4YABA

Crystal structure of trim24 phd-bromodomain complexed with 1-methyl-5-(2-methyl-1 3-thiazol-4-yl)-2 3-dihydro-1h-indol-2-one (1)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
178
Chain Sequence
b'SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 54
structure length 178
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yabA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yabA01
4IOOA 1DVPA 5L98A 4YY6A 5KTUA 5EI4A 5D3PA 5IGNA 1K2FA 4YABA 4NS5A 4FJCA 4AVXA 3SOWA 4A9EA 4J0SA 2C2LA 5EWHA 5FEYA 5A5OA 4QNSA 2YW8A 5DKAA 4YAXA 2HYED 3SOXA 5LKUA 2R0VA 4QSWA 5COIA 1JM4B 3MHSA 4QYDA 2H0DA 2OUOA 5A85A 4CUTA 4UYFB 5EISA 2K1JA 3IHPA 3SOUA 5B77A 1F62A 2EODA 3NG2A 5FE3A 4TS8A 1WEEA 5ENHA 2I50A 3UVDA 4PPEA 2NAAA 5H9MA 2N9GA 3U5OA 4O7EA 2M3HA 4CCGX 4LLBA 4B86C 2YSJA 4WZ3B 5HLSA 3HMEA 4BBQA 1IYMA 5IGMA 5J3XA 3MXFA 4WIVA 4A49A 5D1MB 5A5RA 5D3NA 5CY9A 5ETDA 4OGJA 3U5KA 1WEUA 5B79A 4UITA 4WA6A 1WUMA 5BT3A 2VPBA 1E6IA 4GNGA 5IGKA 4QEUA 2KWJA 4NUDA 3ZVZB 5FG5A 5FE2A 4O72A 2YYNA 3O70A 3JVLA 3RPGC 4XY8A 3ASLA 4YC9A 5KH3A 4LC2A 4Y03A 5EPBA 4L58A 3PHDA 5E9VA 5AD3A 2L5UA 2CT2A 5FE0A 4MR4A 5LKTA 3N9MA 5EM3A 4DONA 4AP4A 5FE6A 3U5LA 4QSTA 4O76A 5DINA 5TCMA 4IC3A 2IDAA 5LUUA 5KH9A 4ZUXU 5F2PA 5L96A 5D1LB 5AIUA 5L8UA 2K16A 2LXPC 2XEUA 2Y43A 4NYWA 4AYCB 3JVJA 4TT6A 2AN6A 3UVYA 4NRCA 1WFKA 2KU3A 2I7KA 5JG6A 2R0YA 4F3IA 5AMFA 3KNVA 3U5PA 4R7EA 4Z1QA 4O7CA 1WEQA 4IR5A 5FE9A 3N9OA 5C13A 3U5NA 3HMFA 1JSPB 5FB0A 5EK9A 4A9HA 2MA5A 2ECNA 4I7CA 5D7XA 4BHWA 5I83A 4N3WA 4O75A 4HXLA 5E0RA 1WGMA 3GG3A 1WEOA 4W4UA 5L99A 4YBTA 5CPEA 4QB3A 4NR7A 4A9FA 4MR3A 4YY4A 5FG6A 1N72A 5EU1A 2MUMA 5CQ4A 2D82A 2RNWA 4A9OA 4LKAA 4HXOA 5B76A 1F68A 4NQMA 3ZYUA 5C89A 2RS9B 2L5EA 4ZC9A 4YYGA 4PTBA 4O7FA 5HM0A 2ECGA 2YQLA 5JI8A 4BW2A 2R10A 5EPSA 4YATA 4QF2A 2YW5A 2L0BA 5CU8A 5F60A 3M99A 1WUGA 3ZNIA 1HYIA 5HQ5A 4NRBA 5CS8A 4MEPA 2L84A 5EGUA 4PS5A 4TTEA 3DQVR 2LXHC 4ZDTA 3ZPV1 5FDZA 4XY9A 2E6SA 5EICA 4CA1A 4QSXA 5E9IA 4GNEA 2LN0A 1T1HA 1FBVA 5A83A 2KE1A 4ZW1A 2VJFB 3G0JA 5ETBA 5FFYA 4NUCA 3V43A 1JM7B 4UP0A 5G05B 3FKMX 3UV4A 3DAIA 4QY4A 2KFTA 2E6RA 2HDPA 2YUCA 2DX8A 2E3KA 3QZVA 5K29A 3GL6A 4KCXA 2MD7B 3ZTGA 4J3IA 4BW3A 3I3JA 4N4HA 4UIYA 4QR5A 4PCEA 5G0FA 2F42A 3SVHA 2K4DA 4LYSA 3C6WA 4QSUA 2FSAA 1WIMA 3QZSA 4NRAA 4QUTA 5I7XA 2M85A 3Q2EA 4UYHA 2MA6A 4A9IA 4UYFA 5C85A 4B7YC 4L7XA 2F6NA 4PCIA 4QEVA 5HFRA 4N4GA 5LJ2A 5EQ1A 3S91A 4UIWA 5E9KA 4CFLA 3N9LA 4PKLA 2NXBA 2YT5A 5FH6A 3KQIA 4QZSA 5DKCA 5KTWA 3L11A 4V3LC 3KV5A 4TZ8A 5A5PA 3T6RA 3U5JA 3GV4A 5FERA 4A4CA 3ZVYA 4I7BA 5I3LA 2R0SA 5I80A 2RNXA 2YEKA 4QC1A 4MR5A 4XUBA 4YK0A 3ZPVE 2YQDA 4NUEA 2D9EA 5LKZA 4J0RA 4PY6A 4TYLA 2UZGA 3PURA 3P1CA 5F1LA 5IGLA 5II2A 5CQ8A 1EQFA 5D3TA 5LKXA 2KYUA 5B78A 2M6MA 1E4UA 2KIZA 5ENIA 5FFVA 4A0CD 4YH4A 5D3JA 3FL2A 2G6QA 2KWKA 5LVRA 2JRJA 3O37A 5ACYA 2MJVB 4ALGA 2LGLA 4CURA 2DKWA 4Z6IA 2YHNA 1WENA 5FE5A 2LDRA 4FO9A 4YYDA 4YYJA 4AUQB 5HEMA 2YDWA 5F62A 3K2JA 4WHWA 4YBSA 2YSMA 5D3RA 2ECJA 2RSDA 4P5OB 2G4AA 1LDJB 2H0DB 3AQAA 5D1KB 2KWNA 3JVKA 4OUFA 2YYRA 3UV5A 5DKHA 4NR8A 3HCSA 3UV2A 5KU3A 5EP7A 3U5MA 1XWHA 2ECIA 3O33A 3LQJA 5TB6A 2MNYA 3L1XA 4O70A 1BORA 4LYIA 5D3SA 5AMEA 5HQ6A 4HXPA 3PUQA 5EYAF 2QICA 5I1QA 5CQ3A 3MB3A 3RCWA 5A82A 4NR5A 1X4IA 4BJXA 4FIPA 5HRVA 5DX4A 3UW9A 5F63A 4GB0A 3HCTA 2EGPA 4HXNA 5H85A 5A5NA 5D0CA 2LRIC 3MHHA 4O71A 5ENFA 4A9JA 1ZS5A 4HBYA 5F61A 5IG6A 5KTXA 4F52B 3MUKA 1WE9A 2LQ6A 3O7AA 4UIZA 5HRWA 4MEOA 4NR4A 1VFYA 3N9NA 4TT2A 2I8NA 1LDKC 1Z60A 5F36A 2JMJA 2OSSA 5C7NA 5C8GA 4BW4A 2D8SA 5LCWB 4QEWA 3P1EA 2QIZA 3HTKC 4IC2A 4CUQA 4MR6A 3LQHA 5E3GA 2YQMA 5AITA 4N4IA 3MB4A 5EPRA 5CUDA 2VNFA 4QYLA 4TZ2A 5H1TA 3M63A 4QSQA 5J0DA 3EB5A 5HCLA 2LGVA 5CZGA 2L43A 2RFJA 4E96A 5CQAA 4CUSA 4YBMA 4LK9A 5G04B 3LJWA 5FBXA 5L8TA 5EWWA 2CKLA 5EWDA 3HCUA 1U6GB 5I29A 2F6JA 5EA1A 1JM7A 3NXBA 4XI1A 4Q6FA 5CGPA 4O64A 4R8PK 5ENEA 5EWVA 2XB1A 3TLPA 5I86A 3S92A 2K17A 5FB1A 1WEVA 4CL9A 4LR6A 4NR6A 4ZQLA 4QF3A 1WESA 3O36A 2KR4A 5G4SA 3P1FA 4WZ2A 4YYHA 4QC3A 5EVAA 3P1DA 4GNFA 5TRBA 5FE1A 4OGIA 4YYKA 2LGKA 5B75A 2RNYA 1VYXA 3DPLR 3UVXA 3SVGA 4LZSA 5I40A 2VJEB 2C2VS 4CUUA 3T7LA 5E3DA 5DY7A 2LSPB 4C67A 4QSSA 5FE8A 5FG4A 1X4UA 3ONIA 1Z6UA 5CRMA 2CSZA 2Y1MA 2VPGA 4Z6HA 4CUPA 5DBMA 5CUBA 5FFWA 2H60A 4YADA 4A9MA 3N9PA 4Z93A 2MNZA 2M1RA 3Q2FA 3MQMA 4CFKA 5F3AA 2BAYA 5TDRA 4UIVA 3VK6A 5C87A 4LZ2A 5D3HA 4O77A 2JMIA 5CUCA 2PUYA 5I88A 3I2DA 3MULA 1X4JA 4WHUA 4XYAA 5ENCA 5TDWA 4X2IA 3EB6A 5LJ1A 4Z1SA 2EA6A 3SVFA 2Y1NA 5EV9A 5TBNA 5DFBA 5DLXA 3RTRB 2L75A 2DVVA 5F5ZA 5TABA 4HBWA 2KREA 5CP5A 2YURA 5C4QA 2YREA 2JMDA 2ECVA 4TKPB 3LQIA 1Z2QA 5A7CA 5D24A 2VP7A 2DVSA 3P5OA 5DYXA 4NXJA 4HBXA 4LRGA 2RO1A 5DLZA 2L85A 2ECTA 4KV1A 5L97A 5DFCA 4QBMA 5A5SA 2LV9A 4HBVA 1N87A 3KV6A 5KO4A 5CUAA 5CQ5A 4C9ZA 4AYCA 4TQNA 2OXQC 2G43A 4A9NA 5KH7A 2LGGA 4LDFA 4TU4A 4C66A 5IIDA 4MVTA 5G4RA 5I7YA 4UYGA 4LYWA 2GRCA 4MEQA 4NN2A 5II1A 4UI9B 4QR3A 2MD8C 4J1PA 5HRXA 3RPGB 4ALHA 5DFDA 5D25A 3HMHA 5C11A 1WILA 4IR6A 4QR4A 4IORA 5A81A 2DVRA 5BT5A 4GPJA 1JOCA 4NQNA 1WEWA 5ENGA 4YH3A 4HXKA 4R2YA 4UYDA 2FUUA 4TU6A 4UP5A 4A4BA 5HENA 5E9YA 4FLPA 4BW1A 5EWCA 2YU4A 4LZRA 1MM3A 3ZYQA 5AD2A 5FE7A 2L80A 5DW1A 4MSXA 4LADB 4N4FA 4UIXA 1FP0A 2FUIA 2CSYA 3IU5A 5IBNA 4O7AA 4YYIA 5H1UA 3LXJA 3M62A 4A9KA 3SHBA 2KTBB 2DWWA 1RMDA 4HXRA 4UIUA 4QSPA 5E9MA 4I7DA 4IOQA 4LJNA 5CQTA 4MENA 1V87A 3LRQA 1X0JA 5JWMA 5LJ0A 3QZTA 2OO1A 4IR4A 5DKDA 2KWOA 2E7OA 5HFQA 1WEMA 4YYNA 2G45A 5A5QA 3N9QA 3D7CA 2VJFA 3IU6A 5E7DA 4NYXA 4A9LA 2WP1A 2YEMA 5CUEA 5E74A 2QJ0A 4YYMA 4V3KC 4WZ0A 4Q0OA 2VJEA 5HELA 2DVQA 5H1VA 4O7BA 5CQ7A 5E9LA 4UYEA 5D26A 3JVMA 2MT5A 4S3OB 1VD4A 3C5KA 2DATA 4XUAA 4AKNA 5B8DA 5LVQA 4O78A 4S3OC 1HYJA 1G25A 4KV4A 5DYAA 2YELA 5CUGA 4HXSA 4IR3A 5CTLA 5CRZA 5DW2A 5ENBA 1WEPA 2ZETC 5DYCA 5E73A 5F25A 2E7NA 5CFWA 2MIQA 2VPEA 4QSRA 4Q0NA 2YHOA 5D3LA 4CLBA 2VPDA 5F1HA 1CHCA 5HQ7A 4NYVA 4NR9A 3UVWA 5FH8A 5FE4A 1ZBDB 3O35A 4FK5A 2KGGA 3DWYA 4QSVA 5HJCA 3G0LA 5I89A 2CKLB 4TT4A 5ENJA 4O74A 4GNDA 5BT4A 3L1ZB 5DYUA 2KGIA 5CQ6A 2WP2A 4QUUA 4RVRA 2PNXA 3O34A 2ECWA 4HXMA 1MM2A 2RI7A 3AADA 5FH7A 4X3GA 5KHMA
chains in the Genus database with same CATH superfamily
4IOOA 1DVPA 5L98A 4YY6A 5KTUA 5EI4A 3FM8C 5D3PA 5IGNA 1K2FA 4YABA 4NS5A 4FJCA 4AVXA 3SOWA 4A9EA 4J0SA 2C2LA 5EWHA 5FEYA 5A5OA 4QNSA 2YW8A 5DKAA 4YAXA 2HYED 3SOXA 3PLWA 5LKUA 2R0VA 4QSWA 5COIA 1JM4B 2FFWA 3MHSA 4QYDA 2H0DA 5SVIA 2OUOA 5A85A 4CUTA 4UYFB 5EISA 2K1JA 3IHPA 3SOUA 5B77A 1F62A 2EODA 3NG2A 5FE3A 4TS8A 1WEEA 2XOYA 5ENHA 2I50A 3UVDA 4PPEA 2NAAA 5H9MA 2N9GA 3U5OA 4O7EA 2M3HA 4CCGX 4LLBA 4B86C 2YSJA 4WZ3B 5HLSA 3HMEA 4BBQA 1IYMA 5IGMA 4F1PA 1DCQA 5J3XA 3MXFA 4WIVA 3T9KA 4A49A 5D1MB 5A5RA 5D3NA 5CY9A 5ETDA 4OGJA 3U5KA 1WEUA 5B79A 4UITA 4WA6A 1WUMA 5BT3A 2VPBA 1E6IA 4GNGA 5IGKA 4QEUA 2KWJA 4NUDA 3ZVZB 5FG5A 5FE2A 4O72A 2YYNA 3O70A 3JVLA 3RPGC 4XY8A 4Z0RA 3ASLA 4YC9A 5KH3A 4LC2A 4Y03A 5EPBA 4L58A 3PHDA 5E9VA 5AD3A 2L5UA 2CT2A 5FE0A 4MR4A 5LKTA 3N9MA 5EM3A 4DONA 4AP4A 5FE6A 3U5LA 4QSTA 4O76A 5DINA 5TCMA 4IC3A 3D1BA 2IDAA 5LUUA 5KH9A 4ZUXU 5F2PA 5L96A 5D1LB 5AIUA 5L8UA 2K16A 2LXPC 2XEUA 2Y43A 4NYWA 4AYCB 3JVJA 3SUBA 4TT6A 4QQ4A 2AN6A 3UVYA 4NRCA 1WFKA 2KU3A 2I7KA 5JG6A 2R0YA 4F3IA 5AMFA 3KNVA 3U5PA 2M13A 2YVRA 4R7EA 4Z1QA 4O7CA 1WEQA 4IR5A 5FE9A 3N9OA 5C13A 3M7KA 3U5NA 3HMFA 1JSPB 5FB0A 5EK9A 4A9HA 2MA5A 2ECNA 4I7CA 4AKGA 3DDTA 5D7XA 4BHWA 5I83A 4N3WA 4O75A 4HXLA 5E0RA 1WGMA 3GG3A 1WEOA 4W4UA 5L99A 4YBTA 5CPEA 4QB3A 4NR7A 4A9FA 4MR3A 4YY4A 3VKHA 5FG6A 1N72A 5EU1A 2MUMA 5CQ4A 2D82A 2RNWA 4A9OA 4LKAA 4HXOA 5B76A 1F68A 4NQMA 3ZYUA 5C89A 2RS9B 2L5EA 4ZC9A 4YYGA 4PTBA 4O7FA 5HM0A 2ECGA 2YQLA 5JI8A 4BW2A 2R10A 2EGMA 3E2DA 5EPSA 4YATA 4QF2A 2YW5A 2L0BA 5CU8A 5F60A 3M99A 1WUGA 3ZNIA 1HYIA 5HQ5A 4NRBA 5CS8A 4MEPA 2L84A 5EGUA 4PS5A 4TTEA 3DQVR 2LXHC 4ZDTA 3ZPV1 5FDZA 3DWDA 4XY9A 2E6SA 5EICA 4CA1A 4QSXA 5E9IA 4GNEA 2LN0A 1T1HA 1FBVA 5A83A 2KE1A 4ZW1A 2VJFB 3G0JA 5ETBA 5FFYA 4NUCA 3V43A 1JM7B 4UP0A 5G05B 3FKMX 3UV4A 3DAIA 4QY4A 2KFTA 2P57A 2E6RA 2HDPA 2YUCA 2DX8A 2E3KA 2FD4A 3QZVA 5K29A 3GL6A 4KCXA 2MD7B 3ZTGA 4J3IA 4BW3A 3I3JA 4N4HA 4UIYA 4Z0OA 4QR5A 4PCEA 5G0FA 2F42A 3SVHA 2K4DA 4LYSA 3C6WA 4QSUA 2FSAA 1WIMA 3QZSA 4NRAA 4QUTA 5I7XA 2M85A 3Q2EA 4UYHA 2MA6A 4A9IA 4UYFA 5C85A 4B7YC 4L7XA 2F6NA 4PCIA 4QEVA 5HFRA 4N4GA 5LJ2A 5EQ1A 3S91A 2OWAA 4UIWA 5E9KA 4CFLA 3N9LA 4PKLA 2NXBA 2YT5A 5FH6A 3KQIA 4QZSA 5DKCA 5KTWA 3L11A 2XOZA 4V3LC 3KV5A 4TZ8A 5A5PA 3T6RA 3U5JA 3GV4A 5FERA 4A4CA 3ZVYA 4I7BA 5I3LA 2R0SA 5I80A 2RNXA 2YEKA 4QC1A 4MR5A 4XUBA 4YK0A 2E61A 3ZPVE 2YQDA 4NUEA 2D9EA 3Q1DA 5LKZA 4J0RA 4PY6A 4TYLA 2UZGA 3PURA 3P1CA 5F1LA 5IGLA 5II2A 5CQ8A 1EQFA 5D3TA 5LKXA 2KYUA 3O47A 5B78A 2M6MA 1E4UA 2KIZA 5ENIA 5FFVA 4A0CD 4YH4A 5D3JA 3FL2A 2G6QA 2KWKA 5LVRA 2JRJA 3O37A 5ACYA 2MJVB 4ALGA 2LGLA 4CURA 2DKWA 4Z6IA 2YHNA 1WENA 5FE5A 2LDRA 4FO9A 4YYDA 4YYJA 4AUQB 5HEMA 2YDWA 5F62A 3K2JA 4WHWA 4YBSA 2YSMA 3MDBC 5D3RA 2ECJA 2RSDA 4P5OB 2G4AA 1LDJB 2H0DB 5SVXA 3AQAA 5D1KB 3JUEA 2KWNA 3ERRA 3JVKA 3LVRE 4OUFA 2YYRA 3UV5A 5DKHA 4NR8A 3HCSA 3UV2A 5KU3A 5EP7A 3U5MA 1XWHA 2ECIA 3O33A 3LQJA 5TB6A 2MNYA 3L1XA 4O70A 1BORA 4LYIA 5D3SA 5AMEA 5HQ6A 4HXPA 3PUQA 5EYAF 2QICA 5I1QA 5CQ3A 3MB3A 3RCWA 3KDEC 5A82A 4NR5A 1X4IA 4BJXA 4FIPA 5HRVA 5DX4A 2RR4A 3UW9A 5F63A 4GB0A 3HCTA 2EGPA 4HXNA 5H85A 5A5NA 5D0CA 2LRIC 3LVQE 2CRRA 4O71A 5ENFA 3MHHA 4A9JA 1ZS5A 4HBYA 5F61A 5IG6A 5KTXA 3LJUX 3MUKA 4F52B 1WE9A 2LQ6A 3O7AA 4UIZA 5HRWA 4MEOA 2CSVA 4NR4A 1VFYA 3N9NA 4TT2A 4O62A 3FJUB 2I8NA 1MBMA 1LDKC 1Z60A 5F36A 2JMJA 2OSSA 5C7NA 5C8GA 2KKYA 4BW4A 2D8SA 5LCWB 4QEWA 3P1EA 2QIZA 3HTKC 4IC2A 4CUQA 4MR6A 3LQHA 5E3GA 2YQMA 5AITA 4N4IA 3MB4A 5EPRA 5CUDA 2JM3A 4QYLA 4TZ2A 5H1TA 2VNFA 4QSQA 5J0DA 3EB5A 3M63A 5HCLA 2LGVA 5CZGA 2L43A 2RFJA 4E96A 5CQAA 3D1DA 4CUSA 4YBMA 4LK9A 5G04B 3LJWA 5FBXA 5L8TA 5EWWA 2CKLA 5EWDA 3HCUA 1U6GB 5I29A 2F6JA 5EA1A 1JM7A 3NXBA 4XI1A 4Q6FA 5CGPA 4O64A 4R8PK 5ENEA 5EWVA 2XB1A 3TLPA 5I86A 3S92A 3FANA 2K17A 5FB1A 1WEVA 4CL9A 4LR6A 4NR6A 4ZQLA 4QF3A 1WESA 3O36A 2KR4A 5G4SA 3P1FA 4WZ2A 4YYHA 4QC3A 5EVAA 3P1DA 4GNFA 5TRBA 5FE1A 4OGIA 4YYKA 2LGKA 5B75A 2RNYA 1VYXA 3DPLR 3UVXA 3SVGA 4LZSA 2KKXA 5I40A 2VJEB 2C2VS 4CUUA 3T7LA 5E3DA 5DY7A 2LSPB 4C67A 4QSSA 5FE8A 5FG4A 1X4UA 2B0OE 3ONIA 1Z6UA 5CRMA 2CSZA 2Y1MA 2VPGA 4Z6HA 4CUPA 5DBMA 5CUBA 5FFWA 2H60A 4YADA 4A9MA 4AKHA 2CRWA 4Z93A 3FEHA 3N9PA 2MNZA 2M1RA 3Q2FA 3MQMA 4CFKA 5F3AA 2BAYA 5TDRA 5K3QA 2DSMA 4UIVA 3VK6A 5C87A 4LZ2A 5D3HA 4O77A 2JMIA 5CUCA 2PUYA 5I88A 3I2DA 3MULA 1X4JA 4WHUA 4XYAA 5ENCA 2EXUA 3H7HA 5TDWA 4X2IA 2CONA 3FAOA 3EB6A 2EJNA 5LJ1A 4Z1SA 2EA6A 3SVFA 2Y1NA 5EV9A 5TBNA 5DFBA 5DLXA 3RTRB 2L75A 2DVVA 5F5ZA 5TABA 4HBWA 2KREA 5CP5A 2YURA 5C4QA 2YREA 2JMDA 2ECVA 4TKPB 1PUOA 3LQIA 1Z2QA 5A7CA 5D24A 2VP7A 2DVSA 3P5OA 5DYXA 4NXJA 4HBXA 4LRGA 2RO1A 5DLZA 2L85A 2ECTA 4KV1A 5L97A 4QBMA 5DFCA 5A5SA 2LV9A 4HBVA 1N87A 2MKEA 3KV6A 5KO4A 5CUAA 5CQ5A 4C9ZA 4AYCA 4TQNA 2OXQC 5SVIB 2G43A 4A9NA 5KH7A 2LGGA 4LDFA 4TU4A 4C66A 3VKGA 5IIDA 4MVTA 5G4RA 5I7YA 4UYGA 4LYWA 2GRCA 4MEQA 4NN2A 5II1A 4UI9B 4QR3A 2MD8C 4J1PA 5HRXA 4AKIA 4ALHA 3RPGB 5DFDA 5D25A 3HMHA 5C11A 1WILA 4IR6A 4QR4A 4IORA 5A81A 2DVRA 5BT5A 4GPJA 1JOCA 4NQNA 1WEWA 5ENGA 3LDYA 4YH3A 4HXKA 4R2YA 4UYDA 2JUNA 2FUUA 4TU6A 2XOCA 4UP5A 4A4BA 5HENA 5E9YA 4FLPA 4BW1A 5EWCA 2YU4A 4LZRA 1MM3A 3ZYQA 5AD2A 5FE7A 2L80A 5DW1A 4MSXA 4LADB 4N4FA 4UIXA 1FP0A 2FUIA 2CSYA 3IU5A 5IBNA 4O7AA 4YYIA 5H1UA 3LXJA 2D8UA 3M62A 4A9KA 3SHBA 2KTBB 2DWWA 1RMDA 4HXRA 4UIUA 4QSPA 5E9MA 4I7DA 4IOQA 4LJNA 5SVYA 5CQTA 4MENA 1V87A 3LRQA 1X0JA 5JWMA 4H9DA 5LJ0A 3QZTA 2OO1A 4IR4A 4OGCA 5DKDA 2DJAA 2E7OA 5HFQA 2KWOA 1WEMA 4YYNA 2G45A 5A5QA 3N9QA 3D7CA 2VJFA 3IU6A 5E7DA 4OGEA 4NYXA 4A9LA 2WP1A 2YEMA 2XP0A 5CUEA 5E74A 2QJ0A 4YYMA 4V3KC 4WZ0A 4Q0OA 2VJEA 5HELA 2DVQA 5H1VA 4O7BA 5CQ7A 5E9LA 4UYEA 5D26A 3JVMA 2MT5A 4S3OB 1VD4A 3C5KA 2DATA 4XUAA 4AKNA 5B8DA 5LVQA 4O78A 4S3OC 1HYJA 2LAUA 1G25A 4KV4A 5DYAA 2YELA 5CUGA 4HXSA 4IR3A 5CTLA 5CRZA 5DW2A 5ENBA 1WEPA 2ZETC 5DYCA 5E73A 5F25A 2E7NA 5CFWA 2MIQA 2VPEA 4QSRA 4Q0NA 2YHOA 1ZKRA 5D3LA 4CLBA 2VPDA 5F1HA 1CHCA 2L7PA 5HQ7A 4NYVA 4NR9A 3UVWA 5FH8A 5FE4A 1ZBDB 3O35A 4FK5A 2KGGA 3DWYA 4QSVA 5HJCA 3G0LA 5I89A 2CKLB 4TT4A 5ENJA 4O74A 4GNDA 5BT4A 3L1ZB 5DYUA 2KGIA 5CQ6A 2WP2A 4QUUA 4RVRA 2PNXA 2IQJA 3O34A 2ECWA 4HXMA 4AI6A 1MM2A 2RI7A 3AADA 5FH7A 4X3GA 5KHMA
chains in the Genus database with same CATH topology
4IOOA 1DVPA 5L98A 4YY6A 5KTUA 5EI4A 5D3PA 5IGNA 1K2FA 4YABA 4NS5A 4FJCA 4AVXA 3SOWA 4A9EA 4J0SA 2C2LA 5EWHA 5FEYA 5A5OA 4QNSA 2YW8A 5DKAA 4YAXA 2HYED 3SOXA 5LKUA 2R0VA 4QSWA 5COIA 1JM4B 3MHSA 4QYDA 2H0DA 2OUOA 5A85A 4CUTA 4UYFB 5EISA 2K1JA 3IHPA 3SOUA 5B77A 1F62A 2EODA 3NG2A 5FE3A 4TS8A 1WEEA 5ENHA 2I50A 3UVDA 4PPEA 2NAAA 5H9MA 2N9GA 3U5OA 4O7EA 2M3HA 4CCGX 4LLBA 4B86C 2YSJA 4WZ3B 5HLSA 3HMEA 4BBQA 1IYMA 5IGMA 5J3XA 3MXFA 4WIVA 4A49A 5D1MB 5A5RA 5D3NA 5CY9A 5ETDA 4OGJA 3U5KA 1WEUA 5B79A 4UITA 4WA6A 1WUMA 5BT3A 2VPBA 1E6IA 4GNGA 5IGKA 4QEUA 2KWJA 4NUDA 3ZVZB 5FG5A 5FE2A 4O72A 2YYNA 3O70A 3JVLA 3RPGC 4XY8A 3ASLA 4YC9A 5KH3A 4LC2A 4Y03A 5EPBA 4L58A 3PHDA 5E9VA 5AD3A 2L5UA 2CT2A 5FE0A 4MR4A 5LKTA 3N9MA 5EM3A 4DONA 4AP4A 5FE6A 3U5LA 4QSTA 4O76A 5DINA 5TCMA 4IC3A 2IDAA 5LUUA 5KH9A 4ZUXU 5F2PA 5L96A 5D1LB 5AIUA 5L8UA 2K16A 2LXPC 2XEUA 2Y43A 4NYWA 4AYCB 3JVJA 4TT6A 2AN6A 3UVYA 4NRCA 1WFKA 2KU3A 2I7KA 5JG6A 2R0YA 4F3IA 5AMFA 3KNVA 3U5PA 4R7EA 4Z1QA 4O7CA 1WEQA 4IR5A 5FE9A 3N9OA 5C13A 3U5NA 3HMFA 1JSPB 5FB0A 5EK9A 4A9HA 2MA5A 2ECNA 4I7CA 5D7XA 4BHWA 5I83A 4N3WA 4O75A 4HXLA 5E0RA 1WGMA 3GG3A 1WEOA 4W4UA 5L99A 4YBTA 5CPEA 4QB3A 4NR7A 4A9FA 4MR3A 4YY4A 5FG6A 1N72A 5EU1A 2MUMA 5CQ4A 2D82A 2RNWA 4A9OA 4LKAA 4HXOA 5B76A 1F68A 4NQMA 3ZYUA 5C89A 2RS9B 2L5EA 4ZC9A 4YYGA 4PTBA 4O7FA 5HM0A 2ECGA 2YQLA 5JI8A 4BW2A 2R10A 5EPSA 4YATA 4QF2A 2YW5A 2L0BA 5CU8A 5F60A 3M99A 1WUGA 3ZNIA 1HYIA 5HQ5A 4NRBA 5CS8A 4MEPA 2L84A 5EGUA 4PS5A 4TTEA 3DQVR 2LXHC 4ZDTA 3ZPV1 5FDZA 4XY9A 2E6SA 5EICA 4CA1A 4QSXA 5E9IA 4GNEA 2LN0A 1T1HA 1FBVA 5A83A 2KE1A 4ZW1A 2VJFB 3G0JA 5ETBA 5FFYA 4NUCA 3V43A 1JM7B 4UP0A 5G05B 3FKMX 3UV4A 3DAIA 4QY4A 2KFTA 2E6RA 2HDPA 2YUCA 2DX8A 2E3KA 3QZVA 5K29A 3GL6A 4KCXA 2MD7B 3ZTGA 4J3IA 4BW3A 3I3JA 4N4HA 4UIYA 4QR5A 4PCEA 5G0FA 2F42A 3SVHA 2K4DA 4LYSA 3C6WA 4QSUA 2FSAA 1WIMA 3QZSA 4NRAA 4QUTA 5I7XA 2M85A 3Q2EA 4UYHA 2MA6A 4A9IA 4UYFA 5C85A 4B7YC 4L7XA 2F6NA 4PCIA 4QEVA 5HFRA 4N4GA 5LJ2A 5EQ1A 3S91A 4UIWA 5E9KA 4CFLA 3N9LA 4PKLA 2NXBA 2YT5A 5FH6A 3KQIA 4QZSA 5DKCA 5KTWA 3L11A 4V3LC 3KV5A 4TZ8A 5A5PA 3T6RA 3U5JA 3GV4A 5FERA 4A4CA 3ZVYA 4I7BA 5I3LA 2R0SA 5I80A 2RNXA 2YEKA 4QC1A 4MR5A 4XUBA 4YK0A 3ZPVE 2YQDA 4NUEA 2D9EA 5LKZA 4J0RA 4PY6A 4TYLA 2UZGA 3PURA 3P1CA 5F1LA 5IGLA 5II2A 5CQ8A 1EQFA 5D3TA 5LKXA 2KYUA 5B78A 2M6MA 1E4UA 2KIZA 5ENIA 5FFVA 4A0CD 4YH4A 5D3JA 3FL2A 2G6QA 2KWKA 5LVRA 2JRJA 3O37A 5ACYA 2MJVB 4ALGA 2LGLA 4CURA 2DKWA 4Z6IA 2YHNA 1WENA 5FE5A 2LDRA 4FO9A 4YYDA 4YYJA 4AUQB 5HEMA 2YDWA 5F62A 3K2JA 4WHWA 4YBSA 2YSMA 5D3RA 2ECJA 2RSDA 4P5OB 2G4AA 1LDJB 2H0DB 3AQAA 5D1KB 2KWNA 3JVKA 4OUFA 2YYRA 3UV5A 5DKHA 4NR8A 3HCSA 3UV2A 5KU3A 5EP7A 3U5MA 1XWHA 2ECIA 3O33A 3LQJA 5TB6A 2MNYA 3L1XA 4O70A 1BORA 4LYIA 5D3SA 5AMEA 5HQ6A 4HXPA 3PUQA 5EYAF 2QICA 5I1QA 5CQ3A 3MB3A 3RCWA 5A82A 4NR5A 1X4IA 4BJXA 4FIPA 5HRVA 5DX4A 3UW9A 5F63A 4GB0A 3HCTA 2EGPA 4HXNA 5H85A 5A5NA 5D0CA 2LRIC 3MHHA 4O71A 5ENFA 4A9JA 1ZS5A 4HBYA 5F61A 5IG6A 5KTXA 4F52B 3MUKA 1WE9A 2LQ6A 3O7AA 4UIZA 5HRWA 4MEOA 4NR4A 1VFYA 3N9NA 4TT2A 2I8NA 1LDKC 1Z60A 5F36A 2JMJA 2OSSA 5C7NA 5C8GA 4BW4A 2D8SA 5LCWB 4QEWA 3P1EA 2QIZA 3HTKC 4IC2A 4CUQA 4MR6A 3LQHA 5E3GA 2YQMA 5AITA 4N4IA 3MB4A 5EPRA 5CUDA 2VNFA 4QYLA 4TZ2A 5H1TA 3M63A 4QSQA 5J0DA 3EB5A 5HCLA 2LGVA 5CZGA 2L43A 2RFJA 4E96A 5CQAA 4CUSA 4YBMA 4LK9A 5G04B 3LJWA 5FBXA 5L8TA 5EWWA 2CKLA 5EWDA 3HCUA 1U6GB 5I29A 2F6JA 5EA1A 1JM7A 3NXBA 4XI1A 4Q6FA 5CGPA 4O64A 4R8PK 5ENEA 5EWVA 2XB1A 3TLPA 5I86A 3S92A 2K17A 5FB1A 1WEVA 4CL9A 4LR6A 4NR6A 4ZQLA 4QF3A 1WESA 3O36A 2KR4A 5G4SA 3P1FA 4WZ2A 4YYHA 4QC3A 5EVAA 3P1DA 4GNFA 5TRBA 5FE1A 4OGIA 4YYKA 2LGKA 5B75A 2RNYA 1VYXA 3DPLR 3UVXA 3SVGA 4LZSA 5I40A 2VJEB 2C2VS 4CUUA 3T7LA 5E3DA 5DY7A 2LSPB 4C67A 4QSSA 5FE8A 5FG4A 1X4UA 3ONIA 1Z6UA 5CRMA 2CSZA 2Y1MA 2VPGA 4Z6HA 4CUPA 5DBMA 5CUBA 5FFWA 2H60A 4YADA 4A9MA 3N9PA 4Z93A 2MNZA 2M1RA 3Q2FA 3MQMA 4CFKA 5F3AA 2BAYA 5TDRA 4UIVA 3VK6A 5C87A 4LZ2A 5D3HA 4O77A 2JMIA 5CUCA 2PUYA 5I88A 3I2DA 3MULA 1X4JA 4WHUA 4XYAA 5ENCA 5TDWA 4X2IA 3EB6A 5LJ1A 4Z1SA 2EA6A 3SVFA 2Y1NA 5EV9A 5TBNA 5DFBA 5DLXA 3RTRB 2L75A 2DVVA 5F5ZA 5TABA 4HBWA 2KREA 5CP5A 2YURA 5C4QA 2YREA 2JMDA 2ECVA 4TKPB 3LQIA 1Z2QA 5A7CA 5D24A 2VP7A 2DVSA 3P5OA 5DYXA 4NXJA 4HBXA 4LRGA 2RO1A 5DLZA 2L85A 2ECTA 4KV1A 5L97A 5DFCA 4QBMA 5A5SA 2LV9A 4HBVA 1N87A 3KV6A 5KO4A 5CUAA 5CQ5A 4C9ZA 4AYCA 4TQNA 2OXQC 2G43A 4A9NA 5KH7A 2LGGA 4LDFA 4TU4A 4C66A 5IIDA 4MVTA 5G4RA 5I7YA 4UYGA 4LYWA 2GRCA 4MEQA 4NN2A 5II1A 4UI9B 4QR3A 2MD8C 4J1PA 5HRXA 3RPGB 4ALHA 5DFDA 5D25A 3HMHA 5C11A 1WILA 4IR6A 4QR4A 4IORA 5A81A 2DVRA 5BT5A 4GPJA 1JOCA 4NQNA 1WEWA 5ENGA 4YH3A 4HXKA 4R2YA 4UYDA 2FUUA 4TU6A 4UP5A 4A4BA 5HENA 5E9YA 4FLPA 4BW1A 5EWCA 2YU4A 4LZRA 1MM3A 3ZYQA 5AD2A 5FE7A 2L80A 5DW1A 4MSXA 4LADB 4N4FA 4UIXA 1FP0A 2FUIA 2CSYA 3IU5A 5IBNA 4O7AA 4YYIA 5H1UA 3LXJA 3M62A 4A9KA 3SHBA 2KTBB 2DWWA 1RMDA 4HXRA 4UIUA 4QSPA 5E9MA 4I7DA 4IOQA 4LJNA 5CQTA 4MENA 1V87A 3LRQA 1X0JA 5JWMA 5LJ0A 3QZTA 2OO1A 4IR4A 5DKDA 2KWOA 2E7OA 5HFQA 1WEMA 4YYNA 2G45A 5A5QA 3N9QA 3D7CA 2VJFA 3IU6A 5E7DA 4NYXA 4A9LA 2WP1A 2YEMA 5CUEA 5E74A 2QJ0A 4YYMA 4V3KC 4WZ0A 4Q0OA 2VJEA 5HELA 2DVQA 5H1VA 4O7BA 5CQ7A 5E9LA 4UYEA 5D26A 3JVMA 2MT5A 4S3OB 1VD4A 3C5KA 2DATA 4XUAA 4AKNA 5B8DA 5LVQA 4O78A 4S3OC 1HYJA 1G25A 4KV4A 5DYAA 2YELA 5CUGA 4HXSA 4IR3A 5CTLA 5CRZA 5DW2A 5ENBA 1WEPA 2ZETC 5DYCA 5E73A 5F25A 2E7NA 5CFWA 2MIQA 2VPEA 4QSRA 4Q0NA 2YHOA 5D3LA 4CLBA 2VPDA 5F1HA 1CHCA 5HQ7A 4NYVA 4NR9A 3UVWA 5FH8A 5FE4A 1ZBDB 3O35A 4FK5A 2KGGA 3DWYA 4QSVA 5HJCA 3G0LA 5I89A 2CKLB 4TT4A 5ENJA 4O74A 4GNDA 5BT4A 3L1ZB 5DYUA 2KGIA 5CQ6A 2WP2A 4QUUA 4RVRA 2PNXA 3O34A 2ECWA 4HXMA 1MM2A 2RI7A 3AADA 5FH7A 4X3GA 5KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOO A;  1DVP A;  5L98 A;  4YY6 A;  5KTU A;  5EI4 A;  5D3P A;  5IGN A;  1K2F A;  4YAB A;  4NS5 A;  4FJC A;  4AVX A;  3SOW A;  4A9E A;  4J0S A;  2C2L A;  5EWH A;  5FEY A;  5A5O A;  4QNS A;  2YW8 A;  5DKA A;  4YAX A;  2HYE D;  3SOX A;  5LKU A;  2R0V A;  4QSW A;  5COI A;  1JM4 B;  3MHS A;  4QYD A;  2H0D A;  2OUO A;  5A85 A;  4CUT A;  4UYF B;  5EIS A;  2K1J A;  3IHP A;  3SOU A;  5B77 A;  1F62 A;  2EOD A;  3NG2 A;  5FE3 A;  4TS8 A;  1WEE A;  5ENH A;  2I50 A;  3UVD A;  4PPE A;  2NAA A;  5H9M A;  2N9G A;  3U5O A;  4O7E A;  2M3H A;  4CCG X;  4LLB A;  4B86 C;  2YSJ A;  4WZ3 B;  5HLS A;  3HME A;  4BBQ A;  1IYM A;  5IGM A;  5J3X A;  3MXF A;  4WIV A;  4A49 A;  5D1M B;  5A5R A;  5D3N A;  5CY9 A;  5ETD A;  4OGJ A;  3U5K A;  1WEU A;  5B79 A;  4UIT A;  4WA6 A;  1WUM A;  5BT3 A;  2VPB A;  1E6I A;  4GNG A;  5IGK A;  4QEU A;  2KWJ A;  4NUD A;  3ZVZ B;  5FG5 A;  5FE2 A;  4O72 A;  2YYN A;  3O70 A;  3JVL A;  3RPG C;  4XY8 A;  3ASL A;  4YC9 A;  5KH3 A;  4LC2 A;  4Y03 A;  5EPB A;  4L58 A;  3PHD A;  5E9V A;  5AD3 A;  2L5U A;  2CT2 A;  5FE0 A;  4MR4 A;  5LKT A;  3N9M A;  5EM3 A;  4DON A;  4AP4 A;  5FE6 A;  3U5L A;  4QST A;  4O76 A;  5DIN A;  5TCM A;  4IC3 A;  2IDA A;  5LUU A;  5KH9 A;  4ZUX U;  5F2P A;  5L96 A;  5D1L B;  5AIU A;  5L8U A;  2K16 A;  2LXP C;  2XEU A;  2Y43 A;  4NYW A;  4AYC B;  3JVJ A;  4TT6 A;  2AN6 A;  3UVY A;  4NRC A;  1WFK A;  2KU3 A;  2I7K A;  5JG6 A;  2R0Y A;  4F3I A;  5AMF A;  3KNV A;  3U5P A;  4R7E A;  4Z1Q A;  4O7C A;  1WEQ A;  4IR5 A;  5FE9 A;  3N9O A;  5C13 A;  3U5N A;  3HMF A;  1JSP B;  5FB0 A;  5EK9 A;  4A9H A;  2MA5 A;  2ECN A;  4I7C A;  5D7X A;  4BHW A;  5I83 A;  4N3W A;  4O75 A;  4HXL A;  5E0R A;  1WGM A;  3GG3 A;  1WEO A;  4W4U A;  5L99 A;  4YBT A;  5CPE A;  4QB3 A;  4NR7 A;  4A9F A;  4MR3 A;  4YY4 A;  5FG6 A;  1N72 A;  5EU1 A;  2MUM A;  5CQ4 A;  2D82 A;  2RNW A;  4A9O A;  4LKA A;  4HXO A;  5B76 A;  1F68 A;  4NQM A;  3ZYU A;  5C89 A;  2RS9 B;  2L5E A;  4ZC9 A;  4YYG A;  4PTB A;  4O7F A;  5HM0 A;  2ECG A;  2YQL A;  5JI8 A;  4BW2 A;  2R10 A;  5EPS A;  4YAT A;  4QF2 A;  2YW5 A;  2L0B A;  5CU8 A;  5F60 A;  3M99 A;  1WUG A;  3ZNI A;  1HYI A;  5HQ5 A;  4NRB A;  5CS8 A;  4MEP A;  2L84 A;  5EGU A;  4PS5 A;  4TTE A;  3DQV R;  2LXH C;  4ZDT A;  3ZPV 1;  5FDZ A;  4XY9 A;  2E6S A;  5EIC A;  4CA1 A;  4QSX A;  5E9I A;  4GNE A;  2LN0 A;  1T1H A;  1FBV A;  5A83 A;  2KE1 A;  4ZW1 A;  2VJF B;  3G0J A;  5ETB A;  5FFY A;  4NUC A;  3V43 A;  1JM7 B;  4UP0 A;  5G05 B;  3FKM X;  3UV4 A;  3DAI A;  4QY4 A;  2KFT A;  2E6R A;  2HDP A;  2YUC A;  2DX8 A;  2E3K A;  3QZV A;  5K29 A;  3GL6 A;  4KCX A;  2MD7 B;  3ZTG A;  4J3I A;  4BW3 A;  3I3J A;  4N4H A;  4UIY A;  4QR5 A;  4PCE A;  5G0F A;  2F42 A;  3SVH A;  2K4D A;  4LYS A;  3C6W A;  4QSU A;  2FSA A;  1WIM A;  3QZS A;  4NRA A;  4QUT A;  5I7X A;  2M85 A;  3Q2E A;  4UYH A;  2MA6 A;  4A9I A;  4UYF A;  5C85 A;  4B7Y C;  4L7X A;  2F6N A;  4PCI A;  4QEV A;  5HFR A;  4N4G A;  5LJ2 A;  5EQ1 A;  3S91 A;  4UIW A;  5E9K A;  4CFL A;  3N9L A;  4PKL A;  2NXB A;  2YT5 A;  5FH6 A;  3KQI A;  4QZS A;  5DKC A;  5KTW A;  3L11 A;  4V3L C;  3KV5 A;  4TZ8 A;  5A5P A;  3T6R A;  3U5J A;  3GV4 A;  5FER A;  4A4C A;  3ZVY A;  4I7B A;  5I3L A;  2R0S A;  5I80 A;  2RNX A;  2YEK A;  4QC1 A;  4MR5 A;  4XUB A;  4YK0 A;  3ZPV E;  2YQD A;  4NUE A;  2D9E A;  5LKZ A;  4J0R A;  4PY6 A;  4TYL A;  2UZG A;  3PUR A;  3P1C A;  5F1L A;  5IGL A;  5II2 A;  5CQ8 A;  1EQF A;  5D3T A;  5LKX A;  2KYU A;  5B78 A;  2M6M A;  1E4U A;  2KIZ A;  5ENI A;  5FFV A;  4A0C D;  4YH4 A;  5D3J A;  3FL2 A;  2G6Q A;  2KWK A;  5LVR A;  2JRJ A;  3O37 A;  5ACY A;  2MJV B;  4ALG A;  2LGL A;  4CUR A;  2DKW A;  4Z6I A;  2YHN A;  1WEN A;  5FE5 A;  2LDR A;  4FO9 A;  4YYD A;  4YYJ A;  4AUQ B;  5HEM A;  2YDW A;  5F62 A;  3K2J A;  4WHW A;  4YBS A;  2YSM A;  5D3R A;  2ECJ A;  2RSD A;  4P5O B;  2G4A A;  1LDJ B;  2H0D B;  3AQA A;  5D1K B;  2KWN A;  3JVK A;  4OUF A;  2YYR A;  3UV5 A;  5DKH A;  4NR8 A;  3HCS A;  3UV2 A;  5KU3 A;  5EP7 A;  3U5M A;  1XWH A;  2ECI A;  3O33 A;  3LQJ A;  5TB6 A;  2MNY A;  3L1X A;  4O70 A;  1BOR A;  4LYI A;  5D3S A;  5AME A;  5HQ6 A;  4HXP A;  3PUQ A;  5EYA F;  2QIC A;  5I1Q A;  5CQ3 A;  3MB3 A;  3RCW A;  5A82 A;  4NR5 A;  1X4I A;  4BJX A;  4FIP A;  5HRV A;  5DX4 A;  3UW9 A;  5F63 A;  4GB0 A;  3HCT A;  2EGP A;  4HXN A;  5H85 A;  5A5N A;  5D0C A;  2LRI C;  3MHH A;  4O71 A;  5ENF A;  4A9J A;  1ZS5 A;  4HBY A;  5F61 A;  5IG6 A;  5KTX A;  4F52 B;  3MUK A;  1WE9 A;  2LQ6 A;  3O7A A;  4UIZ A;  5HRW A;  4MEO A;  4NR4 A;  1VFY A;  3N9N A;  4TT2 A;  2I8N A;  1LDK C;  1Z60 A;  5F36 A;  2JMJ A;  2OSS A;  5C7N A;  5C8G A;  4BW4 A;  2D8S A;  5LCW B;  4QEW A;  3P1E A;  2QIZ A;  3HTK C;  4IC2 A;  4CUQ A;  4MR6 A;  3LQH A;  5E3G A;  2YQM A;  5AIT A;  4N4I A;  3MB4 A;  5EPR A;  5CUD A;  2VNF A;  4QYL A;  4TZ2 A;  5H1T A;  3M63 A;  4QSQ A;  5J0D A;  3EB5 A;  5HCL A;  2LGV A;  5CZG A;  2L43 A;  2RFJ A;  4E96 A;  5CQA A;  4CUS A;  4YBM A;  4LK9 A;  5G04 B;  3LJW A;  5FBX A;  5L8T A;  5EWW A;  2CKL A;  5EWD A;  3HCU A;  1U6G B;  5I29 A;  2F6J A;  5EA1 A;  1JM7 A;  3NXB A;  4XI1 A;  4Q6F A;  5CGP A;  4O64 A;  4R8P K;  5ENE A;  5EWV A;  2XB1 A;  3TLP A;  5I86 A;  3S92 A;  2K17 A;  5FB1 A;  1WEV A;  4CL9 A;  4LR6 A;  4NR6 A;  4ZQL A;  4QF3 A;  1WES A;  3O36 A;  2KR4 A;  5G4S A;  3P1F A;  4WZ2 A;  4YYH A;  4QC3 A;  5EVA A;  3P1D A;  4GNF A;  5TRB A;  5FE1 A;  4OGI A;  4YYK A;  2LGK A;  5B75 A;  2RNY A;  1VYX A;  3DPL R;  3UVX A;  3SVG A;  4LZS A;  5I40 A;  2VJE B;  2C2V S;  4CUU A;  3T7L A;  5E3D A;  5DY7 A;  2LSP B;  4C67 A;  4QSS A;  5FE8 A;  5FG4 A;  1X4U A;  3ONI A;  1Z6U A;  5CRM A;  2CSZ A;  2Y1M A;  2VPG A;  4Z6H A;  4CUP A;  5DBM A;  5CUB A;  5FFW A;  2H60 A;  4YAD A;  4A9M A;  3N9P A;  4Z93 A;  2MNZ A;  2M1R A;  3Q2F A;  3MQM A;  4CFK A;  5F3A A;  2BAY A;  5TDR A;  4UIV A;  3VK6 A;  5C87 A;  4LZ2 A;  5D3H A;  4O77 A;  2JMI A;  5CUC A;  2PUY A;  5I88 A;  3I2D A;  3MUL A;  1X4J A;  4WHU A;  4XYA A;  5ENC A;  5TDW A;  4X2I A;  3EB6 A;  5LJ1 A;  4Z1S A;  2EA6 A;  3SVF A;  2Y1N A;  5EV9 A;  5TBN A;  5DFB A;  5DLX A;  3RTR B;  2L75 A;  2DVV A;  5F5Z A;  5TAB A;  4HBW A;  2KRE A;  5CP5 A;  2YUR A;  5C4Q A;  2YRE A;  2JMD A;  2ECV A;  4TKP B;  3LQI A;  1Z2Q A;  5A7C A;  5D24 A;  2VP7 A;  2DVS A;  3P5O A;  5DYX A;  4NXJ A;  4HBX A;  4LRG A;  2RO1 A;  5DLZ A;  2L85 A;  2ECT A;  4KV1 A;  5L97 A;  5DFC A;  4QBM A;  5A5S A;  2LV9 A;  4HBV A;  1N87 A;  3KV6 A;  5KO4 A;  5CUA A;  5CQ5 A;  4C9Z A;  4AYC A;  4TQN A;  2OXQ C;  2G43 A;  4A9N A;  5KH7 A;  2LGG A;  4LDF A;  4TU4 A;  4C66 A;  5IID A;  4MVT A;  5G4R A;  5I7Y A;  4UYG A;  4LYW A;  2GRC A;  4MEQ A;  4NN2 A;  5II1 A;  4UI9 B;  4QR3 A;  2MD8 C;  4J1P A;  5HRX A;  3RPG B;  4ALH A;  5DFD A;  5D25 A;  3HMH A;  5C11 A;  1WIL A;  4IR6 A;  4QR4 A;  4IOR A;  5A81 A;  2DVR A;  5BT5 A;  4GPJ A;  1JOC A;  4NQN A;  1WEW A;  5ENG A;  4YH3 A;  4HXK A;  4R2Y A;  4UYD A;  2FUU A;  4TU6 A;  4UP5 A;  4A4B A;  5HEN A;  5E9Y A;  4FLP A;  4BW1 A;  5EWC A;  2YU4 A;  4LZR A;  1MM3 A;  3ZYQ A;  5AD2 A;  5FE7 A;  2L80 A;  5DW1 A;  4MSX A;  4LAD B;  4N4F A;  4UIX A;  1FP0 A;  2FUI A;  2CSY A;  3IU5 A;  5IBN A;  4O7A A;  4YYI A;  5H1U A;  3LXJ A;  3M62 A;  4A9K A;  3SHB A;  2KTB B;  2DWW A;  1RMD A;  4HXR A;  4UIU A;  4QSP A;  5E9M A;  4I7D A;  4IOQ A;  4LJN A;  5CQT A;  4MEN A;  1V87 A;  3LRQ A;  1X0J A;  5JWM A;  5LJ0 A;  3QZT A;  2OO1 A;  4IR4 A;  5DKD A;  2KWO A;  2E7O A;  5HFQ A;  1WEM A;  4YYN A;  2G45 A;  5A5Q A;  3N9Q A;  3D7C A;  2VJF A;  3IU6 A;  5E7D A;  4NYX A;  4A9L A;  2WP1 A;  2YEM A;  5CUE A;  5E74 A;  2QJ0 A;  4YYM A;  4V3K C;  4WZ0 A;  4Q0O A;  2VJE A;  5HEL A;  2DVQ A;  5H1V A;  4O7B A;  5CQ7 A;  5E9L A;  4UYE A;  5D26 A;  3JVM A;  2MT5 A;  4S3O B;  1VD4 A;  3C5K A;  2DAT A;  4XUA A;  4AKN A;  5B8D A;  5LVQ A;  4O78 A;  4S3O C;  1HYJ A;  1G25 A;  4KV4 A;  5DYA A;  2YEL A;  5CUG A;  4HXS A;  4IR3 A;  5CTL A;  5CRZ A;  5DW2 A;  5ENB A;  1WEP A;  2ZET C;  5DYC A;  5E73 A;  5F25 A;  2E7N A;  5CFW A;  2MIQ A;  2VPE A;  4QSR A;  4Q0N A;  2YHO A;  5D3L A;  4CLB A;  2VPD A;  5F1H A;  1CHC A;  5HQ7 A;  4NYV A;  4NR9 A;  3UVW A;  5FH8 A;  5FE4 A;  1ZBD B;  3O35 A;  4FK5 A;  2KGG A;  3DWY A;  4QSV A;  5HJC A;  3G0L A;  5I89 A;  2CKL B;  4TT4 A;  5ENJ A;  4O74 A;  4GND A;  5BT4 A;  3L1Z B;  5DYU A;  2KGI A;  5CQ6 A;  2WP2 A;  4QUU A;  4RVR A;  2PNX A;  3O34 A;  2ECW A;  4HXM A;  1MM2 A;  2RI7 A;  3AAD A;  5FH7 A;  4X3G A;  5KHM A; 
#chains in the Genus database with same CATH topology
 4IOO A;  1DVP A;  5L98 A;  4YY6 A;  5KTU A;  5EI4 A;  3FM8 C;  5D3P A;  5IGN A;  1K2F A;  4YAB A;  4NS5 A;  4FJC A;  4AVX A;  3SOW A;  4A9E A;  4J0S A;  2C2L A;  5EWH A;  5FEY A;  5A5O A;  4QNS A;  2YW8 A;  5DKA A;  4YAX A;  2HYE D;  3SOX A;  3PLW A;  5LKU A;  2R0V A;  4QSW A;  5COI A;  1JM4 B;  2FFW A;  3MHS A;  4QYD A;  2H0D A;  5SVI A;  2OUO A;  5A85 A;  4CUT A;  4UYF B;  5EIS A;  2K1J A;  3IHP A;  3SOU A;  5B77 A;  1F62 A;  2EOD A;  3NG2 A;  5FE3 A;  4TS8 A;  1WEE A;  2XOY A;  5ENH A;  2I50 A;  3UVD A;  4PPE A;  2NAA A;  5H9M A;  2N9G A;  3U5O A;  4O7E A;  2M3H A;  4CCG X;  4LLB A;  4B86 C;  2YSJ A;  4WZ3 B;  5HLS A;  3HME A;  4BBQ A;  1IYM A;  5IGM A;  4F1P A;  1DCQ A;  5J3X A;  3MXF A;  4WIV A;  3T9K A;  4A49 A;  5D1M B;  5A5R A;  5D3N A;  5CY9 A;  5ETD A;  4OGJ A;  3U5K A;  1WEU A;  5B79 A;  4UIT A;  4WA6 A;  1WUM A;  5BT3 A;  2VPB A;  1E6I A;  4GNG A;  5IGK A;  4QEU A;  2KWJ A;  4NUD A;  3ZVZ B;  5FG5 A;  5FE2 A;  4O72 A;  2YYN A;  3O70 A;  3JVL A;  3RPG C;  4XY8 A;  4Z0R A;  3ASL A;  4YC9 A;  5KH3 A;  4LC2 A;  4Y03 A;  5EPB A;  4L58 A;  3PHD A;  5E9V A;  5AD3 A;  2L5U A;  2CT2 A;  5FE0 A;  4MR4 A;  5LKT A;  3N9M A;  5EM3 A;  4DON A;  4AP4 A;  5FE6 A;  3U5L A;  4QST A;  4O76 A;  5DIN A;  5TCM A;  4IC3 A;  3D1B A;  2IDA A;  5LUU A;  5KH9 A;  4ZUX U;  5F2P A;  5L96 A;  5D1L B;  5AIU A;  5L8U A;  2K16 A;  2LXP C;  2XEU A;  2Y43 A;  4NYW A;  4AYC B;  3JVJ A;  3SUB A;  4TT6 A;  4QQ4 A;  2AN6 A;  3UVY A;  4NRC A;  1WFK A;  2KU3 A;  2I7K A;  5JG6 A;  2R0Y A;  4F3I A;  5AMF A;  3KNV A;  3U5P A;  2M13 A;  2YVR A;  4R7E A;  4Z1Q A;  4O7C A;  1WEQ A;  4IR5 A;  5FE9 A;  3N9O A;  5C13 A;  3M7K A;  3U5N A;  3HMF A;  1JSP B;  5FB0 A;  5EK9 A;  4A9H A;  2MA5 A;  2ECN A;  4I7C A;  4AKG A;  3DDT A;  5D7X A;  4BHW A;  5I83 A;  4N3W A;  4O75 A;  4HXL A;  5E0R A;  1WGM A;  3GG3 A;  1WEO A;  4W4U A;  5L99 A;  4YBT A;  5CPE A;  4QB3 A;  4NR7 A;  4A9F A;  4MR3 A;  4YY4 A;  3VKH A;  5FG6 A;  1N72 A;  5EU1 A;  2MUM A;  5CQ4 A;  2D82 A;  2RNW A;  4A9O A;  4LKA A;  4HXO A;  5B76 A;  1F68 A;  4NQM A;  3ZYU A;  5C89 A;  2RS9 B;  2L5E A;  4ZC9 A;  4YYG A;  4PTB A;  4O7F A;  5HM0 A;  2ECG A;  2YQL A;  5JI8 A;  4BW2 A;  2R10 A;  2EGM A;  3E2D A;  5EPS A;  4YAT A;  4QF2 A;  2YW5 A;  2L0B A;  5CU8 A;  5F60 A;  3M99 A;  1WUG A;  3ZNI A;  1HYI A;  5HQ5 A;  4NRB A;  5CS8 A;  4MEP A;  2L84 A;  5EGU A;  4PS5 A;  4TTE A;  3DQV R;  2LXH C;  4ZDT A;  3ZPV 1;  5FDZ A;  3DWD A;  4XY9 A;  2E6S A;  5EIC A;  4CA1 A;  4QSX A;  5E9I A;  4GNE A;  2LN0 A;  1T1H A;  1FBV A;  5A83 A;  2KE1 A;  4ZW1 A;  2VJF B;  3G0J A;  5ETB A;  5FFY A;  4NUC A;  3V43 A;  1JM7 B;  4UP0 A;  5G05 B;  3FKM X;  3UV4 A;  3DAI A;  4QY4 A;  2KFT A;  2P57 A;  2E6R A;  2HDP A;  2YUC A;  2DX8 A;  2E3K A;  2FD4 A;  3QZV A;  5K29 A;  3GL6 A;  4KCX A;  2MD7 B;  3ZTG A;  4J3I A;  4BW3 A;  3I3J A;  4N4H A;  4UIY A;  4Z0O A;  4QR5 A;  4PCE A;  5G0F A;  2F42 A;  3SVH A;  2K4D A;  4LYS A;  3C6W A;  4QSU A;  2FSA A;  1WIM A;  3QZS A;  4NRA A;  4QUT A;  5I7X A;  2M85 A;  3Q2E A;  4UYH A;  2MA6 A;  4A9I A;  4UYF A;  5C85 A;  4B7Y C;  4L7X A;  2F6N A;  4PCI A;  4QEV A;  5HFR A;  4N4G A;  5LJ2 A;  5EQ1 A;  3S91 A;  2OWA A;  4UIW A;  5E9K A;  4CFL A;  3N9L A;  4PKL A;  2NXB A;  2YT5 A;  5FH6 A;  3KQI A;  4QZS A;  5DKC A;  5KTW A;  3L11 A;  2XOZ A;  4V3L C;  3KV5 A;  4TZ8 A;  5A5P A;  3T6R A;  3U5J A;  3GV4 A;  5FER A;  4A4C A;  3ZVY A;  4I7B A;  5I3L A;  2R0S A;  5I80 A;  2RNX A;  2YEK A;  4QC1 A;  4MR5 A;  4XUB A;  4YK0 A;  2E61 A;  3ZPV E;  2YQD A;  4NUE A;  2D9E A;  3Q1D A;  5LKZ A;  4J0R A;  4PY6 A;  4TYL A;  2UZG A;  3PUR A;  3P1C A;  5F1L A;  5IGL A;  5II2 A;  5CQ8 A;  1EQF A;  5D3T A;  5LKX A;  2KYU A;  3O47 A;  5B78 A;  2M6M A;  1E4U A;  2KIZ A;  5ENI A;  5FFV A;  4A0C D;  4YH4 A;  5D3J A;  3FL2 A;  2G6Q A;  2KWK A;  5LVR A;  2JRJ A;  3O37 A;  5ACY A;  2MJV B;  4ALG A;  2LGL A;  4CUR A;  2DKW A;  4Z6I A;  2YHN A;  1WEN A;  5FE5 A;  2LDR A;  4FO9 A;  4YYD A;  4YYJ A;  4AUQ B;  5HEM A;  2YDW A;  5F62 A;  3K2J A;  4WHW A;  4YBS A;  2YSM A;  3MDB C;  5D3R A;  2ECJ A;  2RSD A;  4P5O B;  2G4A A;  1LDJ B;  2H0D B;  5SVX A;  3AQA A;  5D1K B;  3JUE A;  2KWN A;  3ERR A;  3JVK A;  3LVR E;  4OUF A;  2YYR A;  3UV5 A;  5DKH A;  4NR8 A;  3HCS A;  3UV2 A;  5KU3 A;  5EP7 A;  3U5M A;  1XWH A;  2ECI A;  3O33 A;  3LQJ A;  5TB6 A;  2MNY A;  3L1X A;  4O70 A;  1BOR A;  4LYI A;  5D3S A;  5AME A;  5HQ6 A;  4HXP A;  3PUQ A;  5EYA F;  2QIC A;  5I1Q A;  5CQ3 A;  3MB3 A;  3RCW A;  3KDE C;  5A82 A;  4NR5 A;  1X4I A;  4BJX A;  4FIP A;  5HRV A;  5DX4 A;  2RR4 A;  3UW9 A;  5F63 A;  4GB0 A;  3HCT A;  2EGP A;  4HXN A;  5H85 A;  5A5N A;  5D0C A;  2LRI C;  3LVQ E;  2CRR A;  4O71 A;  5ENF A;  3MHH A;  4A9J A;  1ZS5 A;  4HBY A;  5F61 A;  5IG6 A;  5KTX A;  3LJU X;  3MUK A;  4F52 B;  1WE9 A;  2LQ6 A;  3O7A A;  4UIZ A;  5HRW A;  4MEO A;  2CSV A;  4NR4 A;  1VFY A;  3N9N A;  4TT2 A;  4O62 A;  3FJU B;  2I8N A;  1MBM A;  1LDK C;  1Z60 A;  5F36 A;  2JMJ A;  2OSS A;  5C7N A;  5C8G A;  2KKY A;  4BW4 A;  2D8S A;  5LCW B;  4QEW A;  3P1E A;  2QIZ A;  3HTK C;  4IC2 A;  4CUQ A;  4MR6 A;  3LQH A;  5E3G A;  2YQM A;  5AIT A;  4N4I A;  3MB4 A;  5EPR A;  5CUD A;  2JM3 A;  4QYL A;  4TZ2 A;  5H1T A;  2VNF A;  4QSQ A;  5J0D A;  3EB5 A;  3M63 A;  5HCL A;  2LGV A;  5CZG A;  2L43 A;  2RFJ A;  4E96 A;  5CQA A;  3D1D A;  4CUS A;  4YBM A;  4LK9 A;  5G04 B;  3LJW A;  5FBX A;  5L8T A;  5EWW A;  2CKL A;  5EWD A;  3HCU A;  1U6G B;  5I29 A;  2F6J A;  5EA1 A;  1JM7 A;  3NXB A;  4XI1 A;  4Q6F A;  5CGP A;  4O64 A;  4R8P K;  5ENE A;  5EWV A;  2XB1 A;  3TLP A;  5I86 A;  3S92 A;  3FAN A;  2K17 A;  5FB1 A;  1WEV A;  4CL9 A;  4LR6 A;  4NR6 A;  4ZQL A;  4QF3 A;  1WES A;  3O36 A;  2KR4 A;  5G4S A;  3P1F A;  4WZ2 A;  4YYH A;  4QC3 A;  5EVA A;  3P1D A;  4GNF A;  5TRB A;  5FE1 A;  4OGI A;  4YYK A;  2LGK A;  5B75 A;  2RNY A;  1VYX A;  3DPL R;  3UVX A;  3SVG A;  4LZS A;  2KKX A;  5I40 A;  2VJE B;  2C2V S;  4CUU A;  3T7L A;  5E3D A;  5DY7 A;  2LSP B;  4C67 A;  4QSS A;  5FE8 A;  5FG4 A;  1X4U A;  2B0O E;  3ONI A;  1Z6U A;  5CRM A;  2CSZ A;  2Y1M A;  2VPG A;  4Z6H A;  4CUP A;  5DBM A;  5CUB A;  5FFW A;  2H60 A;  4YAD A;  4A9M A;  4AKH A;  2CRW A;  4Z93 A;  3FEH A;  3N9P A;  2MNZ A;  2M1R A;  3Q2F A;  3MQM A;  4CFK A;  5F3A A;  2BAY A;  5TDR A;  5K3Q A;  2DSM A;  4UIV A;  3VK6 A;  5C87 A;  4LZ2 A;  5D3H A;  4O77 A;  2JMI A;  5CUC A;  2PUY A;  5I88 A;  3I2D A;  3MUL A;  1X4J A;  4WHU A;  4XYA A;  5ENC A;  2EXU A;  3H7H A;  5TDW A;  4X2I A;  2CON A;  3FAO A;  3EB6 A;  2EJN A;  5LJ1 A;  4Z1S A;  2EA6 A;  3SVF A;  2Y1N A;  5EV9 A;  5TBN A;  5DFB A;  5DLX A;  3RTR B;  2L75 A;  2DVV A;  5F5Z A;  5TAB A;  4HBW A;  2KRE A;  5CP5 A;  2YUR A;  5C4Q A;  2YRE A;  2JMD A;  2ECV A;  4TKP B;  1PUO A;  3LQI A;  1Z2Q A;  5A7C A;  5D24 A;  2VP7 A;  2DVS A;  3P5O A;  5DYX A;  4NXJ A;  4HBX A;  4LRG A;  2RO1 A;  5DLZ A;  2L85 A;  2ECT A;  4KV1 A;  5L97 A;  4QBM A;  5DFC A;  5A5S A;  2LV9 A;  4HBV A;  1N87 A;  2MKE A;  3KV6 A;  5KO4 A;  5CUA A;  5CQ5 A;  4C9Z A;  4AYC A;  4TQN A;  2OXQ C;  5SVI B;  2G43 A;  4A9N A;  5KH7 A;  2LGG A;  4LDF A;  4TU4 A;  4C66 A;  3VKG A;  5IID A;  4MVT A;  5G4R A;  5I7Y A;  4UYG A;  4LYW A;  2GRC A;  4MEQ A;  4NN2 A;  5II1 A;  4UI9 B;  4QR3 A;  2MD8 C;  4J1P A;  5HRX A;  4AKI A;  4ALH A;  3RPG B;  5DFD A;  5D25 A;  3HMH A;  5C11 A;  1WIL A;  4IR6 A;  4QR4 A;  4IOR A;  5A81 A;  2DVR A;  5BT5 A;  4GPJ A;  1JOC A;  4NQN A;  1WEW A;  5ENG A;  3LDY A;  4YH3 A;  4HXK A;  4R2Y A;  4UYD A;  2JUN A;  2FUU A;  4TU6 A;  2XOC A;  4UP5 A;  4A4B A;  5HEN A;  5E9Y A;  4FLP A;  4BW1 A;  5EWC A;  2YU4 A;  4LZR A;  1MM3 A;  3ZYQ A;  5AD2 A;  5FE7 A;  2L80 A;  5DW1 A;  4MSX A;  4LAD B;  4N4F A;  4UIX A;  1FP0 A;  2FUI A;  2CSY A;  3IU5 A;  5IBN A;  4O7A A;  4YYI A;  5H1U A;  3LXJ A;  2D8U A;  3M62 A;  4A9K A;  3SHB A;  2KTB B;  2DWW A;  1RMD A;  4HXR A;  4UIU A;  4QSP A;  5E9M A;  4I7D A;  4IOQ A;  4LJN A;  5SVY A;  5CQT A;  4MEN A;  1V87 A;  3LRQ A;  1X0J A;  5JWM A;  4H9D A;  5LJ0 A;  3QZT A;  2OO1 A;  4IR4 A;  4OGC A;  5DKD A;  2DJA A;  2E7O A;  5HFQ A;  2KWO A;  1WEM A;  4YYN A;  2G45 A;  5A5Q A;  3N9Q A;  3D7C A;  2VJF A;  3IU6 A;  5E7D A;  4OGE A;  4NYX A;  4A9L A;  2WP1 A;  2YEM A;  2XP0 A;  5CUE A;  5E74 A;  2QJ0 A;  4YYM A;  4V3K C;  4WZ0 A;  4Q0O A;  2VJE A;  5HEL A;  2DVQ A;  5H1V A;  4O7B A;  5CQ7 A;  5E9L A;  4UYE A;  5D26 A;  3JVM A;  2MT5 A;  4S3O B;  1VD4 A;  3C5K A;  2DAT A;  4XUA A;  4AKN A;  5B8D A;  5LVQ A;  4O78 A;  4S3O C;  1HYJ A;  2LAU A;  1G25 A;  4KV4 A;  5DYA A;  2YEL A;  5CUG A;  4HXS A;  4IR3 A;  5CTL A;  5CRZ A;  5DW2 A;  5ENB A;  1WEP A;  2ZET C;  5DYC A;  5E73 A;  5F25 A;  2E7N A;  5CFW A;  2MIQ A;  2VPE A;  4QSR A;  4Q0N A;  2YHO A;  1ZKR A;  5D3L A;  4CLB A;  2VPD A;  5F1H A;  1CHC A;  2L7P A;  5HQ7 A;  4NYV A;  4NR9 A;  3UVW A;  5FH8 A;  5FE4 A;  1ZBD B;  3O35 A;  4FK5 A;  2KGG A;  3DWY A;  4QSV A;  5HJC A;  3G0L A;  5I89 A;  2CKL B;  4TT4 A;  5ENJ A;  4O74 A;  4GND A;  5BT4 A;  3L1Z B;  5DYU A;  2KGI A;  5CQ6 A;  2WP2 A;  4QUU A;  4RVR A;  2PNX A;  2IQJ A;  3O34 A;  2ECW A;  4HXM A;  4AI6 A;  1MM2 A;  2RI7 A;  3AAD A;  5FH7 A;  4X3G A;  5KHM A; 
#chains in the Genus database with same CATH homology
 4IOO A;  1DVP A;  5L98 A;  4YY6 A;  5KTU A;  5EI4 A;  5D3P A;  5IGN A;  1K2F A;  4YAB A;  4NS5 A;  4FJC A;  4AVX A;  3SOW A;  4A9E A;  4J0S A;  2C2L A;  5EWH A;  5FEY A;  5A5O A;  4QNS A;  2YW8 A;  5DKA A;  4YAX A;  2HYE D;  3SOX A;  5LKU A;  2R0V A;  4QSW A;  5COI A;  1JM4 B;  3MHS A;  4QYD A;  2H0D A;  2OUO A;  5A85 A;  4CUT A;  4UYF B;  5EIS A;  2K1J A;  3IHP A;  3SOU A;  5B77 A;  1F62 A;  2EOD A;  3NG2 A;  5FE3 A;  4TS8 A;  1WEE A;  5ENH A;  2I50 A;  3UVD A;  4PPE A;  2NAA A;  5H9M A;  2N9G A;  3U5O A;  4O7E A;  2M3H A;  4CCG X;  4LLB A;  4B86 C;  2YSJ A;  4WZ3 B;  5HLS A;  3HME A;  4BBQ A;  1IYM A;  5IGM A;  5J3X A;  3MXF A;  4WIV A;  4A49 A;  5D1M B;  5A5R A;  5D3N A;  5CY9 A;  5ETD A;  4OGJ A;  3U5K A;  1WEU A;  5B79 A;  4UIT A;  4WA6 A;  1WUM A;  5BT3 A;  2VPB A;  1E6I A;  4GNG A;  5IGK A;  4QEU A;  2KWJ A;  4NUD A;  3ZVZ B;  5FG5 A;  5FE2 A;  4O72 A;  2YYN A;  3O70 A;  3JVL A;  3RPG C;  4XY8 A;  3ASL A;  4YC9 A;  5KH3 A;  4LC2 A;  4Y03 A;  5EPB A;  4L58 A;  3PHD A;  5E9V A;  5AD3 A;  2L5U A;  2CT2 A;  5FE0 A;  4MR4 A;  5LKT A;  3N9M A;  5EM3 A;  4DON A;  4AP4 A;  5FE6 A;  3U5L A;  4QST A;  4O76 A;  5DIN A;  5TCM A;  4IC3 A;  2IDA A;  5LUU A;  5KH9 A;  4ZUX U;  5F2P A;  5L96 A;  5D1L B;  5AIU A;  5L8U A;  2K16 A;  2LXP C;  2XEU A;  2Y43 A;  4NYW A;  4AYC B;  3JVJ A;  4TT6 A;  2AN6 A;  3UVY A;  4NRC A;  1WFK A;  2KU3 A;  2I7K A;  5JG6 A;  2R0Y A;  4F3I A;  5AMF A;  3KNV A;  3U5P A;  4R7E A;  4Z1Q A;  4O7C A;  1WEQ A;  4IR5 A;  5FE9 A;  3N9O A;  5C13 A;  3U5N A;  3HMF A;  1JSP B;  5FB0 A;  5EK9 A;  4A9H A;  2MA5 A;  2ECN A;  4I7C A;  5D7X A;  4BHW A;  5I83 A;  4N3W A;  4O75 A;  4HXL A;  5E0R A;  1WGM A;  3GG3 A;  1WEO A;  4W4U A;  5L99 A;  4YBT A;  5CPE A;  4QB3 A;  4NR7 A;  4A9F A;  4MR3 A;  4YY4 A;  5FG6 A;  1N72 A;  5EU1 A;  2MUM A;  5CQ4 A;  2D82 A;  2RNW A;  4A9O A;  4LKA A;  4HXO A;  5B76 A;  1F68 A;  4NQM A;  3ZYU A;  5C89 A;  2RS9 B;  2L5E A;  4ZC9 A;  4YYG A;  4PTB A;  4O7F A;  5HM0 A;  2ECG A;  2YQL A;  5JI8 A;  4BW2 A;  2R10 A;  5EPS A;  4YAT A;  4QF2 A;  2YW5 A;  2L0B A;  5CU8 A;  5F60 A;  3M99 A;  1WUG A;  3ZNI A;  1HYI A;  5HQ5 A;  4NRB A;  5CS8 A;  4MEP A;  2L84 A;  5EGU A;  4PS5 A;  4TTE A;  3DQV R;  2LXH C;  4ZDT A;  3ZPV 1;  5FDZ A;  4XY9 A;  2E6S A;  5EIC A;  4CA1 A;  4QSX A;  5E9I A;  4GNE A;  2LN0 A;  1T1H A;  1FBV A;  5A83 A;  2KE1 A;  4ZW1 A;  2VJF B;  3G0J A;  5ETB A;  5FFY A;  4NUC A;  3V43 A;  1JM7 B;  4UP0 A;  5G05 B;  3FKM X;  3UV4 A;  3DAI A;  4QY4 A;  2KFT A;  2E6R A;  2HDP A;  2YUC A;  2DX8 A;  2E3K A;  3QZV A;  5K29 A;  3GL6 A;  4KCX A;  2MD7 B;  3ZTG A;  4J3I A;  4BW3 A;  3I3J A;  4N4H A;  4UIY A;  4QR5 A;  4PCE A;  5G0F A;  2F42 A;  3SVH A;  2K4D A;  4LYS A;  3C6W A;  4QSU A;  2FSA A;  1WIM A;  3QZS A;  4NRA A;  4QUT A;  5I7X A;  2M85 A;  3Q2E A;  4UYH A;  2MA6 A;  4A9I A;  4UYF A;  5C85 A;  4B7Y C;  4L7X A;  2F6N A;  4PCI A;  4QEV A;  5HFR A;  4N4G A;  5LJ2 A;  5EQ1 A;  3S91 A;  4UIW A;  5E9K A;  4CFL A;  3N9L A;  4PKL A;  2NXB A;  2YT5 A;  5FH6 A;  3KQI A;  4QZS A;  5DKC A;  5KTW A;  3L11 A;  4V3L C;  3KV5 A;  4TZ8 A;  5A5P A;  3T6R A;  3U5J A;  3GV4 A;  5FER A;  4A4C A;  3ZVY A;  4I7B A;  5I3L A;  2R0S A;  5I80 A;  2RNX A;  2YEK A;  4QC1 A;  4MR5 A;  4XUB A;  4YK0 A;  3ZPV E;  2YQD A;  4NUE A;  2D9E A;  5LKZ A;  4J0R A;  4PY6 A;  4TYL A;  2UZG A;  3PUR A;  3P1C A;  5F1L A;  5IGL A;  5II2 A;  5CQ8 A;  1EQF A;  5D3T A;  5LKX A;  2KYU A;  5B78 A;  2M6M A;  1E4U A;  2KIZ A;  5ENI A;  5FFV A;  4A0C D;  4YH4 A;  5D3J A;  3FL2 A;  2G6Q A;  2KWK A;  5LVR A;  2JRJ A;  3O37 A;  5ACY A;  2MJV B;  4ALG A;  2LGL A;  4CUR A;  2DKW A;  4Z6I A;  2YHN A;  1WEN A;  5FE5 A;  2LDR A;  4FO9 A;  4YYD A;  4YYJ A;  4AUQ B;  5HEM A;  2YDW A;  5F62 A;  3K2J A;  4WHW A;  4YBS A;  2YSM A;  5D3R A;  2ECJ A;  2RSD A;  4P5O B;  2G4A A;  1LDJ B;  2H0D B;  3AQA A;  5D1K B;  2KWN A;  3JVK A;  4OUF A;  2YYR A;  3UV5 A;  5DKH A;  4NR8 A;  3HCS A;  3UV2 A;  5KU3 A;  5EP7 A;  3U5M A;  1XWH A;  2ECI A;  3O33 A;  3LQJ A;  5TB6 A;  2MNY A;  3L1X A;  4O70 A;  1BOR A;  4LYI A;  5D3S A;  5AME A;  5HQ6 A;  4HXP A;  3PUQ A;  5EYA F;  2QIC A;  5I1Q A;  5CQ3 A;  3MB3 A;  3RCW A;  5A82 A;  4NR5 A;  1X4I A;  4BJX A;  4FIP A;  5HRV A;  5DX4 A;  3UW9 A;  5F63 A;  4GB0 A;  3HCT A;  2EGP A;  4HXN A;  5H85 A;  5A5N A;  5D0C A;  2LRI C;  3MHH A;  4O71 A;  5ENF A;  4A9J A;  1ZS5 A;  4HBY A;  5F61 A;  5IG6 A;  5KTX A;  4F52 B;  3MUK A;  1WE9 A;  2LQ6 A;  3O7A A;  4UIZ A;  5HRW A;  4MEO A;  4NR4 A;  1VFY A;  3N9N A;  4TT2 A;  2I8N A;  1LDK C;  1Z60 A;  5F36 A;  2JMJ A;  2OSS A;  5C7N A;  5C8G A;  4BW4 A;  2D8S A;  5LCW B;  4QEW A;  3P1E A;  2QIZ A;  3HTK C;  4IC2 A;  4CUQ A;  4MR6 A;  3LQH A;  5E3G A;  2YQM A;  5AIT A;  4N4I A;  3MB4 A;  5EPR A;  5CUD A;  2VNF A;  4QYL A;  4TZ2 A;  5H1T A;  3M63 A;  4QSQ A;  5J0D A;  3EB5 A;  5HCL A;  2LGV A;  5CZG A;  2L43 A;  2RFJ A;  4E96 A;  5CQA A;  4CUS A;  4YBM A;  4LK9 A;  5G04 B;  3LJW A;  5FBX A;  5L8T A;  5EWW A;  2CKL A;  5EWD A;  3HCU A;  1U6G B;  5I29 A;  2F6J A;  5EA1 A;  1JM7 A;  3NXB A;  4XI1 A;  4Q6F A;  5CGP A;  4O64 A;  4R8P K;  5ENE A;  5EWV A;  2XB1 A;  3TLP A;  5I86 A;  3S92 A;  2K17 A;  5FB1 A;  1WEV A;  4CL9 A;  4LR6 A;  4NR6 A;  4ZQL A;  4QF3 A;  1WES A;  3O36 A;  2KR4 A;  5G4S A;  3P1F A;  4WZ2 A;  4YYH A;  4QC3 A;  5EVA A;  3P1D A;  4GNF A;  5TRB A;  5FE1 A;  4OGI A;  4YYK A;  2LGK A;  5B75 A;  2RNY A;  1VYX A;  3DPL R;  3UVX A;  3SVG A;  4LZS A;  5I40 A;  2VJE B;  2C2V S;  4CUU A;  3T7L A;  5E3D A;  5DY7 A;  2LSP B;  4C67 A;  4QSS A;  5FE8 A;  5FG4 A;  1X4U A;  3ONI A;  1Z6U A;  5CRM A;  2CSZ A;  2Y1M A;  2VPG A;  4Z6H A;  4CUP A;  5DBM A;  5CUB A;  5FFW A;  2H60 A;  4YAD A;  4A9M A;  3N9P A;  4Z93 A;  2MNZ A;  2M1R A;  3Q2F A;  3MQM A;  4CFK A;  5F3A A;  2BAY A;  5TDR A;  4UIV A;  3VK6 A;  5C87 A;  4LZ2 A;  5D3H A;  4O77 A;  2JMI A;  5CUC A;  2PUY A;  5I88 A;  3I2D A;  3MUL A;  1X4J A;  4WHU A;  4XYA A;  5ENC A;  5TDW A;  4X2I A;  3EB6 A;  5LJ1 A;  4Z1S A;  2EA6 A;  3SVF A;  2Y1N A;  5EV9 A;  5TBN A;  5DFB A;  5DLX A;  3RTR B;  2L75 A;  2DVV A;  5F5Z A;  5TAB A;  4HBW A;  2KRE A;  5CP5 A;  2YUR A;  5C4Q A;  2YRE A;  2JMD A;  2ECV A;  4TKP B;  3LQI A;  1Z2Q A;  5A7C A;  5D24 A;  2VP7 A;  2DVS A;  3P5O A;  5DYX A;  4NXJ A;  4HBX A;  4LRG A;  2RO1 A;  5DLZ A;  2L85 A;  2ECT A;  4KV1 A;  5L97 A;  5DFC A;  4QBM A;  5A5S A;  2LV9 A;  4HBV A;  1N87 A;  3KV6 A;  5KO4 A;  5CUA A;  5CQ5 A;  4C9Z A;  4AYC A;  4TQN A;  2OXQ C;  2G43 A;  4A9N A;  5KH7 A;  2LGG A;  4LDF A;  4TU4 A;  4C66 A;  5IID A;  4MVT A;  5G4R A;  5I7Y A;  4UYG A;  4LYW A;  2GRC A;  4MEQ A;  4NN2 A;  5II1 A;  4UI9 B;  4QR3 A;  2MD8 C;  4J1P A;  5HRX A;  3RPG B;  4ALH A;  5DFD A;  5D25 A;  3HMH A;  5C11 A;  1WIL A;  4IR6 A;  4QR4 A;  4IOR A;  5A81 A;  2DVR A;  5BT5 A;  4GPJ A;  1JOC A;  4NQN A;  1WEW A;  5ENG A;  4YH3 A;  4HXK A;  4R2Y A;  4UYD A;  2FUU A;  4TU6 A;  4UP5 A;  4A4B A;  5HEN A;  5E9Y A;  4FLP A;  4BW1 A;  5EWC A;  2YU4 A;  4LZR A;  1MM3 A;  3ZYQ A;  5AD2 A;  5FE7 A;  2L80 A;  5DW1 A;  4MSX A;  4LAD B;  4N4F A;  4UIX A;  1FP0 A;  2FUI A;  2CSY A;  3IU5 A;  5IBN A;  4O7A A;  4YYI A;  5H1U A;  3LXJ A;  3M62 A;  4A9K A;  3SHB A;  2KTB B;  2DWW A;  1RMD A;  4HXR A;  4UIU A;  4QSP A;  5E9M A;  4I7D A;  4IOQ A;  4LJN A;  5CQT A;  4MEN A;  1V87 A;  3LRQ A;  1X0J A;  5JWM A;  5LJ0 A;  3QZT A;  2OO1 A;  4IR4 A;  5DKD A;  2KWO A;  2E7O A;  5HFQ A;  1WEM A;  4YYN A;  2G45 A;  5A5Q A;  3N9Q A;  3D7C A;  2VJF A;  3IU6 A;  5E7D A;  4NYX A;  4A9L A;  2WP1 A;  2YEM A;  5CUE A;  5E74 A;  2QJ0 A;  4YYM A;  4V3K C;  4WZ0 A;  4Q0O A;  2VJE A;  5HEL A;  2DVQ A;  5H1V A;  4O7B A;  5CQ7 A;  5E9L A;  4UYE A;  5D26 A;  3JVM A;  2MT5 A;  4S3O B;  1VD4 A;  3C5K A;  2DAT A;  4XUA A;  4AKN A;  5B8D A;  5LVQ A;  4O78 A;  4S3O C;  1HYJ A;  1G25 A;  4KV4 A;  5DYA A;  2YEL A;  5CUG A;  4HXS A;  4IR3 A;  5CTL A;  5CRZ A;  5DW2 A;  5ENB A;  1WEP A;  2ZET C;  5DYC A;  5E73 A;  5F25 A;  2E7N A;  5CFW A;  2MIQ A;  2VPE A;  4QSR A;  4Q0N A;  2YHO A;  5D3L A;  4CLB A;  2VPD A;  5F1H A;  1CHC A;  5HQ7 A;  4NYV A;  4NR9 A;  3UVW A;  5FH8 A;  5FE4 A;  1ZBD B;  3O35 A;  4FK5 A;  2KGG A;  3DWY A;  4QSV A;  5HJC A;  3G0L A;  5I89 A;  2CKL B;  4TT4 A;  5ENJ A;  4O74 A;  4GND A;  5BT4 A;  3L1Z B;  5DYU A;  2KGI A;  5CQ6 A;  2WP2 A;  4QUU A;  4RVR A;  2PNX A;  3O34 A;  2ECW A;  4HXM A;  1MM2 A;  2RI7 A;  3AAD A;  5FH7 A;  4X3G A;  5KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...