5B77A

Crystal structrue of moz double phd finger in complex with histone h3 propionylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b77A00
1T1HA 2KREA 2MNYA 3LQHA 4V3KC 2CKLB 2CSZA 2XB1A 1RMDA 4IC3A 4GNFA 2JMIA 2LGKA 2EODA 2KWJA 5C11A 3U5NA 2K1JA 1WIMA 4CA1A 4AUQB 4PPEA 3KNVA 4NN2A 3RPGB 2L0BA 2LGLA 2QIZA 5LCWB 1FBVA 1FP0A 2FUUA 3QZVA 3M62A 2YQLA 4R2YA 4FJCA 2Y43A 4O64A 2KWKA 3N9NA 2VPDA 3ZVZB 4FO9A 3O33A 2YREA 1VYXA 3U5MA 2M85A 1WEEA 2PNXA 4YBMA 2ECTA 3ZNIA 2OXQC 2MA6A 3HCTA 5D1MB 4L58A 3KV6A 2K17A 5H1TA 4A4CA 5DINA 5FB1A 2L43A 1WEQA 2FSAA 3C5KA 4Q6FA 1MM3A 1JM7A 2HDPA 2MIQA 5KH3A 3PHDA 1XWHA 4WZ2A 1BORA 3U5PA 3L11A 3N9MA 3NG2A 3ZPV1 3O35A 4YADA 2PUYA 5TBNA 2LXHC 4S3OC 5J3XA 5G05B 4FIPA 5D1LB 5C13A 2VPBA 2LGGA 2E6SA 2F6JA 1WEOA 2FUIA 4P5OB 3U5OA 3ZTGA 3ZYQA 3PURA 2H0DB 4AYCA 3EB5A 3LQIA 4MVTA 2ECIA 5I3LA 4GNEA 4UI9B 1X4UA 4AP4A 2MA5A 2CT2A 2HYED 3N9LA 3O37A 1LDJB 2M1RA 4TKPB 2JMDA 3MHHA 1CHCA 2ECNA 4YATA 2KYUA 3M63A 2C2LA 4CCGX 2LDRA 4XI1A 2VPEA 4I7CA 2F42A 5G0FA 3C6WA 2LXPC 2EGPA 4LK9A 2QJ0A 1VFYA 4LADB 4BBQA 2KIZA 3N9PA 2YHNA 2KE1A 5AIUA 4WZ0A 4UP5A 3LQJA 5FERA 2YW8A 4I7DA 2K4DA 5KH7A 5H1VA 5B78A 2ECGA 4LLBA 4YC9A 5TABA 1Z2QA 2YHOA 5B76A 2BAYA 2LQ6A 3GL6A 2K16A 5LKUA 2KWNA 1WEVA 2G43A 2MT5A 3KQIA 2KGGA 1WFKA 5B77A 2KWOA 2MNZA 4ZDTA 5AITA 3DQVR 3SHBA 4GNDA 2LGVA 4A4BA 4QF2A 4R7EA 2LV9A 2G45A 1HYIA 2ZETC 3V43A 1JOCA 2L5UA 4B86C 5TDWA 3M99A 3EB6A 1V87A 3DPLR 2YQMA 1HYJA 3SOUA 3FL2A 5G04B 1JM7B 1WEUA 2XEUA 3SOXA 2MD8C 1DVPA 2CSYA 3RPGC 4MSXA 2LN0A 4WZ3B 5TRBA 4A49A 1WE9A 2YSMA 4C9ZA 4V3LC 1E4UA 3ZVYA 3PUQA 2Y1MA 2MUMA 5TDRA 3HCSA 1WILA 4YBSA 2D8SA 2ECVA 4N3WA 4A0CD 3HCUA 4GB0A 4LKAA 2Y1NA 5FB0A 2M6MA 4WA6A 1WGMA 4ZUXU 5LKTA 1IYMA 1WESA 2YURA 4AYCB 2JMJA 1K2FA 3IHPA 2YU4A 2KU3A 2YUCA 4UP0A 1ZBDB 4GNGA 4YBTA 2ECJA 2MD7B 2VJEA 4S3OB 5B75A 2C2VS 2L75A 2E6RA 3HTKC 3O7AA 4AVXA 2ECWA 5H1UA 4W4UA 2QICA 5H9MA 3L1ZB 1WEMA 4QF3A 1WEWA 5FEYA 1X4IA 3O34A 2VP7A 2I50A 5LKZA 2VJEB 2VNFA 3O70A 5DKAA 4R8PK 2KR4A 3I2DA 4LJNA 4YAXA 5D1KB 2LRIC 4IC2A 3T7LA 1G25A 3L1XA 2YT5A 5JG6A 1LDKC 2JRJA 5KH9A 1VD4A 2VJFA 1WEPA 5B8DA 3MHSA 5LKXA 1U6GB 2YYRA 2EA6A 2G6QA 1F62A 1Z6UA 2RSDA 2M3HA 2KFTA 4ZQLA 3GV4A 3ZPVE 1X4JA 2H0DA 2L80A 4BHWA 3O36A 4YABA 4FK5A 2NAAA 2VJFB 4N4FA 2IDAA 5EYAF 4I7BA 2RI7A 1MM2A 2CKLA 2KGIA 1Z60A 4X3GA 5B79A 2DX8A 4B7YC 3ASLA 2AN6A 3N9OA 3KV5A 2VPGA 2YSJA 3VK6A 2F6NA 1N87A 3LRQA 4PTBA 4F52B 3RTRB 3T6RA 3SOWA 2UZGA 4L7XA 3N9QA 1WENA
chains in the Genus database with same CATH superfamily
3LVQE 1T1HA 2KREA 2MNYA 3LQHA 3MDBC 4V3KC 2CKLB 2CSZA 2XB1A 1RMDA 4IC3A 4GNFA 2JMIA 2XOCA 2LGKA 2EODA 2KWJA 5C11A 1MBMA 3U5NA 2K1JA 1WIMA 4CA1A 4AUQB 4PPEA 3KNVA 4NN2A 3RPGB 2L0BA 2LGLA 2QIZA 5LCWB 2B0OE 1FBVA 1FP0A 2XP0A 2FUUA 3QZVA 3M62A 2YQLA 4R2YA 4FJCA 2Y43A 4O64A 2KWKA 3N9NA 2VPDA 3ZVZB 4FO9A 3O33A 2YREA 1VYXA 3U5MA 2M85A 1WEEA 2P57A 2PNXA 4YBMA 2ECTA 4F1PA 3ZNIA 2OXQC 2MA6A 3HCTA 5D1MB 4L58A 3KV6A 2K17A 5H1TA 4A4CA 1DCQA 5DINA 5FB1A 2L43A 1WEQA 2FSAA 4Z0OA 4H9DA 3C5KA 4Q6FA 1MM3A 1JM7A 2HDPA 2MIQA 5KH3A 5SVYA 3PHDA 2JM3A 1XWHA 4WZ2A 5SVXA 1BORA 3U5PA 3L11A 3N9MA 3NG2A 2DJAA 2L7PA 3ZPV1 3O35A 4YADA 2PUYA 5TBNA 2XOYA 2LXHC 4S3OC 5J3XA 5G05B 2FD4A 4FIPA 5D1LB 5C13A 2VPBA 2LGGA 3FJUB 2E6SA 2F6JA 4OGCA 1WEOA 2FUIA 3PLWA 4P5OB 3U5OA 3DDTA 3KDEC 3ZTGA 3ZYQA 3PURA 2H0DB 4AYCA 3EB5A 3LQIA 3DWDA 4MVTA 2ECIA 5I3LA 4GNEA 4UI9B 1X4UA 5SVIB 4AP4A 2MA5A 2CT2A 2HYED 3N9LA 3O37A 1LDJB 2M1RA 4TKPB 2JMDA 3MHHA 1CHCA 2ECNA 4YATA 2KYUA 3M63A 2C2LA 3M7KA 2FFWA 4CCGX 2LDRA 4XI1A 2VPEA 4I7CA 2F42A 4OGEA 5G0FA 3C6WA 2LXPC 2EGPA 4LK9A 2QJ0A 1VFYA 4LADB 4BBQA 3E2DA 2KIZA 3N9PA 2YHNA 3FM8C 2KE1A 5AIUA 4WZ0A 4UP5A 3LQJA 5FERA 2MKEA 2YW8A 4I7DA 2K4DA 5KH7A 5H1VA 5B78A 2ECGA 2JUNA 4LLBA 4YC9A 5TABA 1Z2QA 2YHOA 5B76A 3H7HA 2BAYA 2LQ6A 3GL6A 2K16A 5LKUA 2DSMA 2KWNA 5K3QA 1WEVA 2G43A 2MT5A 3KQIA 2KGGA 1WFKA 5B77A 2KWOA 2MNZA 4ZDTA 5AITA 3DQVR 3SHBA 4GNDA 2EXUA 2LGVA 4A4BA 4QF2A 2E61A 4R7EA 2LV9A 2G45A 1HYIA 2EGMA 3Q1DA 4Z0RA 2ZETC 3V43A 1JOCA 2L5UA 4B86C 5TDWA 3M99A 3EB6A 1V87A 3DPLR 2YQMA 1HYJA 3SOUA 3FL2A 5G04B 1JM7B 1WEUA 2XEUA 3SOXA 3FAOA 2MD8C 1DVPA 2CSYA 3RPGC 4MSXA 2LN0A 4WZ3B 5TRBA 4A49A 3LDYA 1WE9A 2YSMA 4C9ZA 4V3LC 1E4UA 3ZVYA 3PUQA 2Y1MA 2MUMA 5TDRA 3HCSA 1WILA 4YBSA 2D8SA 2ECVA 4N3WA 4A0CD 3HCUA 4GB0A 4LKAA 2Y1NA 5FB0A 2M6MA 4WA6A 3JUEA 1WGMA 4ZUXU 5LKTA 1IYMA 1WESA 2YURA 4AYCB 2JMJA 1K2FA 3IHPA 2YU4A 2KU3A 2YUCA 4UP0A 1ZBDB 4GNGA 4YBTA 2ECJA 2MD7B 2VJEA 3LJUX 4S3OB 5B75A 2C2VS 2L75A 2E6RA 3HTKC 3O7AA 4AVXA 2ECWA 5H1UA 4W4UA 2QICA 3FEHA 5H9MA 3L1ZB 1WEMA 4QF3A 4QQ4A 1WEWA 5FEYA 1X4IA 3O34A 2VP7A 2I50A 5LKZA 2VJEB 2VNFA 3O70A 5DKAA 4R8PK 2KR4A 3I2DA 4LJNA 4YAXA 5D1KB 2LRIC 4IC2A 3T7LA 1G25A 3L1XA 2YT5A 5JG6A 1LDKC 2JRJA 5KH9A 1VD4A 2VJFA 3T9KA 2KKYA 1WEPA 5B8DA 3MHSA 5LKXA 2RR4A 1U6GB 2YYRA 2EA6A 2G6QA 1F62A 1Z6UA 2RSDA 2M3HA 2KFTA 4ZQLA 3GV4A 3ZPVE 1X4JA 2H0DA 2LAUA 2L80A 4BHWA 3O36A 4YABA 2D8UA 2M13A 3LVRE 4FK5A 2NAAA 2VJFB 4N4FA 2IDAA 2YVRA 5EYAF 4I7BA 2RI7A 5SVIA 2CONA 2CRWA 1MM2A 3SUBA 2CKLA 2KGIA 1Z60A 2KKXA 4X3GA 5B79A 2DX8A 2XOZA 2OWAA 4B7YC 3ASLA 2IQJA 2AN6A 3N9OA 3KV5A 2CSVA 2VPGA 4O62A 2YSJA 3VK6A 2F6NA 1N87A 3LRQA 4PTBA 4F52B 3RTRB 3T6RA 3SOWA 3O47A 2UZGA 2CRRA 3FANA 4L7XA 3N9QA 1WENA
chains in the Genus database with same CATH topology
1T1HA 2KREA 2MNYA 3LQHA 4V3KC 2CKLB 2CSZA 2XB1A 1RMDA 4IC3A 4GNFA 2JMIA 2LGKA 2EODA 2KWJA 5C11A 3U5NA 2K1JA 1WIMA 4CA1A 4AUQB 4PPEA 3KNVA 4NN2A 3RPGB 2L0BA 2LGLA 2QIZA 5LCWB 1FBVA 1FP0A 2FUUA 3QZVA 3M62A 2YQLA 4R2YA 4FJCA 2Y43A 4O64A 2KWKA 3N9NA 2VPDA 3ZVZB 4FO9A 3O33A 2YREA 1VYXA 3U5MA 2M85A 1WEEA 2PNXA 4YBMA 2ECTA 3ZNIA 2OXQC 2MA6A 3HCTA 5D1MB 4L58A 3KV6A 2K17A 5H1TA 4A4CA 5DINA 5FB1A 2L43A 1WEQA 2FSAA 3C5KA 4Q6FA 1MM3A 1JM7A 2HDPA 2MIQA 5KH3A 3PHDA 1XWHA 4WZ2A 1BORA 3U5PA 3L11A 3N9MA 3NG2A 3ZPV1 3O35A 4YADA 2PUYA 5TBNA 2LXHC 4S3OC 5J3XA 5G05B 4FIPA 5D1LB 5C13A 2VPBA 2LGGA 2E6SA 2F6JA 1WEOA 2FUIA 4P5OB 3U5OA 3ZTGA 3ZYQA 3PURA 2H0DB 4AYCA 3EB5A 3LQIA 4MVTA 2ECIA 5I3LA 4GNEA 4UI9B 1X4UA 4AP4A 2MA5A 2CT2A 2HYED 3N9LA 3O37A 1LDJB 2M1RA 4TKPB 2JMDA 3MHHA 1CHCA 2ECNA 4YATA 2KYUA 3M63A 2C2LA 4CCGX 2LDRA 4XI1A 2VPEA 4I7CA 2F42A 5G0FA 3C6WA 2LXPC 2EGPA 4LK9A 2QJ0A 1VFYA 4LADB 4BBQA 2KIZA 3N9PA 2YHNA 2KE1A 5AIUA 4WZ0A 4UP5A 3LQJA 5FERA 2YW8A 4I7DA 2K4DA 5KH7A 5H1VA 5B78A 2ECGA 4LLBA 4YC9A 5TABA 1Z2QA 2YHOA 5B76A 2BAYA 2LQ6A 3GL6A 2K16A 5LKUA 2KWNA 1WEVA 2G43A 2MT5A 3KQIA 2KGGA 1WFKA 5B77A 2KWOA 2MNZA 4ZDTA 5AITA 3DQVR 3SHBA 4GNDA 2LGVA 4A4BA 4QF2A 4R7EA 2LV9A 2G45A 1HYIA 2ZETC 3V43A 1JOCA 2L5UA 4B86C 5TDWA 3M99A 3EB6A 1V87A 3DPLR 2YQMA 1HYJA 3SOUA 3FL2A 5G04B 1JM7B 1WEUA 2XEUA 3SOXA 2MD8C 1DVPA 2CSYA 3RPGC 4MSXA 2LN0A 4WZ3B 5TRBA 4A49A 1WE9A 2YSMA 4C9ZA 4V3LC 1E4UA 3ZVYA 3PUQA 2Y1MA 2MUMA 5TDRA 3HCSA 1WILA 4YBSA 2D8SA 2ECVA 4N3WA 4A0CD 3HCUA 4GB0A 4LKAA 2Y1NA 5FB0A 2M6MA 4WA6A 1WGMA 4ZUXU 5LKTA 1IYMA 1WESA 2YURA 4AYCB 2JMJA 1K2FA 3IHPA 2YU4A 2KU3A 2YUCA 4UP0A 1ZBDB 4GNGA 4YBTA 2ECJA 2MD7B 2VJEA 4S3OB 5B75A 2C2VS 2L75A 2E6RA 3HTKC 3O7AA 4AVXA 2ECWA 5H1UA 4W4UA 2QICA 5H9MA 3L1ZB 1WEMA 4QF3A 1WEWA 5FEYA 1X4IA 3O34A 2VP7A 2I50A 5LKZA 2VJEB 2VNFA 3O70A 5DKAA 4R8PK 2KR4A 3I2DA 4LJNA 4YAXA 5D1KB 2LRIC 4IC2A 3T7LA 1G25A 3L1XA 2YT5A 5JG6A 1LDKC 2JRJA 5KH9A 1VD4A 2VJFA 1WEPA 5B8DA 3MHSA 5LKXA 1U6GB 2YYRA 2EA6A 2G6QA 1F62A 1Z6UA 2RSDA 2M3HA 2KFTA 4ZQLA 3GV4A 3ZPVE 1X4JA 2H0DA 2L80A 4BHWA 3O36A 4YABA 4FK5A 2NAAA 2VJFB 4N4FA 2IDAA 5EYAF 4I7BA 2RI7A 1MM2A 2CKLA 2KGIA 1Z60A 4X3GA 5B79A 2DX8A 4B7YC 3ASLA 2AN6A 3N9OA 3KV5A 2VPGA 2YSJA 3VK6A 2F6NA 1N87A 3LRQA 4PTBA 4F52B 3RTRB 3T6RA 3SOWA 2UZGA 4L7XA 3N9QA 1WENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1H A;  2KRE A;  2MNY A;  3LQH A;  4V3K C;  2CKL B;  2CSZ A;  2XB1 A;  1RMD A;  4IC3 A;  4GNF A;  2JMI A;  2LGK A;  2EOD A;  2KWJ A;  5C11 A;  3U5N A;  2K1J A;  1WIM A;  4CA1 A;  4AUQ B;  4PPE A;  3KNV A;  4NN2 A;  3RPG B;  2L0B A;  2LGL A;  2QIZ A;  5LCW B;  1FBV A;  1FP0 A;  2FUU A;  3QZV A;  3M62 A;  2YQL A;  4R2Y A;  4FJC A;  2Y43 A;  4O64 A;  2KWK A;  3N9N A;  2VPD A;  3ZVZ B;  4FO9 A;  3O33 A;  2YRE A;  1VYX A;  3U5M A;  2M85 A;  1WEE A;  2PNX A;  4YBM A;  2ECT A;  3ZNI A;  2OXQ C;  2MA6 A;  3HCT A;  5D1M B;  4L58 A;  3KV6 A;  2K17 A;  5H1T A;  4A4C A;  5DIN A;  5FB1 A;  2L43 A;  1WEQ A;  2FSA A;  3C5K A;  4Q6F A;  1MM3 A;  1JM7 A;  2HDP A;  2MIQ A;  5KH3 A;  3PHD A;  1XWH A;  4WZ2 A;  1BOR A;  3U5P A;  3L11 A;  3N9M A;  3NG2 A;  3ZPV 1;  3O35 A;  4YAD A;  2PUY A;  5TBN A;  2LXH C;  4S3O C;  5J3X A;  5G05 B;  4FIP A;  5D1L B;  5C13 A;  2VPB A;  2LGG A;  2E6S A;  2F6J A;  1WEO A;  2FUI A;  4P5O B;  3U5O A;  3ZTG A;  3ZYQ A;  3PUR A;  2H0D B;  4AYC A;  3EB5 A;  3LQI A;  4MVT A;  2ECI A;  5I3L A;  4GNE A;  4UI9 B;  1X4U A;  4AP4 A;  2MA5 A;  2CT2 A;  2HYE D;  3N9L A;  3O37 A;  1LDJ B;  2M1R A;  4TKP B;  2JMD A;  3MHH A;  1CHC A;  2ECN A;  4YAT A;  2KYU A;  3M63 A;  2C2L A;  4CCG X;  2LDR A;  4XI1 A;  2VPE A;  4I7C A;  2F42 A;  5G0F A;  3C6W A;  2LXP C;  2EGP A;  4LK9 A;  2QJ0 A;  1VFY A;  4LAD B;  4BBQ A;  2KIZ A;  3N9P A;  2YHN A;  2KE1 A;  5AIU A;  4WZ0 A;  4UP5 A;  3LQJ A;  5FER A;  2YW8 A;  4I7D A;  2K4D A;  5KH7 A;  5H1V A;  5B78 A;  2ECG A;  4LLB A;  4YC9 A;  5TAB A;  1Z2Q A;  2YHO A;  5B76 A;  2BAY A;  2LQ6 A;  3GL6 A;  2K16 A;  5LKU A;  2KWN A;  1WEV A;  2G43 A;  2MT5 A;  3KQI A;  2KGG A;  1WFK A;  5B77 A;  2KWO A;  2MNZ A;  4ZDT A;  5AIT A;  3DQV R;  3SHB A;  4GND A;  2LGV A;  4A4B A;  4QF2 A;  4R7E A;  2LV9 A;  2G45 A;  1HYI A;  2ZET C;  3V43 A;  1JOC A;  2L5U A;  4B86 C;  5TDW A;  3M99 A;  3EB6 A;  1V87 A;  3DPL R;  2YQM A;  1HYJ A;  3SOU A;  3FL2 A;  5G04 B;  1JM7 B;  1WEU A;  2XEU A;  3SOX A;  2MD8 C;  1DVP A;  2CSY A;  3RPG C;  4MSX A;  2LN0 A;  4WZ3 B;  5TRB A;  4A49 A;  1WE9 A;  2YSM A;  4C9Z A;  4V3L C;  1E4U A;  3ZVY A;  3PUQ A;  2Y1M A;  2MUM A;  5TDR A;  3HCS A;  1WIL A;  4YBS A;  2D8S A;  2ECV A;  4N3W A;  4A0C D;  3HCU A;  4GB0 A;  4LKA A;  2Y1N A;  5FB0 A;  2M6M A;  4WA6 A;  1WGM A;  4ZUX U;  5LKT A;  1IYM A;  1WES A;  2YUR A;  4AYC B;  2JMJ A;  1K2F A;  3IHP A;  2YU4 A;  2KU3 A;  2YUC A;  4UP0 A;  1ZBD B;  4GNG A;  4YBT A;  2ECJ A;  2MD7 B;  2VJE A;  4S3O B;  5B75 A;  2C2V S;  2L75 A;  2E6R A;  3HTK C;  3O7A A;  4AVX A;  2ECW A;  5H1U A;  4W4U A;  2QIC A;  5H9M A;  3L1Z B;  1WEM A;  4QF3 A;  1WEW A;  5FEY A;  1X4I A;  3O34 A;  2VP7 A;  2I50 A;  5LKZ A;  2VJE B;  2VNF A;  3O70 A;  5DKA A;  4R8P K;  2KR4 A;  3I2D A;  4LJN A;  4YAX A;  5D1K B;  2LRI C;  4IC2 A;  3T7L A;  1G25 A;  3L1X A;  2YT5 A;  5JG6 A;  1LDK C;  2JRJ A;  5KH9 A;  1VD4 A;  2VJF A;  1WEP A;  5B8D A;  3MHS A;  5LKX A;  1U6G B;  2YYR A;  2EA6 A;  2G6Q A;  1F62 A;  1Z6U A;  2RSD A;  2M3H A;  2KFT A;  4ZQL A;  3GV4 A;  3ZPV E;  1X4J A;  2H0D A;  2L80 A;  4BHW A;  3O36 A;  4YAB A;  4FK5 A;  2NAA A;  2VJF B;  4N4F A;  2IDA A;  5EYA F;  4I7B A;  2RI7 A;  1MM2 A;  2CKL A;  2KGI A;  1Z60 A;  4X3G A;  5B79 A;  2DX8 A;  4B7Y C;  3ASL A;  2AN6 A;  3N9O A;  3KV5 A;  2VPG A;  2YSJ A;  3VK6 A;  2F6N A;  1N87 A;  3LRQ A;  4PTB A;  4F52 B;  3RTR B;  3T6R A;  3SOW A;  2UZG A;  4L7X A;  3N9Q A;  1WEN A; 
#chains in the Genus database with same CATH topology
 3LVQ E;  1T1H A;  2KRE A;  2MNY A;  3LQH A;  3MDB C;  4V3K C;  2CKL B;  2CSZ A;  2XB1 A;  1RMD A;  4IC3 A;  4GNF A;  2JMI A;  2XOC A;  2LGK A;  2EOD A;  2KWJ A;  5C11 A;  1MBM A;  3U5N A;  2K1J A;  1WIM A;  4CA1 A;  4AUQ B;  4PPE A;  3KNV A;  4NN2 A;  3RPG B;  2L0B A;  2LGL A;  2QIZ A;  5LCW B;  2B0O E;  1FBV A;  1FP0 A;  2XP0 A;  2FUU A;  3QZV A;  3M62 A;  2YQL A;  4R2Y A;  4FJC A;  2Y43 A;  4O64 A;  2KWK A;  3N9N A;  2VPD A;  3ZVZ B;  4FO9 A;  3O33 A;  2YRE A;  1VYX A;  3U5M A;  2M85 A;  1WEE A;  2P57 A;  2PNX A;  4YBM A;  2ECT A;  4F1P A;  3ZNI A;  2OXQ C;  2MA6 A;  3HCT A;  5D1M B;  4L58 A;  3KV6 A;  2K17 A;  5H1T A;  4A4C A;  1DCQ A;  5DIN A;  5FB1 A;  2L43 A;  1WEQ A;  2FSA A;  4Z0O A;  4H9D A;  3C5K A;  4Q6F A;  1MM3 A;  1JM7 A;  2HDP A;  2MIQ A;  5KH3 A;  5SVY A;  3PHD A;  2JM3 A;  1XWH A;  4WZ2 A;  5SVX A;  1BOR A;  3U5P A;  3L11 A;  3N9M A;  3NG2 A;  2DJA A;  2L7P A;  3ZPV 1;  3O35 A;  4YAD A;  2PUY A;  5TBN A;  2XOY A;  2LXH C;  4S3O C;  5J3X A;  5G05 B;  2FD4 A;  4FIP A;  5D1L B;  5C13 A;  2VPB A;  2LGG A;  3FJU B;  2E6S A;  2F6J A;  4OGC A;  1WEO A;  2FUI A;  3PLW A;  4P5O B;  3U5O A;  3DDT A;  3KDE C;  3ZTG A;  3ZYQ A;  3PUR A;  2H0D B;  4AYC A;  3EB5 A;  3LQI A;  3DWD A;  4MVT A;  2ECI A;  5I3L A;  4GNE A;  4UI9 B;  1X4U A;  5SVI B;  4AP4 A;  2MA5 A;  2CT2 A;  2HYE D;  3N9L A;  3O37 A;  1LDJ B;  2M1R A;  4TKP B;  2JMD A;  3MHH A;  1CHC A;  2ECN A;  4YAT A;  2KYU A;  3M63 A;  2C2L A;  3M7K A;  2FFW A;  4CCG X;  2LDR A;  4XI1 A;  2VPE A;  4I7C A;  2F42 A;  4OGE A;  5G0F A;  3C6W A;  2LXP C;  2EGP A;  4LK9 A;  2QJ0 A;  1VFY A;  4LAD B;  4BBQ A;  3E2D A;  2KIZ A;  3N9P A;  2YHN A;  3FM8 C;  2KE1 A;  5AIU A;  4WZ0 A;  4UP5 A;  3LQJ A;  5FER A;  2MKE A;  2YW8 A;  4I7D A;  2K4D A;  5KH7 A;  5H1V A;  5B78 A;  2ECG A;  2JUN A;  4LLB A;  4YC9 A;  5TAB A;  1Z2Q A;  2YHO A;  5B76 A;  3H7H A;  2BAY A;  2LQ6 A;  3GL6 A;  2K16 A;  5LKU A;  2DSM A;  2KWN A;  5K3Q A;  1WEV A;  2G43 A;  2MT5 A;  3KQI A;  2KGG A;  1WFK A;  5B77 A;  2KWO A;  2MNZ A;  4ZDT A;  5AIT A;  3DQV R;  3SHB A;  4GND A;  2EXU A;  2LGV A;  4A4B A;  4QF2 A;  2E61 A;  4R7E A;  2LV9 A;  2G45 A;  1HYI A;  2EGM A;  3Q1D A;  4Z0R A;  2ZET C;  3V43 A;  1JOC A;  2L5U A;  4B86 C;  5TDW A;  3M99 A;  3EB6 A;  1V87 A;  3DPL R;  2YQM A;  1HYJ A;  3SOU A;  3FL2 A;  5G04 B;  1JM7 B;  1WEU A;  2XEU A;  3SOX A;  3FAO A;  2MD8 C;  1DVP A;  2CSY A;  3RPG C;  4MSX A;  2LN0 A;  4WZ3 B;  5TRB A;  4A49 A;  3LDY A;  1WE9 A;  2YSM A;  4C9Z A;  4V3L C;  1E4U A;  3ZVY A;  3PUQ A;  2Y1M A;  2MUM A;  5TDR A;  3HCS A;  1WIL A;  4YBS A;  2D8S A;  2ECV A;  4N3W A;  4A0C D;  3HCU A;  4GB0 A;  4LKA A;  2Y1N A;  5FB0 A;  2M6M A;  4WA6 A;  3JUE A;  1WGM A;  4ZUX U;  5LKT A;  1IYM A;  1WES A;  2YUR A;  4AYC B;  2JMJ A;  1K2F A;  3IHP A;  2YU4 A;  2KU3 A;  2YUC A;  4UP0 A;  1ZBD B;  4GNG A;  4YBT A;  2ECJ A;  2MD7 B;  2VJE A;  3LJU X;  4S3O B;  5B75 A;  2C2V S;  2L75 A;  2E6R A;  3HTK C;  3O7A A;  4AVX A;  2ECW A;  5H1U A;  4W4U A;  2QIC A;  3FEH A;  5H9M A;  3L1Z B;  1WEM A;  4QF3 A;  4QQ4 A;  1WEW A;  5FEY A;  1X4I A;  3O34 A;  2VP7 A;  2I50 A;  5LKZ A;  2VJE B;  2VNF A;  3O70 A;  5DKA A;  4R8P K;  2KR4 A;  3I2D A;  4LJN A;  4YAX A;  5D1K B;  2LRI C;  4IC2 A;  3T7L A;  1G25 A;  3L1X A;  2YT5 A;  5JG6 A;  1LDK C;  2JRJ A;  5KH9 A;  1VD4 A;  2VJF A;  3T9K A;  2KKY A;  1WEP A;  5B8D A;  3MHS A;  5LKX A;  2RR4 A;  1U6G B;  2YYR A;  2EA6 A;  2G6Q A;  1F62 A;  1Z6U A;  2RSD A;  2M3H A;  2KFT A;  4ZQL A;  3GV4 A;  3ZPV E;  1X4J A;  2H0D A;  2LAU A;  2L80 A;  4BHW A;  3O36 A;  4YAB A;  2D8U A;  2M13 A;  3LVR E;  4FK5 A;  2NAA A;  2VJF B;  4N4F A;  2IDA A;  2YVR A;  5EYA F;  4I7B A;  2RI7 A;  5SVI A;  2CON A;  2CRW A;  1MM2 A;  3SUB A;  2CKL A;  2KGI A;  1Z60 A;  2KKX A;  4X3G A;  5B79 A;  2DX8 A;  2XOZ A;  2OWA A;  4B7Y C;  3ASL A;  2IQJ A;  2AN6 A;  3N9O A;  3KV5 A;  2CSV A;  2VPG A;  4O62 A;  2YSJ A;  3VK6 A;  2F6N A;  1N87 A;  3LRQ A;  4PTB A;  4F52 B;  3RTR B;  3T6R A;  3SOW A;  3O47 A;  2UZG A;  2CRR A;  3FAN A;  4L7X A;  3N9Q A;  1WEN A; 
#chains in the Genus database with same CATH homology
 1T1H A;  2KRE A;  2MNY A;  3LQH A;  4V3K C;  2CKL B;  2CSZ A;  2XB1 A;  1RMD A;  4IC3 A;  4GNF A;  2JMI A;  2LGK A;  2EOD A;  2KWJ A;  5C11 A;  3U5N A;  2K1J A;  1WIM A;  4CA1 A;  4AUQ B;  4PPE A;  3KNV A;  4NN2 A;  3RPG B;  2L0B A;  2LGL A;  2QIZ A;  5LCW B;  1FBV A;  1FP0 A;  2FUU A;  3QZV A;  3M62 A;  2YQL A;  4R2Y A;  4FJC A;  2Y43 A;  4O64 A;  2KWK A;  3N9N A;  2VPD A;  3ZVZ B;  4FO9 A;  3O33 A;  2YRE A;  1VYX A;  3U5M A;  2M85 A;  1WEE A;  2PNX A;  4YBM A;  2ECT A;  3ZNI A;  2OXQ C;  2MA6 A;  3HCT A;  5D1M B;  4L58 A;  3KV6 A;  2K17 A;  5H1T A;  4A4C A;  5DIN A;  5FB1 A;  2L43 A;  1WEQ A;  2FSA A;  3C5K A;  4Q6F A;  1MM3 A;  1JM7 A;  2HDP A;  2MIQ A;  5KH3 A;  3PHD A;  1XWH A;  4WZ2 A;  1BOR A;  3U5P A;  3L11 A;  3N9M A;  3NG2 A;  3ZPV 1;  3O35 A;  4YAD A;  2PUY A;  5TBN A;  2LXH C;  4S3O C;  5J3X A;  5G05 B;  4FIP A;  5D1L B;  5C13 A;  2VPB A;  2LGG A;  2E6S A;  2F6J A;  1WEO A;  2FUI A;  4P5O B;  3U5O A;  3ZTG A;  3ZYQ A;  3PUR A;  2H0D B;  4AYC A;  3EB5 A;  3LQI A;  4MVT A;  2ECI A;  5I3L A;  4GNE A;  4UI9 B;  1X4U A;  4AP4 A;  2MA5 A;  2CT2 A;  2HYE D;  3N9L A;  3O37 A;  1LDJ B;  2M1R A;  4TKP B;  2JMD A;  3MHH A;  1CHC A;  2ECN A;  4YAT A;  2KYU A;  3M63 A;  2C2L A;  4CCG X;  2LDR A;  4XI1 A;  2VPE A;  4I7C A;  2F42 A;  5G0F A;  3C6W A;  2LXP C;  2EGP A;  4LK9 A;  2QJ0 A;  1VFY A;  4LAD B;  4BBQ A;  2KIZ A;  3N9P A;  2YHN A;  2KE1 A;  5AIU A;  4WZ0 A;  4UP5 A;  3LQJ A;  5FER A;  2YW8 A;  4I7D A;  2K4D A;  5KH7 A;  5H1V A;  5B78 A;  2ECG A;  4LLB A;  4YC9 A;  5TAB A;  1Z2Q A;  2YHO A;  5B76 A;  2BAY A;  2LQ6 A;  3GL6 A;  2K16 A;  5LKU A;  2KWN A;  1WEV A;  2G43 A;  2MT5 A;  3KQI A;  2KGG A;  1WFK A;  5B77 A;  2KWO A;  2MNZ A;  4ZDT A;  5AIT A;  3DQV R;  3SHB A;  4GND A;  2LGV A;  4A4B A;  4QF2 A;  4R7E A;  2LV9 A;  2G45 A;  1HYI A;  2ZET C;  3V43 A;  1JOC A;  2L5U A;  4B86 C;  5TDW A;  3M99 A;  3EB6 A;  1V87 A;  3DPL R;  2YQM A;  1HYJ A;  3SOU A;  3FL2 A;  5G04 B;  1JM7 B;  1WEU A;  2XEU A;  3SOX A;  2MD8 C;  1DVP A;  2CSY A;  3RPG C;  4MSX A;  2LN0 A;  4WZ3 B;  5TRB A;  4A49 A;  1WE9 A;  2YSM A;  4C9Z A;  4V3L C;  1E4U A;  3ZVY A;  3PUQ A;  2Y1M A;  2MUM A;  5TDR A;  3HCS A;  1WIL A;  4YBS A;  2D8S A;  2ECV A;  4N3W A;  4A0C D;  3HCU A;  4GB0 A;  4LKA A;  2Y1N A;  5FB0 A;  2M6M A;  4WA6 A;  1WGM A;  4ZUX U;  5LKT A;  1IYM A;  1WES A;  2YUR A;  4AYC B;  2JMJ A;  1K2F A;  3IHP A;  2YU4 A;  2KU3 A;  2YUC A;  4UP0 A;  1ZBD B;  4GNG A;  4YBT A;  2ECJ A;  2MD7 B;  2VJE A;  4S3O B;  5B75 A;  2C2V S;  2L75 A;  2E6R A;  3HTK C;  3O7A A;  4AVX A;  2ECW A;  5H1U A;  4W4U A;  2QIC A;  5H9M A;  3L1Z B;  1WEM A;  4QF3 A;  1WEW A;  5FEY A;  1X4I A;  3O34 A;  2VP7 A;  2I50 A;  5LKZ A;  2VJE B;  2VNF A;  3O70 A;  5DKA A;  4R8P K;  2KR4 A;  3I2D A;  4LJN A;  4YAX A;  5D1K B;  2LRI C;  4IC2 A;  3T7L A;  1G25 A;  3L1X A;  2YT5 A;  5JG6 A;  1LDK C;  2JRJ A;  5KH9 A;  1VD4 A;  2VJF A;  1WEP A;  5B8D A;  3MHS A;  5LKX A;  1U6G B;  2YYR A;  2EA6 A;  2G6Q A;  1F62 A;  1Z6U A;  2RSD A;  2M3H A;  2KFT A;  4ZQL A;  3GV4 A;  3ZPV E;  1X4J A;  2H0D A;  2L80 A;  4BHW A;  3O36 A;  4YAB A;  4FK5 A;  2NAA A;  2VJF B;  4N4F A;  2IDA A;  5EYA F;  4I7B A;  2RI7 A;  1MM2 A;  2CKL A;  2KGI A;  1Z60 A;  4X3G A;  5B79 A;  2DX8 A;  4B7Y C;  3ASL A;  2AN6 A;  3N9O A;  3KV5 A;  2VPG A;  2YSJ A;  3VK6 A;  2F6N A;  1N87 A;  3LRQ A;  4PTB A;  4F52 B;  3RTR B;  3T6R A;  3SOW A;  2UZG A;  4L7X A;  3N9Q A;  1WEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...