5B77A

Crystal structrue of moz double phd finger in complex with histone h3 propionylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 26
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b77A00
2KE1A 2YYRA 1WEUA 1WILA 2YREA 2K1JA 1Z6UA 2JRJA 2K17A 3U5OA 5LKZA 4PTBA 4B86C 1V87A 1WENA 3O37A 2F6NA 3LQJA 3RTRB 2YHOA 4FIPA 4YAXA 4X3GA 2ECIA 3ZNIA 5C11A 3O7AA 1VYXA 2EODA 3HCTA 2KGIA 2FUIA 4GB0A 5KH3A 2LGLA 3DPLR 2ZETC 4GNFA 2YW8A 3SOXA 4QF3A 2ECWA 2YHNA 3KQIA 4YC9A 4R7EA 2MD7B 3RPGB 2VJFA 2VPGA 2G43A 2KIZA 4AYCB 4PPEA 4YABA 3N9QA 3N9MA 4LJNA 3N9LA 3ZTGA 2JMIA 5DINA 2KFTA 2I50A 4V3LC 3LQIA 3U5MA 3KV6A 4XI1A 3GV4A 3PHDA 4UP5A 5AIUA 2H0DB 4ZQLA 4AYCA 1K2FA 2FUUA 3MHHA 5B8DA 3SOWA 4WZ0A 1WIMA 3ZPV1 5H1TA 3GL6A 2QJ0A 3FL2A 2CSYA 4CA1A 4YBSA 3ZVYA 2LV9A 2VNFA 4CCGX 1E4UA 3SHBA 2MUMA 4S3OB 3ZPVE 5LKUA 5JG6A 1LDKC 1HYJA 1WEPA 1DVPA 2LRIC 2M6MA 2D8SA 1BORA 2LN0A 3O36A 2DX8A 5J3XA 1WEMA 4FO9A 2KU3A 4P5OB 5TRBA 2L80A 5I3LA 4S3OC 4B7YC 4YBMA 2VJEA 4NN2A 3L1XA 4LLBA 3SOUA 2ECGA 1WEQA 2KREA 2LQ6A 3EB6A 5TABA 5D1LB 1G25A 4I7BA 5B79A 1MM3A 2C2VS 4FJCA 1CHCA 3M62A 4UI9B 3ZYQA 3HCUA 2XEUA 3C5KA 5AITA 4A0CD 5H9MA 3M63A 3N9OA 1WEWA 1N87A 4R8PK 2RSDA 3O33A 4YADA 3ASLA 3EB5A 1WEVA 2LXHC 2H0DA 1WE9A 2MNYA 2KR4A 5H1VA 3T7LA 5G0FA 3PURA 1JM7A 2UZGA 4TKPB 2VJEB 4W4UA 2L75A 5EYAF 3RPGC 2JMJA 4WZ2A 5FB1A 2MA6A 2YSJA 2ECNA 4MSXA 3T6RA 2FSAA 2MNZA 3U5NA 4A49A 4WZ3B 2EA6A 4N4FA 4GNDA 4YBTA 1Z60A 1ZBDB 4LADB 3NG2A 3O34A 1VD4A 2VPBA 1FBVA 2E6RA 2VPEA 2HDPA 4IC3A 1IYMA 2CKLA 5TBNA 4ZDTA 5KH7A 2HYED 5B78A 4LKAA 1WEOA 1WFKA 2MD8C 2L0BA 3L1ZB 2MIQA 5C13A 1U6GB 2F42A 1FP0A 4ZUXU 3DQVR 2KWJA 2YUCA 2YU4A 2KWNA 5TDWA 3MHSA 2M3HA 2LXPC 3HTKC 2ECTA 3QZVA 2YT5A 2AN6A 2LGVA 4BBQA 2MT5A 4UP0A 2Y43A 2BAYA 2L5UA 4GNEA 4F52B 2CKLB 2OXQC 5H1UA 2LDRA 1X4UA 5LKXA 4AVXA 2E6SA 2G45A 1JOCA 5D1MB 2Y1NA 1X4IA 1JM7B 2Y1MA 4FK5A 3U5PA 2VP7A 2RI7A 3LRQA 1HYIA 1Z2QA 4Q6FA 5D1KB 2VJFB 4IC2A 5LKTA 2M85A 2QIZA 3L11A 4A4CA 2EGPA 4A4BA 3PUQA 1WEEA 5FERA 2CT2A 2CSZA 2XB1A 3VK6A 4R2YA 2F6JA 1WGMA 2C2LA 4V3KC 4AUQB 3M99A 1RMDA 4C9ZA 2K16A 4GNGA 3O70A 5B77A 2YQLA 3N9PA 2KWOA 3HCSA 2KWKA 2PNXA 5B76A 2G6QA 5G05B 3C6WA 2YQMA 2ECJA 2IDAA 2MA5A 1F62A 3I2DA 2LGKA 3KNVA 3LQHA 4LK9A 2NAAA 4QF2A 5FEYA 5G04B 3V43A 4WA6A 2KYUA 5LCWB 2K4DA 3KV5A 3O35A 5DKAA 5TDRA 2ECVA 2KGGA 2QICA 1WESA 1XWHA 2PUYA 1T1HA 4L7XA 4AP4A 2YURA 2VPDA 4N3WA 5FB0A 4YATA 4BHWA 2M1RA 1VFYA 4I7DA 4L58A 2L43A 1LDJB 2YSMA 5B75A 4I7CA 5KH9A 3N9NA 2JMDA 1MM2A 3ZVZB 3IHPA 4MVTA 2LGGA 4O64A 1X4JA
chains in the Genus database with same CATH superfamily
2KE1A 1DCQA 2YYRA 1WEUA 1WILA 2YREA 2K1JA 1Z6UA 2JRJA 2K17A 3U5OA 5LKZA 4PTBA 4B86C 1V87A 1WENA 3O37A 2F6NA 3LQJA 3RTRB 4OGEA 2YHOA 4FIPA 4YAXA 4X3GA 2ECIA 3ZNIA 3SUBA 5C11A 3O7AA 3O47A 1VYXA 2EODA 3HCTA 2KGIA 2FUIA 4GB0A 5KH3A 2LGLA 3DPLR 1MBMA 2ZETC 2YW8A 4GNFA 3SOXA 4F1PA 4QF3A 2ECWA 2YHNA 4H9DA 3KQIA 4YC9A 4R7EA 2MD7B 3RPGB 2VJFA 2VPGA 2G43A 2KIZA 4AYCB 4PPEA 3LJUX 4YABA 3N9QA 3N9MA 4LJNA 3MDBC 3N9LA 5DINA 2JMIA 3ZTGA 3FM8C 2KFTA 2I50A 4V3LC 3H7HA 3LQIA 3U5MA 3KV6A 4XI1A 3GV4A 3PHDA 4UP5A 5AIUA 4ZQLA 2H0DB 3LVQE 4AYCA 1K2FA 2FUUA 3MHHA 5B8DA 3SOWA 4WZ0A 2P57A 1WIMA 3ZPV1 2XOZA 5H1TA 3GL6A 2QJ0A 3FL2A 2CSYA 4CA1A 5K3QA 4YBSA 3ZVYA 4Z0OA 2LV9A 2VNFA 4CCGX 1E4UA 3SHBA 2MUMA 4QQ4A 4S3OB 3ZPVE 5LKUA 5JG6A 1LDKC 1HYJA 1WEPA 1DVPA 2LRIC 2M6MA 2D8SA 1BORA 2LN0A 2FD4A 3O36A 2DX8A 5J3XA 2IQJA 1WEMA 4FO9A 2KU3A 4P5OB 5TRBA 2L80A 5I3LA 4S3OC 4B7YC 4YBMA 2VJEA 4NN2A 3L1XA 4LLBA 3SOUA 2ECGA 2MKEA 1WEQA 2DSMA 2M13A 2KREA 2LQ6A 3EB6A 5TABA 5D1LB 1G25A 4I7BA 5B79A 1MM3A 2OWAA 2C2VS 4FJCA 1CHCA 3M62A 4UI9B 3ZYQA 3HCUA 2XEUA 3C5KA 5AITA 4A0CD 3FJUB 5H9MA 3M63A 3N9OA 1WEWA 1N87A 2RR4A 4R8PK 2RSDA 2CONA 3O33A 4YADA 3ASLA 3EB5A 1WEVA 2LXHC 2H0DA 1WE9A 3FANA 2MNYA 2KR4A 5H1VA 3T7LA 2EGMA 5G0FA 3PURA 1JM7A 2UZGA 4TKPB 2VJEB 3FEHA 3DWDA 4W4UA 3M7KA 2L75A 5EYAF 3RPGC 2JMJA 4WZ2A 5SVYA 5FB1A 2MA6A 2YSJA 2ECNA 2CRRA 4MSXA 3T6RA 2FSAA 2MNZA 3U5NA 4A49A 2KKXA 2XOYA 4WZ3B 2EA6A 4N4FA 4GNDA 3E2DA 4YBTA 1Z60A 1ZBDB 4LADB 3NG2A 3O34A 1VD4A 2VPBA 1FBVA 2E6RA 2VPEA 2HDPA 4IC3A 1IYMA 2CKLA 5TBNA 4ZDTA 5KH7A 2HYED 5B78A 4LKAA 1WEOA 1WFKA 2MD8C 2FFWA 2JM3A 4OGCA 2L0BA 3L1ZB 2MIQA 5SVXA 5C13A 1U6GB 2F42A 1FP0A 4ZUXU 3DQVR 2KWJA 2YUCA 2YU4A 2KWNA 5TDWA 2KKYA 2M3HA 2LXPC 3MHSA 3HTKC 2ECTA 3QZVA 2YT5A 3KDEC 2AN6A 2LGVA 4BBQA 2MT5A 4UP0A 2Y43A 2BAYA 2L5UA 4GNEA 4F52B 2CKLB 2XOCA 2OXQC 5H1UA 2LDRA 1X4UA 3LVRE 4Z0RA 3FAOA 5LKXA 2B0OE 2EXUA 4AVXA 2E6SA 2G45A 3JUEA 1JOCA 5D1MB 2Y1NA 1X4IA 1JM7B 2Y1MA 4FK5A 3U5PA 2VP7A 2RI7A 3LRQA 1HYIA 1Z2QA 4Q6FA 5D1KB 2VJFB 4IC2A 5LKTA 2M85A 2QIZA 2L7PA 3L11A 4A4CA 2EGPA 4A4BA 3PUQA 1WEEA 5FERA 2CT2A 4O62A 2CSZA 2XB1A 3VK6A 4R2YA 2F6JA 1WGMA 2LAUA 2C2LA 4V3KC 4AUQB 3M99A 3PLWA 1RMDA 4C9ZA 2K16A 4GNGA 3O70A 5B77A 2YQLA 3N9PA 2CRWA 2KWOA 3HCSA 2KWKA 2PNXA 5B76A 3DDTA 2G6QA 5G05B 3C6WA 2YQMA 2ECJA 2IDAA 2JUNA 2MA5A 1F62A 3I2DA 5SVIA 2LGKA 3KNVA 3LQHA 4LK9A 3LDYA 2NAAA 4QF2A 5FEYA 5G04B 3V43A 4WA6A 2KYUA 5LCWB 2K4DA 3KV5A 3O35A 5DKAA 5TDRA 2ECVA 2KGGA 2QICA 1WESA 1XWHA 2PUYA 3Q1DA 1T1HA 4L7XA 5SVIB 4AP4A 2YURA 2VPDA 4N3WA 5FB0A 2XP0A 4YATA 4BHWA 2YVRA 2M1RA 1VFYA 4I7DA 4L58A 2DJAA 2L43A 2E61A 1LDJB 2YSMA 5B75A 2D8UA 2CSVA 4I7CA 5KH9A 3N9NA 2JMDA 1MM2A 3ZVZB 3T9KA 3IHPA 4MVTA 2LGGA 4O64A 1X4JA
chains in the Genus database with same CATH topology
2KE1A 2YYRA 1WEUA 1WILA 2YREA 2K1JA 1Z6UA 2JRJA 2K17A 3U5OA 5LKZA 4PTBA 4B86C 1V87A 1WENA 3O37A 2F6NA 3LQJA 3RTRB 2YHOA 4FIPA 4YAXA 4X3GA 2ECIA 3ZNIA 5C11A 3O7AA 1VYXA 2EODA 3HCTA 2KGIA 2FUIA 4GB0A 5KH3A 2LGLA 3DPLR 2ZETC 4GNFA 2YW8A 3SOXA 4QF3A 2ECWA 2YHNA 3KQIA 4YC9A 4R7EA 2MD7B 3RPGB 2VJFA 2VPGA 2G43A 2KIZA 4AYCB 4PPEA 4YABA 3N9QA 3N9MA 4LJNA 3N9LA 3ZTGA 2JMIA 5DINA 2KFTA 2I50A 4V3LC 3LQIA 3U5MA 3KV6A 4XI1A 3GV4A 3PHDA 4UP5A 5AIUA 2H0DB 4ZQLA 4AYCA 1K2FA 2FUUA 3MHHA 5B8DA 3SOWA 4WZ0A 1WIMA 3ZPV1 5H1TA 3GL6A 2QJ0A 3FL2A 2CSYA 4CA1A 4YBSA 3ZVYA 2LV9A 2VNFA 4CCGX 1E4UA 3SHBA 2MUMA 4S3OB 3ZPVE 5LKUA 5JG6A 1LDKC 1HYJA 1WEPA 1DVPA 2LRIC 2M6MA 2D8SA 1BORA 2LN0A 3O36A 2DX8A 5J3XA 1WEMA 4FO9A 2KU3A 4P5OB 5TRBA 2L80A 5I3LA 4S3OC 4B7YC 4YBMA 2VJEA 4NN2A 3L1XA 4LLBA 3SOUA 2ECGA 1WEQA 2KREA 2LQ6A 3EB6A 5TABA 5D1LB 1G25A 4I7BA 5B79A 1MM3A 2C2VS 4FJCA 1CHCA 3M62A 4UI9B 3ZYQA 3HCUA 2XEUA 3C5KA 5AITA 4A0CD 5H9MA 3M63A 3N9OA 1WEWA 1N87A 4R8PK 2RSDA 3O33A 4YADA 3ASLA 3EB5A 1WEVA 2LXHC 2H0DA 1WE9A 2MNYA 2KR4A 5H1VA 3T7LA 5G0FA 3PURA 1JM7A 2UZGA 4TKPB 2VJEB 4W4UA 2L75A 5EYAF 3RPGC 2JMJA 4WZ2A 5FB1A 2MA6A 2YSJA 2ECNA 4MSXA 3T6RA 2FSAA 2MNZA 3U5NA 4A49A 4WZ3B 2EA6A 4N4FA 4GNDA 4YBTA 1Z60A 1ZBDB 4LADB 3NG2A 3O34A 1VD4A 2VPBA 1FBVA 2E6RA 2VPEA 2HDPA 4IC3A 1IYMA 2CKLA 5TBNA 4ZDTA 5KH7A 2HYED 5B78A 4LKAA 1WEOA 1WFKA 2MD8C 2L0BA 3L1ZB 2MIQA 5C13A 1U6GB 2F42A 1FP0A 4ZUXU 3DQVR 2KWJA 2YUCA 2YU4A 2KWNA 5TDWA 3MHSA 2M3HA 2LXPC 3HTKC 2ECTA 3QZVA 2YT5A 2AN6A 2LGVA 4BBQA 2MT5A 4UP0A 2Y43A 2BAYA 2L5UA 4GNEA 4F52B 2CKLB 2OXQC 5H1UA 2LDRA 1X4UA 5LKXA 4AVXA 2E6SA 2G45A 1JOCA 5D1MB 2Y1NA 1X4IA 1JM7B 2Y1MA 4FK5A 3U5PA 2VP7A 2RI7A 3LRQA 1HYIA 1Z2QA 4Q6FA 5D1KB 2VJFB 4IC2A 5LKTA 2M85A 2QIZA 3L11A 4A4CA 2EGPA 4A4BA 3PUQA 1WEEA 5FERA 2CT2A 2CSZA 2XB1A 3VK6A 4R2YA 2F6JA 1WGMA 2C2LA 4V3KC 4AUQB 3M99A 1RMDA 4C9ZA 2K16A 4GNGA 3O70A 5B77A 2YQLA 3N9PA 2KWOA 3HCSA 2KWKA 2PNXA 5B76A 2G6QA 5G05B 3C6WA 2YQMA 2ECJA 2IDAA 2MA5A 1F62A 3I2DA 2LGKA 3KNVA 3LQHA 4LK9A 2NAAA 4QF2A 5FEYA 5G04B 3V43A 4WA6A 2KYUA 5LCWB 2K4DA 3KV5A 3O35A 5DKAA 5TDRA 2ECVA 2KGGA 2QICA 1WESA 1XWHA 2PUYA 1T1HA 4L7XA 4AP4A 2YURA 2VPDA 4N3WA 5FB0A 4YATA 4BHWA 2M1RA 1VFYA 4I7DA 4L58A 2L43A 1LDJB 2YSMA 5B75A 4I7CA 5KH9A 3N9NA 2JMDA 1MM2A 3ZVZB 3IHPA 4MVTA 2LGGA 4O64A 1X4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE1 A;  2YYR A;  1WEU A;  1WIL A;  2YRE A;  2K1J A;  1Z6U A;  2JRJ A;  2K17 A;  3U5O A;  5LKZ A;  4PTB A;  4B86 C;  1V87 A;  1WEN A;  3O37 A;  2F6N A;  3LQJ A;  3RTR B;  2YHO A;  4FIP A;  4YAX A;  4X3G A;  2ECI A;  3ZNI A;  5C11 A;  3O7A A;  1VYX A;  2EOD A;  3HCT A;  2KGI A;  2FUI A;  4GB0 A;  5KH3 A;  2LGL A;  3DPL R;  2ZET C;  4GNF A;  2YW8 A;  3SOX A;  4QF3 A;  2ECW A;  2YHN A;  3KQI A;  4YC9 A;  4R7E A;  2MD7 B;  3RPG B;  2VJF A;  2VPG A;  2G43 A;  2KIZ A;  4AYC B;  4PPE A;  4YAB A;  3N9Q A;  3N9M A;  4LJN A;  3N9L A;  3ZTG A;  2JMI A;  5DIN A;  2KFT A;  2I50 A;  4V3L C;  3LQI A;  3U5M A;  3KV6 A;  4XI1 A;  3GV4 A;  3PHD A;  4UP5 A;  5AIU A;  2H0D B;  4ZQL A;  4AYC A;  1K2F A;  2FUU A;  3MHH A;  5B8D A;  3SOW A;  4WZ0 A;  1WIM A;  3ZPV 1;  5H1T A;  3GL6 A;  2QJ0 A;  3FL2 A;  2CSY A;  4CA1 A;  4YBS A;  3ZVY A;  2LV9 A;  2VNF A;  4CCG X;  1E4U A;  3SHB A;  2MUM A;  4S3O B;  3ZPV E;  5LKU A;  5JG6 A;  1LDK C;  1HYJ A;  1WEP A;  1DVP A;  2LRI C;  2M6M A;  2D8S A;  1BOR A;  2LN0 A;  3O36 A;  2DX8 A;  5J3X A;  1WEM A;  4FO9 A;  2KU3 A;  4P5O B;  5TRB A;  2L80 A;  5I3L A;  4S3O C;  4B7Y C;  4YBM A;  2VJE A;  4NN2 A;  3L1X A;  4LLB A;  3SOU A;  2ECG A;  1WEQ A;  2KRE A;  2LQ6 A;  3EB6 A;  5TAB A;  5D1L B;  1G25 A;  4I7B A;  5B79 A;  1MM3 A;  2C2V S;  4FJC A;  1CHC A;  3M62 A;  4UI9 B;  3ZYQ A;  3HCU A;  2XEU A;  3C5K A;  5AIT A;  4A0C D;  5H9M A;  3M63 A;  3N9O A;  1WEW A;  1N87 A;  4R8P K;  2RSD A;  3O33 A;  4YAD A;  3ASL A;  3EB5 A;  1WEV A;  2LXH C;  2H0D A;  1WE9 A;  2MNY A;  2KR4 A;  5H1V A;  3T7L A;  5G0F A;  3PUR A;  1JM7 A;  2UZG A;  4TKP B;  2VJE B;  4W4U A;  2L75 A;  5EYA F;  3RPG C;  2JMJ A;  4WZ2 A;  5FB1 A;  2MA6 A;  2YSJ A;  2ECN A;  4MSX A;  3T6R A;  2FSA A;  2MNZ A;  3U5N A;  4A49 A;  4WZ3 B;  2EA6 A;  4N4F A;  4GND A;  4YBT A;  1Z60 A;  1ZBD B;  4LAD B;  3NG2 A;  3O34 A;  1VD4 A;  2VPB A;  1FBV A;  2E6R A;  2VPE A;  2HDP A;  4IC3 A;  1IYM A;  2CKL A;  5TBN A;  4ZDT A;  5KH7 A;  2HYE D;  5B78 A;  4LKA A;  1WEO A;  1WFK A;  2MD8 C;  2L0B A;  3L1Z B;  2MIQ A;  5C13 A;  1U6G B;  2F42 A;  1FP0 A;  4ZUX U;  3DQV R;  2KWJ A;  2YUC A;  2YU4 A;  2KWN A;  5TDW A;  3MHS A;  2M3H A;  2LXP C;  3HTK C;  2ECT A;  3QZV A;  2YT5 A;  2AN6 A;  2LGV A;  4BBQ A;  2MT5 A;  4UP0 A;  2Y43 A;  2BAY A;  2L5U A;  4GNE A;  4F52 B;  2CKL B;  2OXQ C;  5H1U A;  2LDR A;  1X4U A;  5LKX A;  4AVX A;  2E6S A;  2G45 A;  1JOC A;  5D1M B;  2Y1N A;  1X4I A;  1JM7 B;  2Y1M A;  4FK5 A;  3U5P A;  2VP7 A;  2RI7 A;  3LRQ A;  1HYI A;  1Z2Q A;  4Q6F A;  5D1K B;  2VJF B;  4IC2 A;  5LKT A;  2M85 A;  2QIZ A;  3L11 A;  4A4C A;  2EGP A;  4A4B A;  3PUQ A;  1WEE A;  5FER A;  2CT2 A;  2CSZ A;  2XB1 A;  3VK6 A;  4R2Y A;  2F6J A;  1WGM A;  2C2L A;  4V3K C;  4AUQ B;  3M99 A;  1RMD A;  4C9Z A;  2K16 A;  4GNG A;  3O70 A;  5B77 A;  2YQL A;  3N9P A;  2KWO A;  3HCS A;  2KWK A;  2PNX A;  5B76 A;  2G6Q A;  5G05 B;  3C6W A;  2YQM A;  2ECJ A;  2IDA A;  2MA5 A;  1F62 A;  3I2D A;  2LGK A;  3KNV A;  3LQH A;  4LK9 A;  2NAA A;  4QF2 A;  5FEY A;  5G04 B;  3V43 A;  4WA6 A;  2KYU A;  5LCW B;  2K4D A;  3KV5 A;  3O35 A;  5DKA A;  5TDR A;  2ECV A;  2KGG A;  2QIC A;  1WES A;  1XWH A;  2PUY A;  1T1H A;  4L7X A;  4AP4 A;  2YUR A;  2VPD A;  4N3W A;  5FB0 A;  4YAT A;  4BHW A;  2M1R A;  1VFY A;  4I7D A;  4L58 A;  2L43 A;  1LDJ B;  2YSM A;  5B75 A;  4I7C A;  5KH9 A;  3N9N A;  2JMD A;  1MM2 A;  3ZVZ B;  3IHP A;  4MVT A;  2LGG A;  4O64 A;  1X4J A; 
#chains in the Genus database with same CATH topology
 2KE1 A;  1DCQ A;  2YYR A;  1WEU A;  1WIL A;  2YRE A;  2K1J A;  1Z6U A;  2JRJ A;  2K17 A;  3U5O A;  5LKZ A;  4PTB A;  4B86 C;  1V87 A;  1WEN A;  3O37 A;  2F6N A;  3LQJ A;  3RTR B;  4OGE A;  2YHO A;  4FIP A;  4YAX A;  4X3G A;  2ECI A;  3ZNI A;  3SUB A;  5C11 A;  3O7A A;  3O47 A;  1VYX A;  2EOD A;  3HCT A;  2KGI A;  2FUI A;  4GB0 A;  5KH3 A;  2LGL A;  3DPL R;  1MBM A;  2ZET C;  2YW8 A;  4GNF A;  3SOX A;  4F1P A;  4QF3 A;  2ECW A;  2YHN A;  4H9D A;  3KQI A;  4YC9 A;  4R7E A;  2MD7 B;  3RPG B;  2VJF A;  2VPG A;  2G43 A;  2KIZ A;  4AYC B;  4PPE A;  3LJU X;  4YAB A;  3N9Q A;  3N9M A;  4LJN A;  3MDB C;  3N9L A;  5DIN A;  2JMI A;  3ZTG A;  3FM8 C;  2KFT A;  2I50 A;  4V3L C;  3H7H A;  3LQI A;  3U5M A;  3KV6 A;  4XI1 A;  3GV4 A;  3PHD A;  4UP5 A;  5AIU A;  4ZQL A;  2H0D B;  3LVQ E;  4AYC A;  1K2F A;  2FUU A;  3MHH A;  5B8D A;  3SOW A;  4WZ0 A;  2P57 A;  1WIM A;  3ZPV 1;  2XOZ A;  5H1T A;  3GL6 A;  2QJ0 A;  3FL2 A;  2CSY A;  4CA1 A;  5K3Q A;  4YBS A;  3ZVY A;  4Z0O A;  2LV9 A;  2VNF A;  4CCG X;  1E4U A;  3SHB A;  2MUM A;  4QQ4 A;  4S3O B;  3ZPV E;  5LKU A;  5JG6 A;  1LDK C;  1HYJ A;  1WEP A;  1DVP A;  2LRI C;  2M6M A;  2D8S A;  1BOR A;  2LN0 A;  2FD4 A;  3O36 A;  2DX8 A;  5J3X A;  2IQJ A;  1WEM A;  4FO9 A;  2KU3 A;  4P5O B;  5TRB A;  2L80 A;  5I3L A;  4S3O C;  4B7Y C;  4YBM A;  2VJE A;  4NN2 A;  3L1X A;  4LLB A;  3SOU A;  2ECG A;  2MKE A;  1WEQ A;  2DSM A;  2M13 A;  2KRE A;  2LQ6 A;  3EB6 A;  5TAB A;  5D1L B;  1G25 A;  4I7B A;  5B79 A;  1MM3 A;  2OWA A;  2C2V S;  4FJC A;  1CHC A;  3M62 A;  4UI9 B;  3ZYQ A;  3HCU A;  2XEU A;  3C5K A;  5AIT A;  4A0C D;  3FJU B;  5H9M A;  3M63 A;  3N9O A;  1WEW A;  1N87 A;  2RR4 A;  4R8P K;  2RSD A;  2CON A;  3O33 A;  4YAD A;  3ASL A;  3EB5 A;  1WEV A;  2LXH C;  2H0D A;  1WE9 A;  3FAN A;  2MNY A;  2KR4 A;  5H1V A;  3T7L A;  2EGM A;  5G0F A;  3PUR A;  1JM7 A;  2UZG A;  4TKP B;  2VJE B;  3FEH A;  3DWD A;  4W4U A;  3M7K A;  2L75 A;  5EYA F;  3RPG C;  2JMJ A;  4WZ2 A;  5SVY A;  5FB1 A;  2MA6 A;  2YSJ A;  2ECN A;  2CRR A;  4MSX A;  3T6R A;  2FSA A;  2MNZ A;  3U5N A;  4A49 A;  2KKX A;  2XOY A;  4WZ3 B;  2EA6 A;  4N4F A;  4GND A;  3E2D A;  4YBT A;  1Z60 A;  1ZBD B;  4LAD B;  3NG2 A;  3O34 A;  1VD4 A;  2VPB A;  1FBV A;  2E6R A;  2VPE A;  2HDP A;  4IC3 A;  1IYM A;  2CKL A;  5TBN A;  4ZDT A;  5KH7 A;  2HYE D;  5B78 A;  4LKA A;  1WEO A;  1WFK A;  2MD8 C;  2FFW A;  2JM3 A;  4OGC A;  2L0B A;  3L1Z B;  2MIQ A;  5SVX A;  5C13 A;  1U6G B;  2F42 A;  1FP0 A;  4ZUX U;  3DQV R;  2KWJ A;  2YUC A;  2YU4 A;  2KWN A;  5TDW A;  2KKY A;  2M3H A;  2LXP C;  3MHS A;  3HTK C;  2ECT A;  3QZV A;  2YT5 A;  3KDE C;  2AN6 A;  2LGV A;  4BBQ A;  2MT5 A;  4UP0 A;  2Y43 A;  2BAY A;  2L5U A;  4GNE A;  4F52 B;  2CKL B;  2XOC A;  2OXQ C;  5H1U A;  2LDR A;  1X4U A;  3LVR E;  4Z0R A;  3FAO A;  5LKX A;  2B0O E;  2EXU A;  4AVX A;  2E6S A;  2G45 A;  3JUE A;  1JOC A;  5D1M B;  2Y1N A;  1X4I A;  1JM7 B;  2Y1M A;  4FK5 A;  3U5P A;  2VP7 A;  2RI7 A;  3LRQ A;  1HYI A;  1Z2Q A;  4Q6F A;  5D1K B;  2VJF B;  4IC2 A;  5LKT A;  2M85 A;  2QIZ A;  2L7P A;  3L11 A;  4A4C A;  2EGP A;  4A4B A;  3PUQ A;  1WEE A;  5FER A;  2CT2 A;  4O62 A;  2CSZ A;  2XB1 A;  3VK6 A;  4R2Y A;  2F6J A;  1WGM A;  2LAU A;  2C2L A;  4V3K C;  4AUQ B;  3M99 A;  3PLW A;  1RMD A;  4C9Z A;  2K16 A;  4GNG A;  3O70 A;  5B77 A;  2YQL A;  3N9P A;  2CRW A;  2KWO A;  3HCS A;  2KWK A;  2PNX A;  5B76 A;  3DDT A;  2G6Q A;  5G05 B;  3C6W A;  2YQM A;  2ECJ A;  2IDA A;  2JUN A;  2MA5 A;  1F62 A;  3I2D A;  5SVI A;  2LGK A;  3KNV A;  3LQH A;  4LK9 A;  3LDY A;  2NAA A;  4QF2 A;  5FEY A;  5G04 B;  3V43 A;  4WA6 A;  2KYU A;  5LCW B;  2K4D A;  3KV5 A;  3O35 A;  5DKA A;  5TDR A;  2ECV A;  2KGG A;  2QIC A;  1WES A;  1XWH A;  2PUY A;  3Q1D A;  1T1H A;  4L7X A;  5SVI B;  4AP4 A;  2YUR A;  2VPD A;  4N3W A;  5FB0 A;  2XP0 A;  4YAT A;  4BHW A;  2YVR A;  2M1R A;  1VFY A;  4I7D A;  4L58 A;  2DJA A;  2L43 A;  2E61 A;  1LDJ B;  2YSM A;  5B75 A;  2D8U A;  2CSV A;  4I7C A;  5KH9 A;  3N9N A;  2JMD A;  1MM2 A;  3ZVZ B;  3T9K A;  3IHP A;  4MVT A;  2LGG A;  4O64 A;  1X4J A; 
#chains in the Genus database with same CATH homology
 2KE1 A;  2YYR A;  1WEU A;  1WIL A;  2YRE A;  2K1J A;  1Z6U A;  2JRJ A;  2K17 A;  3U5O A;  5LKZ A;  4PTB A;  4B86 C;  1V87 A;  1WEN A;  3O37 A;  2F6N A;  3LQJ A;  3RTR B;  2YHO A;  4FIP A;  4YAX A;  4X3G A;  2ECI A;  3ZNI A;  5C11 A;  3O7A A;  1VYX A;  2EOD A;  3HCT A;  2KGI A;  2FUI A;  4GB0 A;  5KH3 A;  2LGL A;  3DPL R;  2ZET C;  4GNF A;  2YW8 A;  3SOX A;  4QF3 A;  2ECW A;  2YHN A;  3KQI A;  4YC9 A;  4R7E A;  2MD7 B;  3RPG B;  2VJF A;  2VPG A;  2G43 A;  2KIZ A;  4AYC B;  4PPE A;  4YAB A;  3N9Q A;  3N9M A;  4LJN A;  3N9L A;  3ZTG A;  2JMI A;  5DIN A;  2KFT A;  2I50 A;  4V3L C;  3LQI A;  3U5M A;  3KV6 A;  4XI1 A;  3GV4 A;  3PHD A;  4UP5 A;  5AIU A;  2H0D B;  4ZQL A;  4AYC A;  1K2F A;  2FUU A;  3MHH A;  5B8D A;  3SOW A;  4WZ0 A;  1WIM A;  3ZPV 1;  5H1T A;  3GL6 A;  2QJ0 A;  3FL2 A;  2CSY A;  4CA1 A;  4YBS A;  3ZVY A;  2LV9 A;  2VNF A;  4CCG X;  1E4U A;  3SHB A;  2MUM A;  4S3O B;  3ZPV E;  5LKU A;  5JG6 A;  1LDK C;  1HYJ A;  1WEP A;  1DVP A;  2LRI C;  2M6M A;  2D8S A;  1BOR A;  2LN0 A;  3O36 A;  2DX8 A;  5J3X A;  1WEM A;  4FO9 A;  2KU3 A;  4P5O B;  5TRB A;  2L80 A;  5I3L A;  4S3O C;  4B7Y C;  4YBM A;  2VJE A;  4NN2 A;  3L1X A;  4LLB A;  3SOU A;  2ECG A;  1WEQ A;  2KRE A;  2LQ6 A;  3EB6 A;  5TAB A;  5D1L B;  1G25 A;  4I7B A;  5B79 A;  1MM3 A;  2C2V S;  4FJC A;  1CHC A;  3M62 A;  4UI9 B;  3ZYQ A;  3HCU A;  2XEU A;  3C5K A;  5AIT A;  4A0C D;  5H9M A;  3M63 A;  3N9O A;  1WEW A;  1N87 A;  4R8P K;  2RSD A;  3O33 A;  4YAD A;  3ASL A;  3EB5 A;  1WEV A;  2LXH C;  2H0D A;  1WE9 A;  2MNY A;  2KR4 A;  5H1V A;  3T7L A;  5G0F A;  3PUR A;  1JM7 A;  2UZG A;  4TKP B;  2VJE B;  4W4U A;  2L75 A;  5EYA F;  3RPG C;  2JMJ A;  4WZ2 A;  5FB1 A;  2MA6 A;  2YSJ A;  2ECN A;  4MSX A;  3T6R A;  2FSA A;  2MNZ A;  3U5N A;  4A49 A;  4WZ3 B;  2EA6 A;  4N4F A;  4GND A;  4YBT A;  1Z60 A;  1ZBD B;  4LAD B;  3NG2 A;  3O34 A;  1VD4 A;  2VPB A;  1FBV A;  2E6R A;  2VPE A;  2HDP A;  4IC3 A;  1IYM A;  2CKL A;  5TBN A;  4ZDT A;  5KH7 A;  2HYE D;  5B78 A;  4LKA A;  1WEO A;  1WFK A;  2MD8 C;  2L0B A;  3L1Z B;  2MIQ A;  5C13 A;  1U6G B;  2F42 A;  1FP0 A;  4ZUX U;  3DQV R;  2KWJ A;  2YUC A;  2YU4 A;  2KWN A;  5TDW A;  3MHS A;  2M3H A;  2LXP C;  3HTK C;  2ECT A;  3QZV A;  2YT5 A;  2AN6 A;  2LGV A;  4BBQ A;  2MT5 A;  4UP0 A;  2Y43 A;  2BAY A;  2L5U A;  4GNE A;  4F52 B;  2CKL B;  2OXQ C;  5H1U A;  2LDR A;  1X4U A;  5LKX A;  4AVX A;  2E6S A;  2G45 A;  1JOC A;  5D1M B;  2Y1N A;  1X4I A;  1JM7 B;  2Y1M A;  4FK5 A;  3U5P A;  2VP7 A;  2RI7 A;  3LRQ A;  1HYI A;  1Z2Q A;  4Q6F A;  5D1K B;  2VJF B;  4IC2 A;  5LKT A;  2M85 A;  2QIZ A;  3L11 A;  4A4C A;  2EGP A;  4A4B A;  3PUQ A;  1WEE A;  5FER A;  2CT2 A;  2CSZ A;  2XB1 A;  3VK6 A;  4R2Y A;  2F6J A;  1WGM A;  2C2L A;  4V3K C;  4AUQ B;  3M99 A;  1RMD A;  4C9Z A;  2K16 A;  4GNG A;  3O70 A;  5B77 A;  2YQL A;  3N9P A;  2KWO A;  3HCS A;  2KWK A;  2PNX A;  5B76 A;  2G6Q A;  5G05 B;  3C6W A;  2YQM A;  2ECJ A;  2IDA A;  2MA5 A;  1F62 A;  3I2D A;  2LGK A;  3KNV A;  3LQH A;  4LK9 A;  2NAA A;  4QF2 A;  5FEY A;  5G04 B;  3V43 A;  4WA6 A;  2KYU A;  5LCW B;  2K4D A;  3KV5 A;  3O35 A;  5DKA A;  5TDR A;  2ECV A;  2KGG A;  2QIC A;  1WES A;  1XWH A;  2PUY A;  1T1H A;  4L7X A;  4AP4 A;  2YUR A;  2VPD A;  4N3W A;  5FB0 A;  4YAT A;  4BHW A;  2M1R A;  1VFY A;  4I7D A;  4L58 A;  2L43 A;  1LDJ B;  2YSM A;  5B75 A;  4I7C A;  5KH9 A;  3N9N A;  2JMD A;  1MM2 A;  3ZVZ B;  3IHP A;  4MVT A;  2LGG A;  4O64 A;  1X4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...