NN2A 3SOWA 2KR4A 2KE1A 4FJCA 3ZYQA 5TDWA 4PTBA 3VK6A 1X4IA 2L5UA 3N9LA 1FP0A 3U5OA 2HYED 4AYCA 2EGPA 4IC3A 2L43A 1WEUA 3DPLR 2K17A 3T6RA 4A0CD 2Y1NA 1FBVA 2G6QA 4LK9A 1Z2QA 2MNZA 3ZPV1 3KV5A 2ECVA 5TRBA 4YC9A 4AP4A 1E4UA 2XEUA 1G25A 2NAAA 2QJ0A 4GNFA 2G43A
chains in the Genus database with same CATH superfamily
1F62A 3N9PA 5TDRA 4GNDA 4X3GA 1U6GB 2JMIA 3HCTA 3M99A 2BAYA 3RPGB 2I50A 2MNYA 5J3XA 4B7YC 3N9MA 2M3HA 4F52B 2YQLA 2RR4A 2EODA 2CONA 2MKEA 2YVRA 2DSMA 4QF2A 2VJEB 4WA6A 3KQIA 5SVIA 2ECIA 5LKZA 2FFWA 2L0BA 2VP7A 4ZQLA 3KV6A 4S3OB 3LQJA 2LN0A 3NG2A 2ECGA 3ZVYA 1IYMA 4LJNA 5LKTA 2YW8A 3ZTGA 3C6WA 3PHDA 1Z60A 5B79A 5FEYA 5K3QA 5LCWB 3FEHA 5I3LA 3M7KA 2IQJA 1WEEA 4L7XA 5FB1A 2EXUA 2KIZA 2XOZA 2VJFA 1JOCA 5DINA 4I7DA 2PNXA 1WESA 2LXPC 3T9KA 3SUBA 2D8SA 5JG6A 2KWOA 5D1MB 5KH7A 3FAOA 2HDPA 2JUNA 1MM3A 1V87A 1HYIA 2M6MA 3L11A 5AIUA 3LQHA 5H1UA 3N9OA 2K1JA 5FERA 2CKLA 2E6RA 1WEOA 3ZNIA 1WEWA 2OXQC 2MD7B 3KDEC 3PLWA 4B86C 5G05B 4CA1A 4GB0A 3DQVR 2FUIA 3SHBA 1X4UA 2P57A 2CRWA 3MHSA 3HCUA 4AVXA 2VPEA 2H0DB 4YATA 3RPGC 3N9QA 5H1TA 2YURA 5G0FA 5C11A 2XP0A 2ECTA 4N4FA 2RSDA 1ZBDB 2KU3A 2MUMA 2M1RA 1LDJB 2CKLB 2FSAA 1LDKC 2EGMA 4YBMA 3V43A 4YAXA 2FD4A 4A4BA 4Z0OA 4S3OC 2EA6A 2LGGA 2VNFA 3GL6A 2K4DA 4AYCB 3M63A 5DKAA 4V3KC 2MD8C 2VPBA 2D8UA 2L80A 5SVXA 3O34A 3O36A 1JM7A 4V3LC 3KNVA 4XI1A 4YBSA 2XOCA 3PURA 4YABA 2KREA 2MA6A 1Z6UA 3LQIA 2Y43A 2FUUA 1RMDA 2ECWA 4MVTA 3MDBC 4BHWA 2JRJA 5KH9A 2LXHC 3DWDA 3ASLA 3QZVA 3I2DA 3ZPVE 2LGVA 1WGMA 4L58A 4Q6FA 4WZ2A 1CHCA 2DX8A 4I7BA 5H1VA 5TABA 2YT5A 5B77A 3N9NA 4W4UA 2F6NA 1X4JA 2M13A 1WIMA 2CRRA 2MA5A 3RTRB 2VPGA 2YHOA 4FIPA 2YSJA 2YYRA 1VFYA 5SVIB 4CCGX 5FB0A 4GNEA 4O62A 5G04B 2QICA 2LQ6A 4N3WA 2M85A 2LV9A 1HYJA 2LDRA 1VYXA 3O7AA 2B0OE 4LADB 4GNGA 4C9ZA 5TBNA 2KGIA 1K2FA 4YBTA 1XWHA 2YREA 2IDAA 3U5MA 3O35A 1WENA 2YUCA 2YU4A 2VJFB 2XB1A 2YSMA 2G45A 3U5NA 3PUQA 4A49A 3SOUA 3DDTA 1T1HA 2KKXA 2L75A 2VJEA 5EYAF 2KWKA 5B75A 2KWJA 2CT2A 3O33A 2XOYA 2LGLA 3LJUX 4TKPB 2CSVA 4R7EA 4H9DA 4IC2A 4BBQA 3FL2A 1MBMA 2E61A 2K16A 2OWAA 2UZGA 2JMDA 4LLBA 4WZ0A 2C2VS 1N87A 2E6SA 5B78A 3U5PA 1DVPA 2CSZA 2JMJA 3MHHA 5B8DA 2PUYA 2RI7A 2KGGA 3SOXA 3FJUB 3EB6A 4P5OB 4F1PA 2F42A 2L7PA 2ZETC 3O70A 4UP5A 4QQ4A 2VPDA 1MM2A 3ZVZB 2Y1MA 3LRQA 4MSXA 4FK5A 3FANA 5SVYA 5D1LB 2MT5A 4FO9A 3C5KA 1VD4A 5C13A 4I7CA 1WEQA 4WZ3B 1WEMA 2KWNA 2CSYA 3O47A 4R8PK 1BORA 5H9MA 4Z0RA 1WEVA 4ZUXU 1WEPA 2KFTA 2LAUA 4UI9B 4OGCA 4AUQB 5B76A 1DCQA 2LRIC 1WE9A 1WFKA 3HCSA 2ECNA 2C2LA 5AITA 5KH3A 2KKYA 5D1KB 3L1XA 2AN6A 5LKXA 4YADA 3M62A 4LKAA 1WILA 3EB5A 4QF3A 3GV4A 3O37A 4O64A 1JM7B 2H0DA 3LVRE 2YQMA 4A4CA 5LKUA 4UP0A 4R2YA 3T7LA 2YHNA 2F6JA 2QIZA 4ZDTA 2ECJA 3L1ZB 2MIQA 2KYUA 2LGKA 3H7HA 3HTKC 3IHPA 4PPEA 4NN2A 3SOWA 2KR4A 2KE1A 4FJCA 3ZYQA 5TDWA 3FM8C 4PTBA 3VK6A 1X4IA 2L5UA 3N9LA 1FP0A 3U5OA 2HYED 4AYCA 2EGPA 2DJAA 3LVQE 3JUEA 3LDYA 4IC3A 3Q1DA 2L43A 1WEUA 3DPLR 2K17A 3T6RA 4A0CD 2Y1NA 1FBVA 4OGEA 2G6QA 4LK9A 1Z2QA 2MNZA 3ZPV1 3KV5A 2JM3A 2ECVA 5TRBA 4YC9A 4AP4A 1E4UA 2XEUA 1G25A 2NAAA 2QJ0A 4GNFA 3E2DA 2G43A
chains in the Genus database with same CATH topology
1F62A 3N9PA 5TDRA 4GNDA 4X3GA 1U6GB 2JMIA 3HCTA 3M99A 2BAYA 3RPGB 2I50A 2MNYA 5J3XA 4B7YC 3N9MA 2M3HA 4F52B 2YQLA 2EODA 4QF2A 2VJEB 4WA6A 3KQIA 2ECIA 5LKZA 2L0BA 2VP7A 4ZQLA 3KV6A 4S3OB 3LQJA 2LN0A 3NG2A 2ECGA 3ZVYA 1IYMA 4LJNA 5LKTA 2YW8A 3ZTGA 3C6WA 3PHDA 1Z60A 5B79A 5FEYA 5LCWB 5I3LA 1WEEA 4L7XA 5FB1A 2KIZA 2VJFA 1JOCA 5DINA 4I7DA 2PNXA 1WESA 2LXPC 2D8SA 5JG6A 2KWOA 5D1MB 5KH7A 2HDPA 1MM3A 1V87A 1HYIA 2M6MA 3L11A 5AIUA 3LQHA 5H1UA 3N9OA 2K1JA 5FERA 2CKLA 2E6RA 1WEOA 3ZNIA 1WEWA 2OXQC 2MD7B 4B86C 5G05B 4CA1A 4GB0A 3DQVR 2FUIA 3SHBA 1X4UA 3MHSA 3HCUA 4AVXA 2VPEA 2H0DB 4YATA 3RPGC 3N9QA 5H1TA 2YURA 5G0FA 5C11A 2ECTA 4N4FA 2RSDA 1ZBDB 2KU3A 2MUMA 2M1RA 1LDJB 2CKLB 2FSAA 1LDKC 4YBMA 3V43A 4YAXA 4A4BA 4S3OC 2EA6A 2LGGA 2VNFA 3GL6A 2K4DA 4AYCB 3M63A 5DKAA 4V3KC 2MD8C 2VPBA 2L80A 3O34A 3O36A 1JM7A 4V3LC 3KNVA 4XI1A 4YBSA 3PURA 4YABA 2KREA 2MA6A 1Z6UA 3LQIA 2Y43A 2FUUA 1RMDA 2ECWA 4MVTA 4BHWA 2JRJA 5KH9A 2LXHC 3ASLA 3QZVA 3I2DA 3ZPVE 2LGVA 1WGMA 4L58A 4Q6FA 4WZ2A 1CHCA 2DX8A 4I7BA 5H1VA 5TABA 2YT5A 5B77A 3N9NA 4W4UA 2F6NA 1X4JA 1WIMA 2MA5A 3RTRB 2VPGA 2YHOA 4FIPA 2YSJA 2YYRA 1VFYA 4CCGX 5FB0A 4GNEA 5G04B 2QICA 2LQ6A 4N3WA 2M85A 2LV9A 1HYJA 2LDRA 1VYXA 3O7AA 4LADB 4GNGA 4C9ZA 5TBNA 2KGIA 1K2FA 4YBTA 1XWHA 2YREA 2IDAA 3U5MA 3O35A 1WENA 2YUCA 2YU4A 2VJFB 2XB1A 2YSMA 2G45A 3U5NA 3PUQA 4A49A 3SOUA 1T1HA 2L75A 2VJEA 5EYAF 2KWKA 5B75A 2KWJA 2CT2A 3O33A 2LGLA 4TKPB 4R7EA 4IC2A 4BBQA 3FL2A 2K16A 2UZGA 2JMDA 4LLBA 4WZ0A 2C2VS 1N87A 2E6SA 5B78A 3U5PA 1DVPA 2CSZA 2JMJA 3MHHA 5B8DA 2PUYA 2RI7A 2KGGA 3SOXA 3EB6A 4P5OB 2F42A 2ZETC 3O70A 4UP5A 2VPDA 1MM2A 3ZVZB 2Y1MA 3LRQA 4MSXA 4FK5A 5D1LB 2MT5A 4FO9A 3C5KA 1VD4A 5C13A 4I7CA 1WEQA 4WZ3B 1WEMA 2KWNA 2CSYA 4R8PK 1BORA 5H9MA 1WEVA 4ZUXU 1WEPA 2KFTA 4UI9B 4AUQB 5B76A 2LRIC 1WE9A 1WFKA 3HCSA 2ECNA 2C2LA 5AITA 5KH3A 5D1KB 3L1XA 2AN6A 5LKXA 4YADA 3M62A 4LKAA 1WILA 3EB5A 4QF3A 3GV4A 3O37A 4O64A 1JM7B 2H0DA 2YQMA 4A4CA 5LKUA 4UP0A 4R2YA 3T7LA 2YHNA 2F6JA 2QIZA 4ZDTA 2ECJA 3L1ZB 2MIQA 2KYUA 2LGKA 3HTKC 3IHPA 4PPEA 4NN2A 3SOWA 2KR4A 2KE1A 4FJCA 3ZYQA 5TDWA 4PTBA 3VK6A 1X4IA 2L5UA 3N9LA 1FP0A 3U5OA 2HYED 4AYCA 2EGPA 4IC3A 2L43A 1WEUA 3DPLR 2K17A 3T6RA 4A0CD 2Y1NA 1FBVA 2G6QA 4LK9A 1Z2QA 2MNZA 3ZPV1 3KV5A 2ECVA 5TRBA 4YC9A 4AP4A 1E4UA 2XEUA 1G25A 2NAAA 2QJ0A 4GNFA 2G43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F62 A;  3N9P A;  5TDR A;  4GND A;  4X3G A;  1U6G B;  2JMI A;  3HCT A;  3M99 A;  2BAY A;  3RPG B;  2I50 A;  2MNY A;  5J3X A;  4B7Y C;  3N9M A;  2M3H A;  4F52 B;  2YQL A;  2EOD A;  4QF2 A;  2VJE B;  4WA6 A;  3KQI A;  2ECI A;  5LKZ A;  2L0B A;  2VP7 A;  4ZQL A;  3KV6 A;  4S3O B;  3LQJ A;  2LN0 A;  3NG2 A;  2ECG A;  3ZVY A;  1IYM A;  4LJN A;  5LKT A;  2YW8 A;  3ZTG A;  3C6W A;  3PHD A;  1Z60 A;  5B79 A;  5FEY A;  5LCW B;  5I3L A;  1WEE A;  4L7X A;  5FB1 A;  2KIZ A;  2VJF A;  1JOC A;  5DIN A;  4I7D A;  2PNX A;  1WES A;  2LXP C;  2D8S A;  5JG6 A;  2KWO A;  5D1M B;  5KH7 A;  2HDP A;  1MM3 A;  1V87 A;  1HYI A;  2M6M A;  3L11 A;  5AIU A;  3LQH A;  5H1U A;  3N9O A;  2K1J A;  5FER A;  2CKL A;  2E6R A;  1WEO A;  3ZNI A;  1WEW A;  2OXQ C;  2MD7 B;  4B86 C;  5G05 B;  4CA1 A;  4GB0 A;  3DQV R;  2FUI A;  3SHB A;  1X4U A;  3MHS A;  3HCU A;  4AVX A;  2VPE A;  2H0D B;  4YAT A;  3RPG C;  3N9Q A;  5H1T A;  2YUR A;  5G0F A;  5C11 A;  2ECT A;  4N4F A;  2RSD A;  1ZBD B;  2KU3 A;  2MUM A;  2M1R A;  1LDJ B;  2CKL B;  2FSA A;  1LDK C;  4YBM A;  3V43 A;  4YAX A;  4A4B A;  4S3O C;  2EA6 A;  2LGG A;  2VNF A;  3GL6 A;  2K4D A;  4AYC B;  3M63 A;  5DKA A;  4V3K C;  2MD8 C;  2VPB A;  2L80 A;  3O34 A;  3O36 A;  1JM7 A;  4V3L C;  3KNV A;  4XI1 A;  4YBS A;  3PUR A;  4YAB A;  2KRE A;  2MA6 A;  1Z6U A;  3LQI A;  2Y43 A;  2FUU A;  1RMD A;  2ECW A;  4MVT A;  4BHW A;  2JRJ A;  5KH9 A;  2LXH C;  3ASL A;  3QZV A;  3I2D A;  3ZPV E;  2LGV A;  1WGM A;  4L58 A;  4Q6F A;  4WZ2 A;  1CHC A;  2DX8 A;  4I7B A;  5H1V A;  5TAB A;  2YT5 A;  5B77 A;  3N9N A;  4W4U A;  2F6N A;  1X4J A;  1WIM A;  2MA5 A;  3RTR B;  2VPG A;  2YHO A;  4FIP A;  2YSJ A;  2YYR A;  1VFY A;  4CCG X;  5FB0 A;  4GNE A;  5G04 B;  2QIC A;  2LQ6 A;  4N3W A;  2M85 A;  2LV9 A;  1HYJ A;  2LDR A;  1VYX A;  3O7A A;  4LAD B;  4GNG A;  4C9Z A;  5TBN A;  2KGI A;  1K2F A;  4YBT A;  1XWH A;  2YRE A;  2IDA A;  3U5M A;  3O35 A;  1WEN A;  2YUC A;  2YU4 A;  2VJF B;  2XB1 A;  2YSM A;  2G45 A;  3U5N A;  3PUQ A;  4A49 A;  3SOU A;  1T1H A;  2L75 A;  2VJE A;  5EYA F;  2KWK A;  5B75 A;  2KWJ A;  2CT2 A;  3O33 A;  2LGL A;  4TKP B;  4R7E A;  4IC2 A;  4BBQ A;  3FL2 A;  2K16 A;  2UZG A;  2JMD A;  4LLB A;  4WZ0 A;  2C2V S;  1N87 A;  2E6S A;  5B78 A;  3U5P A;  1DVP A;  2CSZ A;  2JMJ A;  3MHH A;  5B8D A;  2PUY A;  2RI7 A;  2KGG A;  3SOX A;  3EB6 A;  4P5O B;  2F42 A;  2ZET C;  3O70 A;  4UP5 A;  2VPD A;  1MM2 A;  3ZVZ B;  2Y1M A;  3LRQ A;  4MSX A;  4FK5 A;  5D1L B;  2MT5 A;  4FO9 A;  3C5K A;  1VD4 A;  5C13 A;  4I7C A;  1WEQ A;  4WZ3 B;  1WEM A;  2KWN A;  2CSY A;  4R8P K;  1BOR A;  5H9M A;  1WEV A;  4ZUX U;  1WEP A;  2KFT A;  4UI9 B;  4AUQ B;  5B76 A;  2LRI C;  1WE9 A;  1WFK A;  3HCS A;  2ECN A;  2C2L A;  5AIT A;  5KH3 A;  5D1K B;  3L1X A;  2AN6 A;  5LKX A;  4YAD A;  3M62 A;  4LKA A;  1WIL A;  3EB5 A;  4QF3 A;  3GV4 A;  3O37 A;  4O64 A;  1JM7 B;  2H0D A;  2YQM A;  4A4C A;  5LKU A;  4UP0 A;  4R2Y A;  3T7L A;  2YHN A;  2F6J A;  2QIZ A;  4ZDT A;  2ECJ A;  3L1Z B;  2MIQ A;  2KYU A;  2LGK A;  3HTK C;  3IHP A;  4PPE A;  4NN2 A;  3SOW A;  2KR4 A;  2KE1 A;  4FJC A;  3ZYQ A;  5TDW A;  4PTB A;  3VK6 A;  1X4I A;  2L5U A;  3N9L A;  1FP0 A;  3U5O A;  2HYE D;  4AYC A;  2EGP A;  4IC3 A;  2L43 A;  1WEU A;  3DPL R;  2K17 A;  3T6R A;  4A0C D;  2Y1N A;  1FBV A;  2G6Q A;  4LK9 A;  1Z2Q A;  2MNZ A;  3ZPV 1;  3KV5 A;  2ECV A;  5TRB A;  4YC9 A;  4AP4 A;  1E4U A;  2XEU A;  1G25 A;  2NAA A;  2QJ0 A;  4GNF A;  2G43 A; 
#chains in the Genus database with same CATH topology
 1F62 A;  3N9P A;  5TDR A;  4GND A;  4X3G A;  1U6G B;  2JMI A;  3HCT A;  3M99 A;  2BAY A;  3RPG B;  2I50 A;  2MNY A;  5J3X A;  4B7Y C;  3N9M A;  2M3H A;  4F52 B;  2YQL A;  2RR4 A;  2EOD A;  2CON A;  2MKE A;  2YVR A;  2DSM A;  4QF2 A;  2VJE B;  4WA6 A;  3KQI A;  5SVI A;  2ECI A;  5LKZ A;  2FFW A;  2L0B A;  2VP7 A;  4ZQL A;  3KV6 A;  4S3O B;  3LQJ A;  2LN0 A;  3NG2 A;  2ECG A;  3ZVY A;  1IYM A;  4LJN A;  5LKT A;  2YW8 A;  3ZTG A;  3C6W A;  3PHD A;  1Z60 A;  5B79 A;  5FEY A;  5K3Q A;  5LCW B;  3FEH A;  5I3L A;  3M7K A;  2IQJ A;  1WEE A;  4L7X A;  5FB1 A;  2EXU A;  2KIZ A;  2XOZ A;  2VJF A;  1JOC A;  5DIN A;  4I7D A;  2PNX A;  1WES A;  2LXP C;  3T9K A;  3SUB A;  2D8S A;  5JG6 A;  2KWO A;  5D1M B;  5KH7 A;  3FAO A;  2HDP A;  2JUN A;  1MM3 A;  1V87 A;  1HYI A;  2M6M A;  3L11 A;  5AIU A;  3LQH A;  5H1U A;  3N9O A;  2K1J A;  5FER A;  2CKL A;  2E6R A;  1WEO A;  3ZNI A;  1WEW A;  2OXQ C;  2MD7 B;  3KDE C;  3PLW A;  4B86 C;  5G05 B;  4CA1 A;  4GB0 A;  3DQV R;  2FUI A;  3SHB A;  1X4U A;  2P57 A;  2CRW A;  3MHS A;  3HCU A;  4AVX A;  2VPE A;  2H0D B;  4YAT A;  3RPG C;  3N9Q A;  5H1T A;  2YUR A;  5G0F A;  5C11 A;  2XP0 A;  2ECT A;  4N4F A;  2RSD A;  1ZBD B;  2KU3 A;  2MUM A;  2M1R A;  1LDJ B;  2CKL B;  2FSA A;  1LDK C;  2EGM A;  4YBM A;  3V43 A;  4YAX A;  2FD4 A;  4A4B A;  4Z0O A;  4S3O C;  2EA6 A;  2LGG A;  2VNF A;  3GL6 A;  2K4D A;  4AYC B;  3M63 A;  5DKA A;  4V3K C;  2MD8 C;  2VPB A;  2D8U A;  2L80 A;  5SVX A;  3O34 A;  3O36 A;  1JM7 A;  4V3L C;  3KNV A;  4XI1 A;  4YBS A;  2XOC A;  3PUR A;  4YAB A;  2KRE A;  2MA6 A;  1Z6U A;  3LQI A;  2Y43 A;  2FUU A;  1RMD A;  2ECW A;  4MVT A;  3MDB C;  4BHW A;  2JRJ A;  5KH9 A;  2LXH C;  3DWD A;  3ASL A;  3QZV A;  3I2D A;  3ZPV E;  2LGV A;  1WGM A;  4L58 A;  4Q6F A;  4WZ2 A;  1CHC A;  2DX8 A;  4I7B A;  5H1V A;  5TAB A;  2YT5 A;  5B77 A;  3N9N A;  4W4U A;  2F6N A;  1X4J A;  2M13 A;  1WIM A;  2CRR A;  2MA5 A;  3RTR B;  2VPG A;  2YHO A;  4FIP A;  2YSJ A;  2YYR A;  1VFY A;  5SVI B;  4CCG X;  5FB0 A;  4GNE A;  4O62 A;  5G04 B;  2QIC A;  2LQ6 A;  4N3W A;  2M85 A;  2LV9 A;  1HYJ A;  2LDR A;  1VYX A;  3O7A A;  2B0O E;  4LAD B;  4GNG A;  4C9Z A;  5TBN A;  2KGI A;  1K2F A;  4YBT A;  1XWH A;  2YRE A;  2IDA A;  3U5M A;  3O35 A;  1WEN A;  2YUC A;  2YU4 A;  2VJF B;  2XB1 A;  2YSM A;  2G45 A;  3U5N A;  3PUQ A;  4A49 A;  3SOU A;  3DDT A;  1T1H A;  2KKX A;  2L75 A;  2VJE A;  5EYA F;  2KWK A;  5B75 A;  2KWJ A;  2CT2 A;  3O33 A;  2XOY A;  2LGL A;  3LJU X;  4TKP B;  2CSV A;  4R7E A;  4H9D A;  4IC2 A;  4BBQ A;  3FL2 A;  1MBM A;  2E61 A;  2K16 A;  2OWA A;  2UZG A;  2JMD A;  4LLB A;  4WZ0 A;  2C2V S;  1N87 A;  2E6S A;  5B78 A;  3U5P A;  1DVP A;  2CSZ A;  2JMJ A;  3MHH A;  5B8D A;  2PUY A;  2RI7 A;  2KGG A;  3SOX A;  3FJU B;  3EB6 A;  4P5O B;  4F1P A;  2F42 A;  2L7P A;  2ZET C;  3O70 A;  4UP5 A;  4QQ4 A;  2VPD A;  1MM2 A;  3ZVZ B;  2Y1M A;  3LRQ A;  4MSX A;  4FK5 A;  3FAN A;  5SVY A;  5D1L B;  2MT5 A;  4FO9 A;  3C5K A;  1VD4 A;  5C13 A;  4I7C A;  1WEQ A;  4WZ3 B;  1WEM A;  2KWN A;  2CSY A;  3O47 A;  4R8P K;  1BOR A;  5H9M A;  4Z0R A;  1WEV A;  4ZUX U;  1WEP A;  2KFT A;  2LAU A;  4UI9 B;  4OGC A;  4AUQ B;  5B76 A;  1DCQ A;  2LRI C;  1WE9 A;  1WFK A;  3HCS A;  2ECN A;  2C2L A;  5AIT A;  5KH3 A;  2KKY A;  5D1K B;  3L1X A;  2AN6 A;  5LKX A;  4YAD A;  3M62 A;  4LKA A;  1WIL A;  3EB5 A;  4QF3 A;  3GV4 A;  3O37 A;  4O64 A;  1JM7 B;  2H0D A;  3LVR E;  2YQM A;  4A4C A;  5LKU A;  4UP0 A;  4R2Y A;  3T7L A;  2YHN A;  2F6J A;  2QIZ A;  4ZDT A;  2ECJ A;  3L1Z B;  2MIQ A;  2KYU A;  2LGK A;  3H7H A;  3HTK C;  3IHP A;  4PPE A;  4NN2 A;  3SOW A;  2KR4 A;  2KE1 A;  4FJC A;  3ZYQ A;  5TDW A;  3FM8 C;  4PTB A;  3VK6 A;  1X4I A;  2L5U A;  3N9L A;  1FP0 A;  3U5O A;  2HYE D;  4AYC A;  2EGP A;  2DJA A;  3LVQ E;  3JUE A;  3LDY A;  4IC3 A;  3Q1D A;  2L43 A;  1WEU A;  3DPL R;  2K17 A;  3T6R A;  4A0C D;  2Y1N A;  1FBV A;  4OGE A;  2G6Q A;  4LK9 A;  1Z2Q A;  2MNZ A;  3ZPV 1;  3KV5 A;  2JM3 A;  2ECV A;  5TRB A;  4YC9 A;  4AP4 A;  1E4U A;  2XEU A;  1G25 A;  2NAA A;  2QJ0 A;  4GNF A;  3E2D A;  2G43 A; 
#chains in the Genus database with same CATH homology
 1F62 A;  3N9P A;  5TDR A;  4GND A;  4X3G A;  1U6G B;  2JMI A;  3HCT A;  3M99 A;  2BAY A;  3RPG B;  2I50 A;  2MNY A;  5J3X A;  4B7Y C;  3N9M A;  2M3H A;  4F52 B;  2YQL A;  2EOD A;  4QF2 A;  2VJE B;  4WA6 A;  3KQI A;  2ECI A;  5LKZ A;  2L0B A;  2VP7 A;  4ZQL A;  3KV6 A;  4S3O B;  3LQJ A;  2LN0 A;  3NG2 A;  2ECG A;  3ZVY A;  1IYM A;  4LJN A;  5LKT A;  2YW8 A;  3ZTG A;  3C6W A;  3PHD A;  1Z60 A;  5B79 A;  5FEY A;  5LCW B;  5I3L A;  1WEE A;  4L7X A;  5FB1 A;  2KIZ A;  2VJF A;  1JOC A;  5DIN A;  4I7D A;  2PNX A;  1WES A;  2LXP C;  2D8S A;  5JG6 A;  2KWO A;  5D1M B;  5KH7 A;  2HDP A;  1MM3 A;  1V87 A;  1HYI A;  2M6M A;  3L11 A;  5AIU A;  3LQH A;  5H1U A;  3N9O A;  2K1J A;  5FER A;  2CKL A;  2E6R A;  1WEO A;  3ZNI A;  1WEW A;  2OXQ C;  2MD7 B;  4B86 C;  5G05 B;  4CA1 A;  4GB0 A;  3DQV R;  2FUI A;  3SHB A;  1X4U A;  3MHS A;  3HCU A;  4AVX A;  2VPE A;  2H0D B;  4YAT A;  3RPG C;  3N9Q A;  5H1T A;  2YUR A;  5G0F A;  5C11 A;  2ECT A;  4N4F A;  2RSD A;  1ZBD B;  2KU3 A;  2MUM A;  2M1R A;  1LDJ B;  2CKL B;  2FSA A;  1LDK C;  4YBM A;  3V43 A;  4YAX A;  4A4B A;  4S3O C;  2EA6 A;  2LGG A;  2VNF A;  3GL6 A;  2K4D A;  4AYC B;  3M63 A;  5DKA A;  4V3K C;  2MD8 C;  2VPB A;  2L80 A;  3O34 A;  3O36 A;  1JM7 A;  4V3L C;  3KNV A;  4XI1 A;  4YBS A;  3PUR A;  4YAB A;  2KRE A;  2MA6 A;  1Z6U A;  3LQI A;  2Y43 A;  2FUU A;  1RMD A;  2ECW A;  4MVT A;  4BHW A;  2JRJ A;  5KH9 A;  2LXH C;  3ASL A;  3QZV A;  3I2D A;  3ZPV E;  2LGV A;  1WGM A;  4L58 A;  4Q6F A;  4WZ2 A;  1CHC A;  2DX8 A;  4I7B A;  5H1V A;  5TAB A;  2YT5 A;  5B77 A;  3N9N A;  4W4U A;  2F6N A;  1X4J A;  1WIM A;  2MA5 A;  3RTR B;  2VPG A;  2YHO A;  4FIP A;  2YSJ A;  2YYR A;  1VFY A;  4CCG X;  5FB0 A;  4GNE A;  5G04 B;  2QIC A;  2LQ6 A;  4N3W A;  2M85 A;  2LV9 A;  1HYJ A;  2LDR A;  1VYX A;  3O7A A;  4LAD B;  4GNG A;  4C9Z A;  5TBN A;  2KGI A;  1K2F A;  4YBT A;  1XWH A;  2YRE A;  2IDA A;  3U5M A;  3O35 A;  1WEN A;  2YUC A;  2YU4 A;  2VJF B;  2XB1 A;  2YSM A;  2G45 A;  3U5N A;  3PUQ A;  4A49 A;  3SOU A;  1T1H A;  2L75 A;  2VJE A;  5EYA F;  2KWK A;  5B75 A;  2KWJ A;  2CT2 A;  3O33 A;  2LGL A;  4TKP B;  4R7E A;  4IC2 A;  4BBQ A;  3FL2 A;  2K16 A;  2UZG A;  2JMD A;  4LLB A;  4WZ0 A;  2C2V S;  1N87 A;  2E6S A;  5B78 A;  3U5P A;  1DVP A;  2CSZ A;  2JMJ A;  3MHH A;  5B8D A;  2PUY A;  2RI7 A;  2KGG A;  3SOX A;  3EB6 A;  4P5O B;  2F42 A;  2ZET C;  3O70 A;  4UP5 A;  2VPD A;  1MM2 A;  3ZVZ B;  2Y1M A;  3LRQ A;  4MSX A;  4FK5 A;  5D1L B;  2MT5 A;  4FO9 A;  3C5K A;  1VD4 A;  5C13 A;  4I7C A;  1WEQ A;  4WZ3 B;  1WEM A;  2KWN A;  2CSY A;  4R8P K;  1BOR A;  5H9M A;  1WEV A;  4ZUX U;  1WEP A;  2KFT A;  4UI9 B;  4AUQ B;  5B76 A;  2LRI C;  1WE9 A;  1WFK A;  3HCS A;  2ECN A;  2C2L A;  5AIT A;  5KH3 A;  5D1K B;  3L1X A;  2AN6 A;  5LKX A;  4YAD A;  3M62 A;  4LKA A;  1WIL A;  3EB5 A;  4QF3 A;  3GV4 A;  3O37 A;  4O64 A;  1JM7 B;  2H0D A;  2YQM A;  4A4C A;  5LKU A;  4UP0 A;  4R2Y A;  3T7L A;  2YHN A;  2F6J A;  2QIZ A;  4ZDT A;  2ECJ A;  3L1Z B;  2MIQ A;  2KYU A;  2LGK A;  3HTK C;  3IHP A;  4PPE A;  4NN2 A;  3SOW A;  2KR4 A;  2KE1 A;  4FJC A;  3ZYQ A;  5TDW A;  4PTB A;  3VK6 A;  1X4I A;  2L5U A;  3N9L A;  1FP0 A;  3U5O A;  2HYE D;  4AYC A;  2EGP A;  4IC3 A;  2L43 A;  1WEU A;  3DPL R;  2K17 A;  3T6R A;  4A0C D;  2Y1N A;  1FBV A;  2G6Q A;  4LK9 A;  1Z2Q A;  2MNZ A;  3ZPV 1;  3KV5 A;  2ECV A;  5TRB A;  4YC9 A;  4AP4 A;  1E4U A;  2XEU A;  1G25 A;  2NAA A;  2QJ0 A;  4GNF A;  2G43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...