4YABA

Crystal structure of trim24 phd-bromodomain complexed with 1-methyl-5-(2-methyl-1 3-thiazol-4-yl)-2 3-dihydro-1h-indol-2-one (1)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
178
Chain Sequence
SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 178
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yabA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yabA01
3M63A 4UIYA 1WE9A 5EWVA 5D3RA 5I7YA 4O7FA 5FE7A 2YQMA 4QSQA 5L98A 4HXMA 5E7DA 1RMDA 5HCLA 3O7AA 3UV4A 4R8PK 4QUTA 1WUMA 4UYHA 2F42A 1E6IA 5EV9A 5C7NA 2QICA 4BJXA 5I83A 3QZSA 4HXSA 5A85A 2H60A 3MULA 4QEVA 2BAYA 2Y1MA 4O77A 4O7BA 5A5NA 5DYAA 4UYFB 4NRCA 3DAIA 5H1UA 3U5PA 4QBMA 5LKZA 3ZNIA 5I89A 2YUCA 5CUCA 2H0DB 5EA1A 1N72A 4ZUXU 4C9ZA 1FP0A 4HXLA 2VP7A 5FE0A 2OSSA 4HBXA 3S92A 4C66A 4TZ2A 3UV2A 3EB6A 5FE6A 2RNXA 3SOUA 4N4HA 4TS8A 5II1A 3KV5A 4QSPA 5L96A 5CRZA 4TYLA 3RCWA 5D0CA 4GNDA 4NR6A 5E9KA 1VYXA 4HBVA 5ENCA 5ENHA 1K2FA 4O7EA 5LJ2A 1N87A 5HRVA 2GRCA 2NAAA 5C87A 2VJFA 4A0CD 3M99A 3QZVA 5TCMA 4NUCA 4IORA 4A9FA 4I7CA 2E7NA 3TLPA 3HTKC 4B86C 3JVMA 4YAXA 2YREA 3NXBA 2D9EA 1BORA 4O74A 2N9GA 4YYKA 2LN0A 4QC3A 5JG6A 2XB1A 5DKDA 5ENBA 5FB0A 2YQLA 2WP1A 4ZDTA 3PURA 4WIVA 2ECJA 5EK9A 4O7CA 3PUQA 2YQDA 2LGLA 2MNYA 4HXOA 4AYCB 5A5RA 2R0VA 2YDWA 4A9KA 1WGMA 1WILA 4A9JA 5F36A 4QNSA 5HQ6A 4O7AA 2KGGA 5DW2A 4FLPA 1Z2QA 4W4UA 5C13A 4N3WA 4QSWA 5DKHA 5F2PA 3FKMX 5DYXA 5ENFA 3AQAA 4IOOA 4O78A 3IU6A 4QEWA 5CRMA 4UP5A 5LUUA 4L58A 3L1XA 3SVHA 4Z1QA 1DVPA 5LCWB 4TKPB 5LKTA 2KWOA 2VNFA 5L97A 5E9YA 5L8UA 2ECNA 4LR6A 3JVLA 4TU4A 4QF2A 5CY9A 1ZS5A 2RNYA 2M6MA 3O37A 5HFRA 2KR4A 4GPJA 5DINA 4WHUA 5AD2A 5B77A 4LYIA 3LRQA 4Q0OA 5FFWA 2YT5A 1VD4A 3O34A 2LDRA 5TDWA 2RFJA 1WEVA 1CHCA 4KCXA 5TBNA 5EI4A 5CU8A 4CLBA 4LLBA 5D24A 2RS9B 3N9PA 5B76A 3MQMA 5I88A 4HXNA 2CKLB 5EP7A 2KWNA 2ECTA 5L99A 5FG6A 4FJCA 4GB0A 3SOXA 4A49A 5C85A 4Q0NA 4NQMA 3HMEA 2ECGA 4GNGA 5I1QA 2DVQA 4CUQA 2K1JA 3AADA 5KU3A 3EB5A 3O35A 2EODA 4HXKA 5B8DA 5FH6A 2OUOA 4N4FA 5FE8A 1JM7B 3JVKA 2YEKA 2YSMA 5IG6A 4MEOA 4V3LC 5KH3A 1MM2A 5DYCA 4J0SA 1E4UA 4IR6A 1X4JA 3UVXA 5II2A 5FBXA 5C4QA 5CQ8A 5IIDA 3KQIA 4YATA 2MA5A 5CQAA 3UVYA 2YYRA 4FO9A 5ENIA 2L80A 5FE4A 1HYIA 4WZ2A 5TDRA 4TTEA 4MR3A 4ZC9A 3SVFA 4TZ8A 5DW1A 4CUTA 3VK6A 1IYMA 5DFBA 4NUEA 4J1PA 5E9IA 5HQ5A 4QF3A 4Z6HA 2ECIA 2VJEA 3N9QA 2OO1A 5FH8A 3RTRB 4IR4A 5E9VA 5ENGA 5HJCA 4MENA 3ZYUA 4Q6FA 5CUBA 5TABA 2R0SA 2QIZA 2CT2A 4IC3A 2F6JA 3DWYA 5BT3A 5CS8A 5BT4A 4R7EA 2UZGA 1XWHA 4X2IA 5G4SA 4QY4A 4PPEA 5COIA 5ENEA 5CP5A 4BW2A 4CUPA 2JMJA 2YHNA 2C2LA 4A9MA 2FSAA 4QEUA 4LZ2A 5IGMA 4YY6A 5CQTA 2ZETC 1G25A 3LQHA 4CCGX 5I40A 5A5QA 5LKUA 1U6GB 5F1HA 5EISA 2KFTA 3N9OA 4XUAA 3ONIA 2MT5A 5F5ZA 2DWWA 5I86A 5DFCA 5CTLA 5LVRA 3S91A 2KREA 5C8GA 2VPBA 4F52B 3O36A 2RI7A 1WEEA 5EYAF 4QSUA 4RVRA 3I2DA 5DX4A 3O33A 5DKCA 5CUAA 2L84A 2WP2A 3UVWA 2ECWA 2VPEA 4MSXA 5H9MA 3ZVZB 5CQ7A 4HBYA 4XY9A 4HBWA 3L11A 4BW3A 5CUEA 2Y43A 4YK0A 1WENA 5L8TA 4V3KC 5CQ5A 1WEMA 5JI8A 5ETDA 4NR9A 1WEWA 4KV1A 1FBVA 5E3DA 2MA6A 3T6RA 2E3KA 1WEQA 5FG5A 4QSVA 2YHOA 4Z93A 5KTWA 1WEOA 2LRIC 2CSYA 4GNEA 4NR5A 4Z1SA 5A83A 3RPGB 1EQFA 4A9LA 4YYHA 4AKNA 3U5JA 3SHBA 5AMFA 5FE5A 2L5UA 2VPGA 4QR3A 5J0DA 4Z6IA 4S3OB 5I80A 4BW4A 2HDPA 4QUUA 4LDFA 4MR5A 4TT6A 5LVQA 4O64A 4QSSA 4A4BA 5A5SA 2YW5A 1Z60A 5CGPA 2VJFB 3O70A 2KTBB 2YU4A 5AD3A 4YBTA 3P1DA 3RPGC 5FERA 4E96A 5KO4A 2JRJA 2NXBA 5LKXA 3MXFA 3M62A 4XY8A 4GNFA 5I29A 4MVTA 4YY4A 4LK9A 5F3AA 4YYMA 5TRBA 4S3OC 5EPSA 2D82A 3UV5A 4X3GA 5G05B 4QYLA 3G0JA 4O72A 2ECVA 3LJWA 5FE2A 5A5OA 3GV4A 5D3TA 5EWCA 4ALHA 2EA6A 2DATA 5D7XA 1WEUA 5ETBA 5CFWA 5D3SA 5FG4A 2G6QA 5FH7A 4A9IA 2YW8A 5E74A 3LQJA 4CL9A 4YYDA 4YYJA 4IR5A 2KWKA 5AITA 4O71A 5FE1A 3ZPVE 2CSZA 5AIUA 2MJVB 4UIUA 5KH7A 5FFVA 3JVJA 4QR5A 3C6WA 3N9LA 2YYNA 5DLZA 3FL2A 5KTUA 4A4CA 3L1ZB 4PCIA 4CFKA 3P1EA 3P1FA 5CQ4A 5E73A 4CURA 1LDKC 4UYFA 5E9LA 2G45A 5FDZA 3SVGA 4IR3A 3ZYQA 4J3IA 4OGJA 4YBSA 4CFLA 3LXJA 2M3HA 3HCUA 4IC2A 4A9OA 3ZPV1 4Y03A 1Z6UA 2H0DA 2LGGA 2MD7B 5HELA 4NR7A 2LXHC 4TQNA 4TT4A 4MR6A 5H1TA 5H85A 4LRGA 5E3GA 4YYGA 4YADA 4NRBA 5CQ6A 2HYED 2LGKA 4QZSA 4WHWA 5DLXA 3I3JA 2G43A 3ASLA 1HYJA 2K17A 4UYEA 5ACYA 5HM0A 3DQVR 4F3IA 5EQ1A 2L0BA 2MNZA 2DVRA 5HRXA 3HMFA 5KHMA 4UYGA 5EPBA 5C11A 4XI1A 2DX8A 4YABA 4QC1A 4UP0A 4A9EA 3T7LA 4LYWA 3P1CA 3U5NA 4PS5A 5KH9A 2LGVA 3G0LA 5IGLA 2DVSA 4NRAA 4UIZA 5F63A 4AUQB 4PKLA 2DVVA 5LJ1A 2M1RA 3NG2A 4I7DA 1JOCA 2MUMA 1T1HA 2KU3A 1X4IA 4NQNA 5EVAA 4QSXA 5JWMA 4UI9B 4O76A 3P5OA 5C89A 2VPDA 5D3JA 3IU5A 1WESA 2R0YA 4C67A 4AYCA 5EWWA 2E6RA 2L85A 5EWDA 4N4GA 5B78A 3Q2FA 4UIXA 1VFYA 3U5OA 5CQ3A 5IGNA 4I7BA 3SOWA 2Y1NA 5G04B 2LQ6A 4ZW1A 3U5LA 5D1LB 2I8NA 4WZ0A 3D7CA 4NR8A 4LJNA 4L7XA 4MEQA 4IOQA 3Q2EA 2L5EA 4P5OB 2VJEB 1WIMA 5K29A 1V87A 4NR4A 2PNXA 4WA6A 2FUIA 5J3XA 5EU1A 5F62A 3U5MA 3IHPA 4OUFA 5EGUA 2D8SA 2YEMA 5A5PA 4LC2A 4UIWA 5D3PA 3N9NA 1WUGA 5DBMA 4ZQLA 4MEPA 5A82A 4UYDA 3ZVYA 5I3LA 3QZTA 1X4UA 4YC9A 4LYSA 5FB1A 5EICA 4PTBA 4XYAA 2G4AA 4LZRA 4PY6A 4QYDA 2EGPA 5IGKA 3LQIA 4J0RA 2CKLA 2XEUA 4B7YC 5G4RA 2C2VS 4YYIA 4A9NA 2FUUA 3K2JA 4OGIA 5D25A 2LV9A 3HMHA 4FK5A 2I50A 2L75A 1ZBDB 4A9HA 4NYXA 5A81A 5HENA 5FEYA 3MB3A 2RSDA 3DPLR 2YSJA 1F62A 4QSRA 5F60A 3U5KA 5CUDA 3ZTGA 2YURA 4UIVA 4LADB 5F61A 5DYUA 2KE1A 4PCEA 3MHHA 1JM4B 5D1KB 1JM7A 5D3NA 5LJ0A 2MIQA 4QSTA 4MR4A 4YH4A 3HCSA 2E7OA 5AMEA 2LSPB 3UVDA 4WZ3B 3N9MA 2KIZA 2M85A 5D3HA 5A7CA 5F1LA 2E6SA 4CUSA 4FIPA 1JSPB 4NS5A 2K16A 5CPEA 2AN6A 4CA1A 5CUGA 5HLSA 5EM3A 4NXJA 1X0JA 2LXPC 5HQ7A 2OXQC 1LDJB 1F68A 4BBQA 4QR4A 3GG3A 4YH3A 5E9MA 5BT5A 3C5KA 4R2YA 5HFQA 4LZSA 5F25A 2F6NA 4UITA 5FE9A 2K4DA 4AP4A 5FFYA 5D26A 4AVXA 5FE3A 1WEPA 2MD8C 5B75A 5B79A 4HXPA 2JMDA 4DONA 4TU6A 4ALGA 4LKAA 5IBNA 2R10A 4NUDA 4XUBA 2IDAA 5EWHA 4NYVA 5DFDA 4YBMA 4NYWA 5H1VA 4BW1A 5KTXA 5HEMA 5TB6A 5ENJA 2KYUA 2KGIA 5D3LA 5DY7A 5CZGA 4BHWA 2KWJA 4N4IA 3GL6A 4O75A 1WFKA 5G0FA 4QB3A 2PUYA 2YELA 4HXRA 3V43A 2RO1A 4TT2A 5EPRA 3MUKA 2DKWA 2QJ0A 2L43A 4YYNA 1MM3A 3UW9A 5E0RA 3MB4A 5I7XA 4O70A 2I7KA 4CUUA 4KV4A 2JMIA 3MHSA 4NN2A 3HCTA 5D1MB 5HRWA 2RNWA 3KV6A 5DKAA 3PHDA 3KNVA
chains in the Genus database with same CATH superfamily
3M63A 4UIYA 1WE9A 5EWVA 5D3RA 5I7YA 4O7FA 5FE7A 2YQMA 4QSQA 5L98A 5SVXA 4HXMA 5E7DA 1RMDA 5HCLA 3O7AA 3UV4A 4R8PK 4QUTA 1WUMA 4UYHA 2F42A 1E6IA 5EV9A 5C7NA 2QICA 4BJXA 5I83A 3QZSA 4HXSA 4AKIA 5A85A 2H60A 3MULA 4QEVA 2BAYA 2Y1MA 4O77A 4O7BA 5A5NA 5DYAA 4UYFB 4NRCA 3DAIA 1ZKRA 5H1UA 3U5PA 4QBMA 5LKZA 3ZNIA 5I89A 2YUCA 5CUCA 2H0DB 2JUNA 5EA1A 1N72A 4ZUXU 4C9ZA 1FP0A 4HXLA 2VP7A 5FE0A 2OSSA 4HBXA 3S92A 4C66A 4TZ2A 3UV2A 3DWDA 3EB6A 5FE6A 2RNXA 3SOUA 4N4HA 4TS8A 5II1A 3KV5A 4QSPA 5L96A 5CRZA 4TYLA 3RCWA 5D0CA 4GNDA 4NR6A 5E9KA 1VYXA 4HBVA 5ENCA 5ENHA 1K2FA 4O7EA 5LJ2A 1N87A 5HRVA 2GRCA 2NAAA 5C87A 2VJFA 3T9KA 3M99A 4A0CD 3QZVA 5TCMA 4NUCA 4IORA 4A9FA 4I7CA 2E7NA 3TLPA 3HTKC 4B86C 3JVMA 4YAXA 2YREA 3NXBA 2D9EA 1BORA 4O74A 2N9GA 4YYKA 2LN0A 4QC3A 5JG6A 2XB1A 5DKDA 5ENBA 5FB0A 2YQLA 2WP1A 4ZDTA 3PURA 4WIVA 2ECJA 5EK9A 4O7CA 3PUQA 2YQDA 2LGLA 3MDBC 2MNYA 4HXOA 2P57A 4AYCB 5A5RA 2R0VA 2YDWA 4A9KA 1WGMA 1WILA 2OWAA 4A9JA 5F36A 4QNSA 5HQ6A 4O7AA 2KGGA 5DW2A 4FLPA 1Z2QA 4W4UA 5C13A 4N3WA 4QSWA 5DKHA 5F2PA 3FKMX 5DYXA 5ENFA 3AQAA 4IOOA 2XOZA 3SUBA 4O78A 3IU6A 2D8UA 4QEWA 5CRMA 4UP5A 5LUUA 4L58A 3L1XA 3SVHA 4Z1QA 1DVPA 5LCWB 4TKPB 5LKTA 2KWOA 2VNFA 3KDEC 3FM8C 5L97A 2MKEA 5E9YA 5L8UA 2ECNA 4LR6A 3JVLA 4TU4A 4QF2A 5CY9A 1ZS5A 2RNYA 2M6MA 3O37A 5HFRA 2KR4A 4GPJA 5DINA 4WHUA 5AD2A 5B77A 4LYIA 3LRQA 4Q0OA 3PLWA 5FFWA 3ERRA 2YT5A 1VD4A 3O34A 2CRRA 2LDRA 5TDWA 2RFJA 1WEVA 1CHCA 4KCXA 5TBNA 2FD4A 5EI4A 5CU8A 4CLBA 4LLBA 5D24A 2RS9B 3N9PA 5B76A 3MQMA 5I88A 4HXNA 2CKLB 5EP7A 2E61A 2ECTA 5L99A 5FG6A 2KWNA 4FJCA 4GB0A 4O62A 3SOXA 4A49A 5C85A 4Q0NA 4NQMA 3HMEA 2EGMA 2ECGA 4GNGA 3FEHA 5I1QA 2DVQA 4CUQA 2K1JA 3AADA 5KU3A 3EB5A 3O35A 2EODA 4HXKA 3DDTA 5B8DA 5FH6A 3D1DA 2OUOA 4N4FA 5FE8A 1JM7B 3JVKA 2YEKA 2YSMA 5IG6A 4MEOA 4V3LC 5KH3A 3JUEA 1MM2A 5DYCA 4J0SA 1E4UA 4IR6A 1X4JA 3UVXA 5II2A 5FBXA 5C4QA 5CQ8A 2L7PA 5IIDA 3KQIA 4YATA 2MA5A 5CQAA 3UVYA 2YYRA 4FO9A 4Z0RA 2DJAA 5ENIA 2L80A 5FE4A 1HYIA 4WZ2A 5TDRA 4TTEA 4MR3A 4ZC9A 3SVFA 4TZ8A 5DW1A 4CUTA 3VK6A 1IYMA 5DFBA 3M7KA 2EJNA 4NUEA 1PUOA 4J1PA 5E9IA 5HQ5A 4QF3A 4Z6HA 2ECIA 2VJEA 3N9QA 2OO1A 5FH8A 3RTRB 4IR4A 5E9VA 5ENGA 4AKGA 2DSMA 5HJCA 4MENA 3ZYUA 4Q6FA 5CUBA 5TABA 2R0SA 2QIZA 2CT2A 4IC3A 2F6JA 3DWYA 5BT3A 5CS8A 5BT4A 4R7EA 2UZGA 1XWHA 4X2IA 5G4SA 4QY4A 4PPEA 5COIA 5ENEA 5CP5A 4BW2A 4CUPA 2JMJA 2YHNA 2C2LA 4A9MA 2FSAA 4QEUA 4LZ2A 5IGMA 4YY6A 5CQTA 2KKYA 2ZETC 1G25A 3LQHA 4CCGX 5I40A 5A5QA 5LKUA 1U6GB 5F1HA 5EISA 2KFTA 3N9OA 4XUAA 3ONIA 2MT5A 5F5ZA 2DWWA 5I86A 5DFCA 5CTLA 5LVRA 3S91A 2KREA 5C8GA 2VPBA 4F52B 3O36A 2RI7A 1WEEA 5EYAF 4QSUA 4RVRA 3I2DA 5DX4A 3O33A 5K3QA 5DKCA 5CUAA 2L84A 2WP2A 3UVWA 2CONA 2ECWA 2VPEA 4MSXA 5H9MA 3ZVZB 5CQ7A 4HBYA 4XY9A 4HBWA 3FANA 3L11A 4BW3A 5CUEA 2Y43A 4YK0A 1WENA 5L8TA 4V3KC 5CQ5A 1WEMA 5JI8A 5ETDA 4AI6A 4NR9A 1WEWA 4KV1A 1FBVA 5E3DA 2MA6A 3T6RA 4Z0OA 2E3KA 1WEQA 5FG5A 4QSVA 2YHOA 4Z93A 5KTWA 1WEOA 2LRIC 2CSYA 4GNEA 4NR5A 4Z1SA 5A83A 3RPGB 1EQFA 4A9LA 4YYHA 4AKNA 3U5JA 3SHBA 5AMFA 5FE5A 2L5UA 2VPGA 2JM3A 4QR3A 5J0DA 4Z6IA 4S3OB 5I80A 4BW4A 2HDPA 4QUUA 4LDFA 4MR5A 4TT6A 5LVQA 4O64A 4QSSA 3VKHA 4A4BA 5A5SA 2YW5A 1Z60A 5CGPA 2VJFB 3O70A 2KTBB 2YU4A 5AD3A 4YBTA 3P1DA 3RPGC 5FERA 4E96A 5KO4A 2CRWA 2JRJA 2NXBA 5LKXA 3MXFA 3M62A 4XY8A 4GNFA 4OGEA 5I29A 2CSVA 4MVTA 4YY4A 4LK9A 3LVRE 5F3AA 4YYMA 5TRBA 4S3OC 5EPSA 2D82A 3UV5A 4X3GA 5G05B 4QYLA 3G0JA 4O72A 2ECVA 3LJWA 5FE2A 5SVIA 5A5OA 3GV4A 5D3TA 5EWCA 4ALHA 2EA6A 2DATA 5D7XA 1WEUA 5ETBA 5CFWA 5D3SA 5FG4A 2G6QA 5FH7A 4A9IA 2YW8A 5E74A 3LQJA 3FAOA 4CL9A 4YYDA 4YYJA 4IR5A 2KWKA 5AITA 4O71A 5FE1A 3ZPVE 2CSZA 5AIUA 2MJVB 4UIUA 5KH7A 5FFVA 3JVJA 4QR5A 3C6WA 3N9LA 2YYNA 5DLZA 3FL2A 5KTUA 4A4CA 3L1ZB 4PCIA 4CFKA 3P1EA 3P1FA 5CQ4A 3VKGA 5E73A 4CURA 1LDKC 4UYFA 5E9LA 2G45A 5FDZA 4OGCA 3SVGA 4IR3A 3ZYQA 4J3IA 4OGJA 4YBSA 4CFLA 3LXJA 2KKXA 2M3HA 3HCUA 4A9OA 4IC2A 3ZPV1 4Y03A 1Z6UA 2H0DA 2LGGA 2MD7B 5HELA 4NR7A 2LXHC 4TQNA 4TT4A 4MR6A 5H1TA 5H85A 4LRGA 5E3GA 4YYGA 4YADA 4NRBA 5CQ6A 2HYED 2LGKA 4QZSA 4WHWA 5DLXA 3I3JA 2G43A 3ASLA 1DCQA 1HYJA 2K17A 4UYEA 5ACYA 5HM0A 3DQVR 4F3IA 5EQ1A 2L0BA 2MNZA 2DVRA 5HRXA 3HMFA 5KHMA 2XP0A 4UYGA 5EPBA 5C11A 4XI1A 2M13A 2DX8A 4YABA 4QC1A 4UP0A 4A9EA 3T7LA 4LYWA 3P1CA 3U5NA 4PS5A 5KH9A 2LGVA 3G0LA 5IGLA 2IQJA 2DVSA 2XOCA 4NRAA 4UIZA 5F63A 4AUQB 4PKLA 2DVVA 5LJ1A 2M1RA 3NG2A 4I7DA 1JOCA 2B0OE 1T1HA 2KU3A 2MUMA 1X4IA 4H9DA 4NQNA 5EVAA 4QSXA 5JWMA 4UI9B 4O76A 3P5OA 5C89A 2VPDA 5D3JA 3IU5A 1WESA 2R0YA 4C67A 4AYCA 5EWWA 2E6RA 2L85A 5EWDA 4N4GA 5B78A 3Q2FA 4UIXA 1VFYA 3U5OA 5CQ3A 5IGNA 3H7HA 4I7BA 3SOWA 2Y1NA 5G04B 2LQ6A 4ZW1A 3U5LA 5D1LB 2I8NA 4WZ0A 3D7CA 4NR8A 4LJNA 4L7XA 4MEQA 4IOQA 3Q2EA 2L5EA 4P5OB 2VJEB 1WIMA 5K29A 1V87A 4NR4A 2PNXA 4WA6A 2FUIA 5J3XA 5EU1A 5F62A 3U5MA 3IHPA 4F1PA 4OUFA 2RR4A 5EGUA 2D8SA 2YEMA 5A5PA 4LC2A 4AKHA 4UIWA 5D3PA 3N9NA 1WUGA 5DBMA 4ZQLA 4MEPA 5A82A 4UYDA 3ZVYA 5I3LA 3QZTA 5SVYA 1X4UA 4YC9A 4LYSA 5FB1A 5EICA 4PTBA 4XYAA 2G4AA 4LZRA 4PY6A 4QYDA 2EGPA 5IGKA 3LQIA 4J0RA 2CKLA 2XEUA 4B7YC 5G4RA 2C2VS 4YYIA 4A9NA 2FUUA 3K2JA 4OGIA 5D25A 2XOYA 2LV9A 3HMHA 4FK5A 2I50A 2L75A 1ZBDB 4QQ4A 4A9HA 4NYXA 5A81A 5HENA 5FEYA 3MB3A 3FJUB 2RSDA 3DPLR 2YSJA 1F62A 4QSRA 5F60A 3U5KA 3LVQE 5CUDA 3ZTGA 2YURA 4UIVA 4LADB 5F61A 5DYUA 2KE1A 4PCEA 3MHHA 1JM4B 5D1KB 1JM7A 5D3NA 5LJ0A 2MIQA 3E2DA 4QSTA 4MR4A 4YH4A 2YVRA 2E7OA 3HCSA 5AMEA 2LSPB 3UVDA 4WZ3B 3N9MA 3O47A 2KIZA 2M85A 5D3HA 5A7CA 5F1LA 2E6SA 4CUSA 4FIPA 1JSPB 4NS5A 2K16A 5CPEA 2AN6A 3LJUX 3Q1DA 5CUGA 2FFWA 5HLSA 5EM3A 4CA1A 4NXJA 1X0JA 2LXPC 5HQ7A 2OXQC 1LDJB 1F68A 4BBQA 2EXUA 4QR4A 3GG3A 4YH3A 5E9MA 5BT5A 3C5KA 4R2YA 5HFQA 4LZSA 5F25A 2F6NA 4UITA 5FE9A 2K4DA 4AP4A 5FFYA 5D26A 4AVXA 5FE3A 1WEPA 2MD8C 5B75A 5B79A 4HXPA 2JMDA 4DONA 3D1BA 4TU6A 3LDYA 4ALGA 4LKAA 5IBNA 2R10A 4NUDA 4XUBA 2IDAA 5EWHA 2LAUA 4NYVA 5DFDA 4YBMA 4NYWA 5H1VA 4BW1A 5KTXA 1MBMA 5HEMA 5TB6A 5ENJA 2KYUA 2KGIA 5D3LA 5DY7A 5CZGA 4BHWA 2KWJA 4N4IA 3GL6A 4O75A 1WFKA 5G0FA 4QB3A 2PUYA 2YELA 4HXRA 3V43A 2RO1A 4TT2A 5EPRA 3MUKA 2DKWA 2QJ0A 2L43A 4YYNA 1MM3A 3UW9A 5E0RA 3MB4A 5I7XA 4O70A 2I7KA 4CUUA 4KV4A 2JMIA 3MHSA 4NN2A 5SVIB 3HCTA 5D1MB 5HRWA 2RNWA 3KV6A 5DKAA 3PHDA 3KNVA
chains in the Genus database with same CATH topology
3M63A 4UIYA 1WE9A 5EWVA 5D3RA 5I7YA 4O7FA 5FE7A 2YQMA 4QSQA 5L98A 4HXMA 5E7DA 1RMDA 5HCLA 3O7AA 3UV4A 4R8PK 4QUTA 1WUMA 4UYHA 2F42A 1E6IA 5EV9A 5C7NA 2QICA 4BJXA 5I83A 3QZSA 4HXSA 5A85A 2H60A 3MULA 4QEVA 2BAYA 2Y1MA 4O77A 4O7BA 5A5NA 5DYAA 4UYFB 4NRCA 3DAIA 5H1UA 3U5PA 4QBMA 5LKZA 3ZNIA 5I89A 2YUCA 5CUCA 2H0DB 5EA1A 1N72A 4ZUXU 4C9ZA 1FP0A 4HXLA 2VP7A 5FE0A 2OSSA 4HBXA 3S92A 4C66A 4TZ2A 3UV2A 3EB6A 5FE6A 2RNXA 3SOUA 4N4HA 4TS8A 5II1A 3KV5A 4QSPA 5L96A 5CRZA 4TYLA 3RCWA 5D0CA 4GNDA 4NR6A 5E9KA 1VYXA 4HBVA 5ENCA 5ENHA 1K2FA 4O7EA 5LJ2A 1N87A 5HRVA 2GRCA 2NAAA 5C87A 2VJFA 4A0CD 3M99A 3QZVA 5TCMA 4NUCA 4IORA 4A9FA 4I7CA 2E7NA 3TLPA 3HTKC 4B86C 3JVMA 4YAXA 2YREA 3NXBA 2D9EA 1BORA 4O74A 2N9GA 4YYKA 2LN0A 4QC3A 5JG6A 2XB1A 5DKDA 5ENBA 5FB0A 2YQLA 2WP1A 4ZDTA 3PURA 4WIVA 2ECJA 5EK9A 4O7CA 3PUQA 2YQDA 2LGLA 2MNYA 4HXOA 4AYCB 5A5RA 2R0VA 2YDWA 4A9KA 1WGMA 1WILA 4A9JA 5F36A 4QNSA 5HQ6A 4O7AA 2KGGA 5DW2A 4FLPA 1Z2QA 4W4UA 5C13A 4N3WA 4QSWA 5DKHA 5F2PA 3FKMX 5DYXA 5ENFA 3AQAA 4IOOA 4O78A 3IU6A 4QEWA 5CRMA 4UP5A 5LUUA 4L58A 3L1XA 3SVHA 4Z1QA 1DVPA 5LCWB 4TKPB 5LKTA 2KWOA 2VNFA 5L97A 5E9YA 5L8UA 2ECNA 4LR6A 3JVLA 4TU4A 4QF2A 5CY9A 1ZS5A 2RNYA 2M6MA 3O37A 5HFRA 2KR4A 4GPJA 5DINA 4WHUA 5AD2A 5B77A 4LYIA 3LRQA 4Q0OA 5FFWA 2YT5A 1VD4A 3O34A 2LDRA 5TDWA 2RFJA 1WEVA 1CHCA 4KCXA 5TBNA 5EI4A 5CU8A 4CLBA 4LLBA 5D24A 2RS9B 3N9PA 5B76A 3MQMA 5I88A 4HXNA 2CKLB 5EP7A 2KWNA 2ECTA 5L99A 5FG6A 4FJCA 4GB0A 3SOXA 4A49A 5C85A 4Q0NA 4NQMA 3HMEA 2ECGA 4GNGA 5I1QA 2DVQA 4CUQA 2K1JA 3AADA 5KU3A 3EB5A 3O35A 2EODA 4HXKA 5B8DA 5FH6A 2OUOA 4N4FA 5FE8A 1JM7B 3JVKA 2YEKA 2YSMA 5IG6A 4MEOA 4V3LC 5KH3A 1MM2A 5DYCA 4J0SA 1E4UA 4IR6A 1X4JA 3UVXA 5II2A 5FBXA 5C4QA 5CQ8A 5IIDA 3KQIA 4YATA 2MA5A 5CQAA 3UVYA 2YYRA 4FO9A 5ENIA 2L80A 5FE4A 1HYIA 4WZ2A 5TDRA 4TTEA 4MR3A 4ZC9A 3SVFA 4TZ8A 5DW1A 4CUTA 3VK6A 1IYMA 5DFBA 4NUEA 4J1PA 5E9IA 5HQ5A 4QF3A 4Z6HA 2ECIA 2VJEA 3N9QA 2OO1A 5FH8A 3RTRB 4IR4A 5E9VA 5ENGA 5HJCA 4MENA 3ZYUA 4Q6FA 5CUBA 5TABA 2R0SA 2QIZA 2CT2A 4IC3A 2F6JA 3DWYA 5BT3A 5CS8A 5BT4A 4R7EA 2UZGA 1XWHA 4X2IA 5G4SA 4QY4A 4PPEA 5COIA 5ENEA 5CP5A 4BW2A 4CUPA 2JMJA 2YHNA 2C2LA 4A9MA 2FSAA 4QEUA 4LZ2A 5IGMA 4YY6A 5CQTA 2ZETC 1G25A 3LQHA 4CCGX 5I40A 5A5QA 5LKUA 1U6GB 5F1HA 5EISA 2KFTA 3N9OA 4XUAA 3ONIA 2MT5A 5F5ZA 2DWWA 5I86A 5DFCA 5CTLA 5LVRA 3S91A 2KREA 5C8GA 2VPBA 4F52B 3O36A 2RI7A 1WEEA 5EYAF 4QSUA 4RVRA 3I2DA 5DX4A 3O33A 5DKCA 5CUAA 2L84A 2WP2A 3UVWA 2ECWA 2VPEA 4MSXA 5H9MA 3ZVZB 5CQ7A 4HBYA 4XY9A 4HBWA 3L11A 4BW3A 5CUEA 2Y43A 4YK0A 1WENA 5L8TA 4V3KC 5CQ5A 1WEMA 5JI8A 5ETDA 4NR9A 1WEWA 4KV1A 1FBVA 5E3DA 2MA6A 3T6RA 2E3KA 1WEQA 5FG5A 4QSVA 2YHOA 4Z93A 5KTWA 1WEOA 2LRIC 2CSYA 4GNEA 4NR5A 4Z1SA 5A83A 3RPGB 1EQFA 4A9LA 4YYHA 4AKNA 3U5JA 3SHBA 5AMFA 5FE5A 2L5UA 2VPGA 4QR3A 5J0DA 4Z6IA 4S3OB 5I80A 4BW4A 2HDPA 4QUUA 4LDFA 4MR5A 4TT6A 5LVQA 4O64A 4QSSA 4A4BA 5A5SA 2YW5A 1Z60A 5CGPA 2VJFB 3O70A 2KTBB 2YU4A 5AD3A 4YBTA 3P1DA 3RPGC 5FERA 4E96A 5KO4A 2JRJA 2NXBA 5LKXA 3MXFA 3M62A 4XY8A 4GNFA 5I29A 4MVTA 4YY4A 4LK9A 5F3AA 4YYMA 5TRBA 4S3OC 5EPSA 2D82A 3UV5A 4X3GA 5G05B 4QYLA 3G0JA 4O72A 2ECVA 3LJWA 5FE2A 5A5OA 3GV4A 5D3TA 5EWCA 4ALHA 2EA6A 2DATA 5D7XA 1WEUA 5ETBA 5CFWA 5D3SA 5FG4A 2G6QA 5FH7A 4A9IA 2YW8A 5E74A 3LQJA 4CL9A 4YYDA 4YYJA 4IR5A 2KWKA 5AITA 4O71A 5FE1A 3ZPVE 2CSZA 5AIUA 2MJVB 4UIUA 5KH7A 5FFVA 3JVJA 4QR5A 3C6WA 3N9LA 2YYNA 5DLZA 3FL2A 5KTUA 4A4CA 3L1ZB 4PCIA 4CFKA 3P1EA 3P1FA 5CQ4A 5E73A 4CURA 1LDKC 4UYFA 5E9LA 2G45A 5FDZA 3SVGA 4IR3A 3ZYQA 4J3IA 4OGJA 4YBSA 4CFLA 3LXJA 2M3HA 3HCUA 4IC2A 4A9OA 3ZPV1 4Y03A 1Z6UA 2H0DA 2LGGA 2MD7B 5HELA 4NR7A 2LXHC 4TQNA 4TT4A 4MR6A 5H1TA 5H85A 4LRGA 5E3GA 4YYGA 4YADA 4NRBA 5CQ6A 2HYED 2LGKA 4QZSA 4WHWA 5DLXA 3I3JA 2G43A 3ASLA 1HYJA 2K17A 4UYEA 5ACYA 5HM0A 3DQVR 4F3IA 5EQ1A 2L0BA 2MNZA 2DVRA 5HRXA 3HMFA 5KHMA 4UYGA 5EPBA 5C11A 4XI1A 2DX8A 4YABA 4QC1A 4UP0A 4A9EA 3T7LA 4LYWA 3P1CA 3U5NA 4PS5A 5KH9A 2LGVA 3G0LA 5IGLA 2DVSA 4NRAA 4UIZA 5F63A 4AUQB 4PKLA 2DVVA 5LJ1A 2M1RA 3NG2A 4I7DA 1JOCA 2MUMA 1T1HA 2KU3A 1X4IA 4NQNA 5EVAA 4QSXA 5JWMA 4UI9B 4O76A 3P5OA 5C89A 2VPDA 5D3JA 3IU5A 1WESA 2R0YA 4C67A 4AYCA 5EWWA 2E6RA 2L85A 5EWDA 4N4GA 5B78A 3Q2FA 4UIXA 1VFYA 3U5OA 5CQ3A 5IGNA 4I7BA 3SOWA 2Y1NA 5G04B 2LQ6A 4ZW1A 3U5LA 5D1LB 2I8NA 4WZ0A 3D7CA 4NR8A 4LJNA 4L7XA 4MEQA 4IOQA 3Q2EA 2L5EA 4P5OB 2VJEB 1WIMA 5K29A 1V87A 4NR4A 2PNXA 4WA6A 2FUIA 5J3XA 5EU1A 5F62A 3U5MA 3IHPA 4OUFA 5EGUA 2D8SA 2YEMA 5A5PA 4LC2A 4UIWA 5D3PA 3N9NA 1WUGA 5DBMA 4ZQLA 4MEPA 5A82A 4UYDA 3ZVYA 5I3LA 3QZTA 1X4UA 4YC9A 4LYSA 5FB1A 5EICA 4PTBA 4XYAA 2G4AA 4LZRA 4PY6A 4QYDA 2EGPA 5IGKA 3LQIA 4J0RA 2CKLA 2XEUA 4B7YC 5G4RA 2C2VS 4YYIA 4A9NA 2FUUA 3K2JA 4OGIA 5D25A 2LV9A 3HMHA 4FK5A 2I50A 2L75A 1ZBDB 4A9HA 4NYXA 5A81A 5HENA 5FEYA 3MB3A 2RSDA 3DPLR 2YSJA 1F62A 4QSRA 5F60A 3U5KA 5CUDA 3ZTGA 2YURA 4UIVA 4LADB 5F61A 5DYUA 2KE1A 4PCEA 3MHHA 1JM4B 5D1KB 1JM7A 5D3NA 5LJ0A 2MIQA 4QSTA 4MR4A 4YH4A 3HCSA 2E7OA 5AMEA 2LSPB 3UVDA 4WZ3B 3N9MA 2KIZA 2M85A 5D3HA 5A7CA 5F1LA 2E6SA 4CUSA 4FIPA 1JSPB 4NS5A 2K16A 5CPEA 2AN6A 4CA1A 5CUGA 5HLSA 5EM3A 4NXJA 1X0JA 2LXPC 5HQ7A 2OXQC 1LDJB 1F68A 4BBQA 4QR4A 3GG3A 4YH3A 5E9MA 5BT5A 3C5KA 4R2YA 5HFQA 4LZSA 5F25A 2F6NA 4UITA 5FE9A 2K4DA 4AP4A 5FFYA 5D26A 4AVXA 5FE3A 1WEPA 2MD8C 5B75A 5B79A 4HXPA 2JMDA 4DONA 4TU6A 4ALGA 4LKAA 5IBNA 2R10A 4NUDA 4XUBA 2IDAA 5EWHA 4NYVA 5DFDA 4YBMA 4NYWA 5H1VA 4BW1A 5KTXA 5HEMA 5TB6A 5ENJA 2KYUA 2KGIA 5D3LA 5DY7A 5CZGA 4BHWA 2KWJA 4N4IA 3GL6A 4O75A 1WFKA 5G0FA 4QB3A 2PUYA 2YELA 4HXRA 3V43A 2RO1A 4TT2A 5EPRA 3MUKA 2DKWA 2QJ0A 2L43A 4YYNA 1MM3A 3UW9A 5E0RA 3MB4A 5I7XA 4O70A 2I7KA 4CUUA 4KV4A 2JMIA 3MHSA 4NN2A 3HCTA 5D1MB 5HRWA 2RNWA 3KV6A 5DKAA 3PHDA 3KNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  4UIY A;  1WE9 A;  5EWV A;  5D3R A;  5I7Y A;  4O7F A;  5FE7 A;  2YQM A;  4QSQ A;  5L98 A;  4HXM A;  5E7D A;  1RMD A;  5HCL A;  3O7A A;  3UV4 A;  4R8P K;  4QUT A;  1WUM A;  4UYH A;  2F42 A;  1E6I A;  5EV9 A;  5C7N A;  2QIC A;  4BJX A;  5I83 A;  3QZS A;  4HXS A;  5A85 A;  2H60 A;  3MUL A;  4QEV A;  2BAY A;  2Y1M A;  4O77 A;  4O7B A;  5A5N A;  5DYA A;  4UYF B;  4NRC A;  3DAI A;  5H1U A;  3U5P A;  4QBM A;  5LKZ A;  3ZNI A;  5I89 A;  2YUC A;  5CUC A;  2H0D B;  5EA1 A;  1N72 A;  4ZUX U;  4C9Z A;  1FP0 A;  4HXL A;  2VP7 A;  5FE0 A;  2OSS A;  4HBX A;  3S92 A;  4C66 A;  4TZ2 A;  3UV2 A;  3EB6 A;  5FE6 A;  2RNX A;  3SOU A;  4N4H A;  4TS8 A;  5II1 A;  3KV5 A;  4QSP A;  5L96 A;  5CRZ A;  4TYL A;  3RCW A;  5D0C A;  4GND A;  4NR6 A;  5E9K A;  1VYX A;  4HBV A;  5ENC A;  5ENH A;  1K2F A;  4O7E A;  5LJ2 A;  1N87 A;  5HRV A;  2GRC A;  2NAA A;  5C87 A;  2VJF A;  4A0C D;  3M99 A;  3QZV A;  5TCM A;  4NUC A;  4IOR A;  4A9F A;  4I7C A;  2E7N A;  3TLP A;  3HTK C;  4B86 C;  3JVM A;  4YAX A;  2YRE A;  3NXB A;  2D9E A;  1BOR A;  4O74 A;  2N9G A;  4YYK A;  2LN0 A;  4QC3 A;  5JG6 A;  2XB1 A;  5DKD A;  5ENB A;  5FB0 A;  2YQL A;  2WP1 A;  4ZDT A;  3PUR A;  4WIV A;  2ECJ A;  5EK9 A;  4O7C A;  3PUQ A;  2YQD A;  2LGL A;  2MNY A;  4HXO A;  4AYC B;  5A5R A;  2R0V A;  2YDW A;  4A9K A;  1WGM A;  1WIL A;  4A9J A;  5F36 A;  4QNS A;  5HQ6 A;  4O7A A;  2KGG A;  5DW2 A;  4FLP A;  1Z2Q A;  4W4U A;  5C13 A;  4N3W A;  4QSW A;  5DKH A;  5F2P A;  3FKM X;  5DYX A;  5ENF A;  3AQA A;  4IOO A;  4O78 A;  3IU6 A;  4QEW A;  5CRM A;  4UP5 A;  5LUU A;  4L58 A;  3L1X A;  3SVH A;  4Z1Q A;  1DVP A;  5LCW B;  4TKP B;  5LKT A;  2KWO A;  2VNF A;  5L97 A;  5E9Y A;  5L8U A;  2ECN A;  4LR6 A;  3JVL A;  4TU4 A;  4QF2 A;  5CY9 A;  1ZS5 A;  2RNY A;  2M6M A;  3O37 A;  5HFR A;  2KR4 A;  4GPJ A;  5DIN A;  4WHU A;  5AD2 A;  5B77 A;  4LYI A;  3LRQ A;  4Q0O A;  5FFW A;  2YT5 A;  1VD4 A;  3O34 A;  2LDR A;  5TDW A;  2RFJ A;  1WEV A;  1CHC A;  4KCX A;  5TBN A;  5EI4 A;  5CU8 A;  4CLB A;  4LLB A;  5D24 A;  2RS9 B;  3N9P A;  5B76 A;  3MQM A;  5I88 A;  4HXN A;  2CKL B;  5EP7 A;  2KWN A;  2ECT A;  5L99 A;  5FG6 A;  4FJC A;  4GB0 A;  3SOX A;  4A49 A;  5C85 A;  4Q0N A;  4NQM A;  3HME A;  2ECG A;  4GNG A;  5I1Q A;  2DVQ A;  4CUQ A;  2K1J A;  3AAD A;  5KU3 A;  3EB5 A;  3O35 A;  2EOD A;  4HXK A;  5B8D A;  5FH6 A;  2OUO A;  4N4F A;  5FE8 A;  1JM7 B;  3JVK A;  2YEK A;  2YSM A;  5IG6 A;  4MEO A;  4V3L C;  5KH3 A;  1MM2 A;  5DYC A;  4J0S A;  1E4U A;  4IR6 A;  1X4J A;  3UVX A;  5II2 A;  5FBX A;  5C4Q A;  5CQ8 A;  5IID A;  3KQI A;  4YAT A;  2MA5 A;  5CQA A;  3UVY A;  2YYR A;  4FO9 A;  5ENI A;  2L80 A;  5FE4 A;  1HYI A;  4WZ2 A;  5TDR A;  4TTE A;  4MR3 A;  4ZC9 A;  3SVF A;  4TZ8 A;  5DW1 A;  4CUT A;  3VK6 A;  1IYM A;  5DFB A;  4NUE A;  4J1P A;  5E9I A;  5HQ5 A;  4QF3 A;  4Z6H A;  2ECI A;  2VJE A;  3N9Q A;  2OO1 A;  5FH8 A;  3RTR B;  4IR4 A;  5E9V A;  5ENG A;  5HJC A;  4MEN A;  3ZYU A;  4Q6F A;  5CUB A;  5TAB A;  2R0S A;  2QIZ A;  2CT2 A;  4IC3 A;  2F6J A;  3DWY A;  5BT3 A;  5CS8 A;  5BT4 A;  4R7E A;  2UZG A;  1XWH A;  4X2I A;  5G4S A;  4QY4 A;  4PPE A;  5COI A;  5ENE A;  5CP5 A;  4BW2 A;  4CUP A;  2JMJ A;  2YHN A;  2C2L A;  4A9M A;  2FSA A;  4QEU A;  4LZ2 A;  5IGM A;  4YY6 A;  5CQT A;  2ZET C;  1G25 A;  3LQH A;  4CCG X;  5I40 A;  5A5Q A;  5LKU A;  1U6G B;  5F1H A;  5EIS A;  2KFT A;  3N9O A;  4XUA A;  3ONI A;  2MT5 A;  5F5Z A;  2DWW A;  5I86 A;  5DFC A;  5CTL A;  5LVR A;  3S91 A;  2KRE A;  5C8G A;  2VPB A;  4F52 B;  3O36 A;  2RI7 A;  1WEE A;  5EYA F;  4QSU A;  4RVR A;  3I2D A;  5DX4 A;  3O33 A;  5DKC A;  5CUA A;  2L84 A;  2WP2 A;  3UVW A;  2ECW A;  2VPE A;  4MSX A;  5H9M A;  3ZVZ B;  5CQ7 A;  4HBY A;  4XY9 A;  4HBW A;  3L11 A;  4BW3 A;  5CUE A;  2Y43 A;  4YK0 A;  1WEN A;  5L8T A;  4V3K C;  5CQ5 A;  1WEM A;  5JI8 A;  5ETD A;  4NR9 A;  1WEW A;  4KV1 A;  1FBV A;  5E3D A;  2MA6 A;  3T6R A;  2E3K A;  1WEQ A;  5FG5 A;  4QSV A;  2YHO A;  4Z93 A;  5KTW A;  1WEO A;  2LRI C;  2CSY A;  4GNE A;  4NR5 A;  4Z1S A;  5A83 A;  3RPG B;  1EQF A;  4A9L A;  4YYH A;  4AKN A;  3U5J A;  3SHB A;  5AMF A;  5FE5 A;  2L5U A;  2VPG A;  4QR3 A;  5J0D A;  4Z6I A;  4S3O B;  5I80 A;  4BW4 A;  2HDP A;  4QUU A;  4LDF A;  4MR5 A;  4TT6 A;  5LVQ A;  4O64 A;  4QSS A;  4A4B A;  5A5S A;  2YW5 A;  1Z60 A;  5CGP A;  2VJF B;  3O70 A;  2KTB B;  2YU4 A;  5AD3 A;  4YBT A;  3P1D A;  3RPG C;  5FER A;  4E96 A;  5KO4 A;  2JRJ A;  2NXB A;  5LKX A;  3MXF A;  3M62 A;  4XY8 A;  4GNF A;  5I29 A;  4MVT A;  4YY4 A;  4LK9 A;  5F3A A;  4YYM A;  5TRB A;  4S3O C;  5EPS A;  2D82 A;  3UV5 A;  4X3G A;  5G05 B;  4QYL A;  3G0J A;  4O72 A;  2ECV A;  3LJW A;  5FE2 A;  5A5O A;  3GV4 A;  5D3T A;  5EWC A;  4ALH A;  2EA6 A;  2DAT A;  5D7X A;  1WEU A;  5ETB A;  5CFW A;  5D3S A;  5FG4 A;  2G6Q A;  5FH7 A;  4A9I A;  2YW8 A;  5E74 A;  3LQJ A;  4CL9 A;  4YYD A;  4YYJ A;  4IR5 A;  2KWK A;  5AIT A;  4O71 A;  5FE1 A;  3ZPV E;  2CSZ A;  5AIU A;  2MJV B;  4UIU A;  5KH7 A;  5FFV A;  3JVJ A;  4QR5 A;  3C6W A;  3N9L A;  2YYN A;  5DLZ A;  3FL2 A;  5KTU A;  4A4C A;  3L1Z B;  4PCI A;  4CFK A;  3P1E A;  3P1F A;  5CQ4 A;  5E73 A;  4CUR A;  1LDK C;  4UYF A;  5E9L A;  2G45 A;  5FDZ A;  3SVG A;  4IR3 A;  3ZYQ A;  4J3I A;  4OGJ A;  4YBS A;  4CFL A;  3LXJ A;  2M3H A;  3HCU A;  4IC2 A;  4A9O A;  3ZPV 1;  4Y03 A;  1Z6U A;  2H0D A;  2LGG A;  2MD7 B;  5HEL A;  4NR7 A;  2LXH C;  4TQN A;  4TT4 A;  4MR6 A;  5H1T A;  5H85 A;  4LRG A;  5E3G A;  4YYG A;  4YAD A;  4NRB A;  5CQ6 A;  2HYE D;  2LGK A;  4QZS A;  4WHW A;  5DLX A;  3I3J A;  2G43 A;  3ASL A;  1HYJ A;  2K17 A;  4UYE A;  5ACY A;  5HM0 A;  3DQV R;  4F3I A;  5EQ1 A;  2L0B A;  2MNZ A;  2DVR A;  5HRX A;  3HMF A;  5KHM A;  4UYG A;  5EPB A;  5C11 A;  4XI1 A;  2DX8 A;  4YAB A;  4QC1 A;  4UP0 A;  4A9E A;  3T7L A;  4LYW A;  3P1C A;  3U5N A;  4PS5 A;  5KH9 A;  2LGV A;  3G0L A;  5IGL A;  2DVS A;  4NRA A;  4UIZ A;  5F63 A;  4AUQ B;  4PKL A;  2DVV A;  5LJ1 A;  2M1R A;  3NG2 A;  4I7D A;  1JOC A;  2MUM A;  1T1H A;  2KU3 A;  1X4I A;  4NQN A;  5EVA A;  4QSX A;  5JWM A;  4UI9 B;  4O76 A;  3P5O A;  5C89 A;  2VPD A;  5D3J A;  3IU5 A;  1WES A;  2R0Y A;  4C67 A;  4AYC A;  5EWW A;  2E6R A;  2L85 A;  5EWD A;  4N4G A;  5B78 A;  3Q2F A;  4UIX A;  1VFY A;  3U5O A;  5CQ3 A;  5IGN A;  4I7B A;  3SOW A;  2Y1N A;  5G04 B;  2LQ6 A;  4ZW1 A;  3U5L A;  5D1L B;  2I8N A;  4WZ0 A;  3D7C A;  4NR8 A;  4LJN A;  4L7X A;  4MEQ A;  4IOQ A;  3Q2E A;  2L5E A;  4P5O B;  2VJE B;  1WIM A;  5K29 A;  1V87 A;  4NR4 A;  2PNX A;  4WA6 A;  2FUI A;  5J3X A;  5EU1 A;  5F62 A;  3U5M A;  3IHP A;  4OUF A;  5EGU A;  2D8S A;  2YEM A;  5A5P A;  4LC2 A;  4UIW A;  5D3P A;  3N9N A;  1WUG A;  5DBM A;  4ZQL A;  4MEP A;  5A82 A;  4UYD A;  3ZVY A;  5I3L A;  3QZT A;  1X4U A;  4YC9 A;  4LYS A;  5FB1 A;  5EIC A;  4PTB A;  4XYA A;  2G4A A;  4LZR A;  4PY6 A;  4QYD A;  2EGP A;  5IGK A;  3LQI A;  4J0R A;  2CKL A;  2XEU A;  4B7Y C;  5G4R A;  2C2V S;  4YYI A;  4A9N A;  2FUU A;  3K2J A;  4OGI A;  5D25 A;  2LV9 A;  3HMH A;  4FK5 A;  2I50 A;  2L75 A;  1ZBD B;  4A9H A;  4NYX A;  5A81 A;  5HEN A;  5FEY A;  3MB3 A;  2RSD A;  3DPL R;  2YSJ A;  1F62 A;  4QSR A;  5F60 A;  3U5K A;  5CUD A;  3ZTG A;  2YUR A;  4UIV A;  4LAD B;  5F61 A;  5DYU A;  2KE1 A;  4PCE A;  3MHH A;  1JM4 B;  5D1K B;  1JM7 A;  5D3N A;  5LJ0 A;  2MIQ A;  4QST A;  4MR4 A;  4YH4 A;  3HCS A;  2E7O A;  5AME A;  2LSP B;  3UVD A;  4WZ3 B;  3N9M A;  2KIZ A;  2M85 A;  5D3H A;  5A7C A;  5F1L A;  2E6S A;  4CUS A;  4FIP A;  1JSP B;  4NS5 A;  2K16 A;  5CPE A;  2AN6 A;  4CA1 A;  5CUG A;  5HLS A;  5EM3 A;  4NXJ A;  1X0J A;  2LXP C;  5HQ7 A;  2OXQ C;  1LDJ B;  1F68 A;  4BBQ A;  4QR4 A;  3GG3 A;  4YH3 A;  5E9M A;  5BT5 A;  3C5K A;  4R2Y A;  5HFQ A;  4LZS A;  5F25 A;  2F6N A;  4UIT A;  5FE9 A;  2K4D A;  4AP4 A;  5FFY A;  5D26 A;  4AVX A;  5FE3 A;  1WEP A;  2MD8 C;  5B75 A;  5B79 A;  4HXP A;  2JMD A;  4DON A;  4TU6 A;  4ALG A;  4LKA A;  5IBN A;  2R10 A;  4NUD A;  4XUB A;  2IDA A;  5EWH A;  4NYV A;  5DFD A;  4YBM A;  4NYW A;  5H1V A;  4BW1 A;  5KTX A;  5HEM A;  5TB6 A;  5ENJ A;  2KYU A;  2KGI A;  5D3L A;  5DY7 A;  5CZG A;  4BHW A;  2KWJ A;  4N4I A;  3GL6 A;  4O75 A;  1WFK A;  5G0F A;  4QB3 A;  2PUY A;  2YEL A;  4HXR A;  3V43 A;  2RO1 A;  4TT2 A;  5EPR A;  3MUK A;  2DKW A;  2QJ0 A;  2L43 A;  4YYN A;  1MM3 A;  3UW9 A;  5E0R A;  3MB4 A;  5I7X A;  4O70 A;  2I7K A;  4CUU A;  4KV4 A;  2JMI A;  3MHS A;  4NN2 A;  3HCT A;  5D1M B;  5HRW A;  2RNW A;  3KV6 A;  5DKA A;  3PHD A;  3KNV A; 
#chains in the Genus database with same CATH topology
 3M63 A;  4UIY A;  1WE9 A;  5EWV A;  5D3R A;  5I7Y A;  4O7F A;  5FE7 A;  2YQM A;  4QSQ A;  5L98 A;  5SVX A;  4HXM A;  5E7D A;  1RMD A;  5HCL A;  3O7A A;  3UV4 A;  4R8P K;  4QUT A;  1WUM A;  4UYH A;  2F42 A;  1E6I A;  5EV9 A;  5C7N A;  2QIC A;  4BJX A;  5I83 A;  3QZS A;  4HXS A;  4AKI A;  5A85 A;  2H60 A;  3MUL A;  4QEV A;  2BAY A;  2Y1M A;  4O77 A;  4O7B A;  5A5N A;  5DYA A;  4UYF B;  4NRC A;  3DAI A;  1ZKR A;  5H1U A;  3U5P A;  4QBM A;  5LKZ A;  3ZNI A;  5I89 A;  2YUC A;  5CUC A;  2H0D B;  2JUN A;  5EA1 A;  1N72 A;  4ZUX U;  4C9Z A;  1FP0 A;  4HXL A;  2VP7 A;  5FE0 A;  2OSS A;  4HBX A;  3S92 A;  4C66 A;  4TZ2 A;  3UV2 A;  3DWD A;  3EB6 A;  5FE6 A;  2RNX A;  3SOU A;  4N4H A;  4TS8 A;  5II1 A;  3KV5 A;  4QSP A;  5L96 A;  5CRZ A;  4TYL A;  3RCW A;  5D0C A;  4GND A;  4NR6 A;  5E9K A;  1VYX A;  4HBV A;  5ENC A;  5ENH A;  1K2F A;  4O7E A;  5LJ2 A;  1N87 A;  5HRV A;  2GRC A;  2NAA A;  5C87 A;  2VJF A;  3T9K A;  3M99 A;  4A0C D;  3QZV A;  5TCM A;  4NUC A;  4IOR A;  4A9F A;  4I7C A;  2E7N A;  3TLP A;  3HTK C;  4B86 C;  3JVM A;  4YAX A;  2YRE A;  3NXB A;  2D9E A;  1BOR A;  4O74 A;  2N9G A;  4YYK A;  2LN0 A;  4QC3 A;  5JG6 A;  2XB1 A;  5DKD A;  5ENB A;  5FB0 A;  2YQL A;  2WP1 A;  4ZDT A;  3PUR A;  4WIV A;  2ECJ A;  5EK9 A;  4O7C A;  3PUQ A;  2YQD A;  2LGL A;  3MDB C;  2MNY A;  4HXO A;  2P57 A;  4AYC B;  5A5R A;  2R0V A;  2YDW A;  4A9K A;  1WGM A;  1WIL A;  2OWA A;  4A9J A;  5F36 A;  4QNS A;  5HQ6 A;  4O7A A;  2KGG A;  5DW2 A;  4FLP A;  1Z2Q A;  4W4U A;  5C13 A;  4N3W A;  4QSW A;  5DKH A;  5F2P A;  3FKM X;  5DYX A;  5ENF A;  3AQA A;  4IOO A;  2XOZ A;  3SUB A;  4O78 A;  3IU6 A;  2D8U A;  4QEW A;  5CRM A;  4UP5 A;  5LUU A;  4L58 A;  3L1X A;  3SVH A;  4Z1Q A;  1DVP A;  5LCW B;  4TKP B;  5LKT A;  2KWO A;  2VNF A;  3KDE C;  3FM8 C;  5L97 A;  2MKE A;  5E9Y A;  5L8U A;  2ECN A;  4LR6 A;  3JVL A;  4TU4 A;  4QF2 A;  5CY9 A;  1ZS5 A;  2RNY A;  2M6M A;  3O37 A;  5HFR A;  2KR4 A;  4GPJ A;  5DIN A;  4WHU A;  5AD2 A;  5B77 A;  4LYI A;  3LRQ A;  4Q0O A;  3PLW A;  5FFW A;  3ERR A;  2YT5 A;  1VD4 A;  3O34 A;  2CRR A;  2LDR A;  5TDW A;  2RFJ A;  1WEV A;  1CHC A;  4KCX A;  5TBN A;  2FD4 A;  5EI4 A;  5CU8 A;  4CLB A;  4LLB A;  5D24 A;  2RS9 B;  3N9P A;  5B76 A;  3MQM A;  5I88 A;  4HXN A;  2CKL B;  5EP7 A;  2E61 A;  2ECT A;  5L99 A;  5FG6 A;  2KWN A;  4FJC A;  4GB0 A;  4O62 A;  3SOX A;  4A49 A;  5C85 A;  4Q0N A;  4NQM A;  3HME A;  2EGM A;  2ECG A;  4GNG A;  3FEH A;  5I1Q A;  2DVQ A;  4CUQ A;  2K1J A;  3AAD A;  5KU3 A;  3EB5 A;  3O35 A;  2EOD A;  4HXK A;  3DDT A;  5B8D A;  5FH6 A;  3D1D A;  2OUO A;  4N4F A;  5FE8 A;  1JM7 B;  3JVK A;  2YEK A;  2YSM A;  5IG6 A;  4MEO A;  4V3L C;  5KH3 A;  3JUE A;  1MM2 A;  5DYC A;  4J0S A;  1E4U A;  4IR6 A;  1X4J A;  3UVX A;  5II2 A;  5FBX A;  5C4Q A;  5CQ8 A;  2L7P A;  5IID A;  3KQI A;  4YAT A;  2MA5 A;  5CQA A;  3UVY A;  2YYR A;  4FO9 A;  4Z0R A;  2DJA A;  5ENI A;  2L80 A;  5FE4 A;  1HYI A;  4WZ2 A;  5TDR A;  4TTE A;  4MR3 A;  4ZC9 A;  3SVF A;  4TZ8 A;  5DW1 A;  4CUT A;  3VK6 A;  1IYM A;  5DFB A;  3M7K A;  2EJN A;  4NUE A;  1PUO A;  4J1P A;  5E9I A;  5HQ5 A;  4QF3 A;  4Z6H A;  2ECI A;  2VJE A;  3N9Q A;  2OO1 A;  5FH8 A;  3RTR B;  4IR4 A;  5E9V A;  5ENG A;  4AKG A;  2DSM A;  5HJC A;  4MEN A;  3ZYU A;  4Q6F A;  5CUB A;  5TAB A;  2R0S A;  2QIZ A;  2CT2 A;  4IC3 A;  2F6J A;  3DWY A;  5BT3 A;  5CS8 A;  5BT4 A;  4R7E A;  2UZG A;  1XWH A;  4X2I A;  5G4S A;  4QY4 A;  4PPE A;  5COI A;  5ENE A;  5CP5 A;  4BW2 A;  4CUP A;  2JMJ A;  2YHN A;  2C2L A;  4A9M A;  2FSA A;  4QEU A;  4LZ2 A;  5IGM A;  4YY6 A;  5CQT A;  2KKY A;  2ZET C;  1G25 A;  3LQH A;  4CCG X;  5I40 A;  5A5Q A;  5LKU A;  1U6G B;  5F1H A;  5EIS A;  2KFT A;  3N9O A;  4XUA A;  3ONI A;  2MT5 A;  5F5Z A;  2DWW A;  5I86 A;  5DFC A;  5CTL A;  5LVR A;  3S91 A;  2KRE A;  5C8G A;  2VPB A;  4F52 B;  3O36 A;  2RI7 A;  1WEE A;  5EYA F;  4QSU A;  4RVR A;  3I2D A;  5DX4 A;  3O33 A;  5K3Q A;  5DKC A;  5CUA A;  2L84 A;  2WP2 A;  3UVW A;  2CON A;  2ECW A;  2VPE A;  4MSX A;  5H9M A;  3ZVZ B;  5CQ7 A;  4HBY A;  4XY9 A;  4HBW A;  3FAN A;  3L11 A;  4BW3 A;  5CUE A;  2Y43 A;  4YK0 A;  1WEN A;  5L8T A;  4V3K C;  5CQ5 A;  1WEM A;  5JI8 A;  5ETD A;  4AI6 A;  4NR9 A;  1WEW A;  4KV1 A;  1FBV A;  5E3D A;  2MA6 A;  3T6R A;  4Z0O A;  2E3K A;  1WEQ A;  5FG5 A;  4QSV A;  2YHO A;  4Z93 A;  5KTW A;  1WEO A;  2LRI C;  2CSY A;  4GNE A;  4NR5 A;  4Z1S A;  5A83 A;  3RPG B;  1EQF A;  4A9L A;  4YYH A;  4AKN A;  3U5J A;  3SHB A;  5AMF A;  5FE5 A;  2L5U A;  2VPG A;  2JM3 A;  4QR3 A;  5J0D A;  4Z6I A;  4S3O B;  5I80 A;  4BW4 A;  2HDP A;  4QUU A;  4LDF A;  4MR5 A;  4TT6 A;  5LVQ A;  4O64 A;  4QSS A;  3VKH A;  4A4B A;  5A5S A;  2YW5 A;  1Z60 A;  5CGP A;  2VJF B;  3O70 A;  2KTB B;  2YU4 A;  5AD3 A;  4YBT A;  3P1D A;  3RPG C;  5FER A;  4E96 A;  5KO4 A;  2CRW A;  2JRJ A;  2NXB A;  5LKX A;  3MXF A;  3M62 A;  4XY8 A;  4GNF A;  4OGE A;  5I29 A;  2CSV A;  4MVT A;  4YY4 A;  4LK9 A;  3LVR E;  5F3A A;  4YYM A;  5TRB A;  4S3O C;  5EPS A;  2D82 A;  3UV5 A;  4X3G A;  5G05 B;  4QYL A;  3G0J A;  4O72 A;  2ECV A;  3LJW A;  5FE2 A;  5SVI A;  5A5O A;  3GV4 A;  5D3T A;  5EWC A;  4ALH A;  2EA6 A;  2DAT A;  5D7X A;  1WEU A;  5ETB A;  5CFW A;  5D3S A;  5FG4 A;  2G6Q A;  5FH7 A;  4A9I A;  2YW8 A;  5E74 A;  3LQJ A;  3FAO A;  4CL9 A;  4YYD A;  4YYJ A;  4IR5 A;  2KWK A;  5AIT A;  4O71 A;  5FE1 A;  3ZPV E;  2CSZ A;  5AIU A;  2MJV B;  4UIU A;  5KH7 A;  5FFV A;  3JVJ A;  4QR5 A;  3C6W A;  3N9L A;  2YYN A;  5DLZ A;  3FL2 A;  5KTU A;  4A4C A;  3L1Z B;  4PCI A;  4CFK A;  3P1E A;  3P1F A;  5CQ4 A;  3VKG A;  5E73 A;  4CUR A;  1LDK C;  4UYF A;  5E9L A;  2G45 A;  5FDZ A;  4OGC A;  3SVG A;  4IR3 A;  3ZYQ A;  4J3I A;  4OGJ A;  4YBS A;  4CFL A;  3LXJ A;  2KKX A;  2M3H A;  3HCU A;  4A9O A;  4IC2 A;  3ZPV 1;  4Y03 A;  1Z6U A;  2H0D A;  2LGG A;  2MD7 B;  5HEL A;  4NR7 A;  2LXH C;  4TQN A;  4TT4 A;  4MR6 A;  5H1T A;  5H85 A;  4LRG A;  5E3G A;  4YYG A;  4YAD A;  4NRB A;  5CQ6 A;  2HYE D;  2LGK A;  4QZS A;  4WHW A;  5DLX A;  3I3J A;  2G43 A;  3ASL A;  1DCQ A;  1HYJ A;  2K17 A;  4UYE A;  5ACY A;  5HM0 A;  3DQV R;  4F3I A;  5EQ1 A;  2L0B A;  2MNZ A;  2DVR A;  5HRX A;  3HMF A;  5KHM A;  2XP0 A;  4UYG A;  5EPB A;  5C11 A;  4XI1 A;  2M13 A;  2DX8 A;  4YAB A;  4QC1 A;  4UP0 A;  4A9E A;  3T7L A;  4LYW A;  3P1C A;  3U5N A;  4PS5 A;  5KH9 A;  2LGV A;  3G0L A;  5IGL A;  2IQJ A;  2DVS A;  2XOC A;  4NRA A;  4UIZ A;  5F63 A;  4AUQ B;  4PKL A;  2DVV A;  5LJ1 A;  2M1R A;  3NG2 A;  4I7D A;  1JOC A;  2B0O E;  1T1H A;  2KU3 A;  2MUM A;  1X4I A;  4H9D A;  4NQN A;  5EVA A;  4QSX A;  5JWM A;  4UI9 B;  4O76 A;  3P5O A;  5C89 A;  2VPD A;  5D3J A;  3IU5 A;  1WES A;  2R0Y A;  4C67 A;  4AYC A;  5EWW A;  2E6R A;  2L85 A;  5EWD A;  4N4G A;  5B78 A;  3Q2F A;  4UIX A;  1VFY A;  3U5O A;  5CQ3 A;  5IGN A;  3H7H A;  4I7B A;  3SOW A;  2Y1N A;  5G04 B;  2LQ6 A;  4ZW1 A;  3U5L A;  5D1L B;  2I8N A;  4WZ0 A;  3D7C A;  4NR8 A;  4LJN A;  4L7X A;  4MEQ A;  4IOQ A;  3Q2E A;  2L5E A;  4P5O B;  2VJE B;  1WIM A;  5K29 A;  1V87 A;  4NR4 A;  2PNX A;  4WA6 A;  2FUI A;  5J3X A;  5EU1 A;  5F62 A;  3U5M A;  3IHP A;  4F1P A;  4OUF A;  2RR4 A;  5EGU A;  2D8S A;  2YEM A;  5A5P A;  4LC2 A;  4AKH A;  4UIW A;  5D3P A;  3N9N A;  1WUG A;  5DBM A;  4ZQL A;  4MEP A;  5A82 A;  4UYD A;  3ZVY A;  5I3L A;  3QZT A;  5SVY A;  1X4U A;  4YC9 A;  4LYS A;  5FB1 A;  5EIC A;  4PTB A;  4XYA A;  2G4A A;  4LZR A;  4PY6 A;  4QYD A;  2EGP A;  5IGK A;  3LQI A;  4J0R A;  2CKL A;  2XEU A;  4B7Y C;  5G4R A;  2C2V S;  4YYI A;  4A9N A;  2FUU A;  3K2J A;  4OGI A;  5D25 A;  2XOY A;  2LV9 A;  3HMH A;  4FK5 A;  2I50 A;  2L75 A;  1ZBD B;  4QQ4 A;  4A9H A;  4NYX A;  5A81 A;  5HEN A;  5FEY A;  3MB3 A;  3FJU B;  2RSD A;  3DPL R;  2YSJ A;  1F62 A;  4QSR A;  5F60 A;  3U5K A;  3LVQ E;  5CUD A;  3ZTG A;  2YUR A;  4UIV A;  4LAD B;  5F61 A;  5DYU A;  2KE1 A;  4PCE A;  3MHH A;  1JM4 B;  5D1K B;  1JM7 A;  5D3N A;  5LJ0 A;  2MIQ A;  3E2D A;  4QST A;  4MR4 A;  4YH4 A;  2YVR A;  2E7O A;  3HCS A;  5AME A;  2LSP B;  3UVD A;  4WZ3 B;  3N9M A;  3O47 A;  2KIZ A;  2M85 A;  5D3H A;  5A7C A;  5F1L A;  2E6S A;  4CUS A;  4FIP A;  1JSP B;  4NS5 A;  2K16 A;  5CPE A;  2AN6 A;  3LJU X;  3Q1D A;  5CUG A;  2FFW A;  5HLS A;  5EM3 A;  4CA1 A;  4NXJ A;  1X0J A;  2LXP C;  5HQ7 A;  2OXQ C;  1LDJ B;  1F68 A;  4BBQ A;  2EXU A;  4QR4 A;  3GG3 A;  4YH3 A;  5E9M A;  5BT5 A;  3C5K A;  4R2Y A;  5HFQ A;  4LZS A;  5F25 A;  2F6N A;  4UIT A;  5FE9 A;  2K4D A;  4AP4 A;  5FFY A;  5D26 A;  4AVX A;  5FE3 A;  1WEP A;  2MD8 C;  5B75 A;  5B79 A;  4HXP A;  2JMD A;  4DON A;  3D1B A;  4TU6 A;  3LDY A;  4ALG A;  4LKA A;  5IBN A;  2R10 A;  4NUD A;  4XUB A;  2IDA A;  5EWH A;  2LAU A;  4NYV A;  5DFD A;  4YBM A;  4NYW A;  5H1V A;  4BW1 A;  5KTX A;  1MBM A;  5HEM A;  5TB6 A;  5ENJ A;  2KYU A;  2KGI A;  5D3L A;  5DY7 A;  5CZG A;  4BHW A;  2KWJ A;  4N4I A;  3GL6 A;  4O75 A;  1WFK A;  5G0F A;  4QB3 A;  2PUY A;  2YEL A;  4HXR A;  3V43 A;  2RO1 A;  4TT2 A;  5EPR A;  3MUK A;  2DKW A;  2QJ0 A;  2L43 A;  4YYN A;  1MM3 A;  3UW9 A;  5E0R A;  3MB4 A;  5I7X A;  4O70 A;  2I7K A;  4CUU A;  4KV4 A;  2JMI A;  3MHS A;  4NN2 A;  5SVI B;  3HCT A;  5D1M B;  5HRW A;  2RNW A;  3KV6 A;  5DKA A;  3PHD A;  3KNV A; 
#chains in the Genus database with same CATH homology
 3M63 A;  4UIY A;  1WE9 A;  5EWV A;  5D3R A;  5I7Y A;  4O7F A;  5FE7 A;  2YQM A;  4QSQ A;  5L98 A;  4HXM A;  5E7D A;  1RMD A;  5HCL A;  3O7A A;  3UV4 A;  4R8P K;  4QUT A;  1WUM A;  4UYH A;  2F42 A;  1E6I A;  5EV9 A;  5C7N A;  2QIC A;  4BJX A;  5I83 A;  3QZS A;  4HXS A;  5A85 A;  2H60 A;  3MUL A;  4QEV A;  2BAY A;  2Y1M A;  4O77 A;  4O7B A;  5A5N A;  5DYA A;  4UYF B;  4NRC A;  3DAI A;  5H1U A;  3U5P A;  4QBM A;  5LKZ A;  3ZNI A;  5I89 A;  2YUC A;  5CUC A;  2H0D B;  5EA1 A;  1N72 A;  4ZUX U;  4C9Z A;  1FP0 A;  4HXL A;  2VP7 A;  5FE0 A;  2OSS A;  4HBX A;  3S92 A;  4C66 A;  4TZ2 A;  3UV2 A;  3EB6 A;  5FE6 A;  2RNX A;  3SOU A;  4N4H A;  4TS8 A;  5II1 A;  3KV5 A;  4QSP A;  5L96 A;  5CRZ A;  4TYL A;  3RCW A;  5D0C A;  4GND A;  4NR6 A;  5E9K A;  1VYX A;  4HBV A;  5ENC A;  5ENH A;  1K2F A;  4O7E A;  5LJ2 A;  1N87 A;  5HRV A;  2GRC A;  2NAA A;  5C87 A;  2VJF A;  4A0C D;  3M99 A;  3QZV A;  5TCM A;  4NUC A;  4IOR A;  4A9F A;  4I7C A;  2E7N A;  3TLP A;  3HTK C;  4B86 C;  3JVM A;  4YAX A;  2YRE A;  3NXB A;  2D9E A;  1BOR A;  4O74 A;  2N9G A;  4YYK A;  2LN0 A;  4QC3 A;  5JG6 A;  2XB1 A;  5DKD A;  5ENB A;  5FB0 A;  2YQL A;  2WP1 A;  4ZDT A;  3PUR A;  4WIV A;  2ECJ A;  5EK9 A;  4O7C A;  3PUQ A;  2YQD A;  2LGL A;  2MNY A;  4HXO A;  4AYC B;  5A5R A;  2R0V A;  2YDW A;  4A9K A;  1WGM A;  1WIL A;  4A9J A;  5F36 A;  4QNS A;  5HQ6 A;  4O7A A;  2KGG A;  5DW2 A;  4FLP A;  1Z2Q A;  4W4U A;  5C13 A;  4N3W A;  4QSW A;  5DKH A;  5F2P A;  3FKM X;  5DYX A;  5ENF A;  3AQA A;  4IOO A;  4O78 A;  3IU6 A;  4QEW A;  5CRM A;  4UP5 A;  5LUU A;  4L58 A;  3L1X A;  3SVH A;  4Z1Q A;  1DVP A;  5LCW B;  4TKP B;  5LKT A;  2KWO A;  2VNF A;  5L97 A;  5E9Y A;  5L8U A;  2ECN A;  4LR6 A;  3JVL A;  4TU4 A;  4QF2 A;  5CY9 A;  1ZS5 A;  2RNY A;  2M6M A;  3O37 A;  5HFR A;  2KR4 A;  4GPJ A;  5DIN A;  4WHU A;  5AD2 A;  5B77 A;  4LYI A;  3LRQ A;  4Q0O A;  5FFW A;  2YT5 A;  1VD4 A;  3O34 A;  2LDR A;  5TDW A;  2RFJ A;  1WEV A;  1CHC A;  4KCX A;  5TBN A;  5EI4 A;  5CU8 A;  4CLB A;  4LLB A;  5D24 A;  2RS9 B;  3N9P A;  5B76 A;  3MQM A;  5I88 A;  4HXN A;  2CKL B;  5EP7 A;  2KWN A;  2ECT A;  5L99 A;  5FG6 A;  4FJC A;  4GB0 A;  3SOX A;  4A49 A;  5C85 A;  4Q0N A;  4NQM A;  3HME A;  2ECG A;  4GNG A;  5I1Q A;  2DVQ A;  4CUQ A;  2K1J A;  3AAD A;  5KU3 A;  3EB5 A;  3O35 A;  2EOD A;  4HXK A;  5B8D A;  5FH6 A;  2OUO A;  4N4F A;  5FE8 A;  1JM7 B;  3JVK A;  2YEK A;  2YSM A;  5IG6 A;  4MEO A;  4V3L C;  5KH3 A;  1MM2 A;  5DYC A;  4J0S A;  1E4U A;  4IR6 A;  1X4J A;  3UVX A;  5II2 A;  5FBX A;  5C4Q A;  5CQ8 A;  5IID A;  3KQI A;  4YAT A;  2MA5 A;  5CQA A;  3UVY A;  2YYR A;  4FO9 A;  5ENI A;  2L80 A;  5FE4 A;  1HYI A;  4WZ2 A;  5TDR A;  4TTE A;  4MR3 A;  4ZC9 A;  3SVF A;  4TZ8 A;  5DW1 A;  4CUT A;  3VK6 A;  1IYM A;  5DFB A;  4NUE A;  4J1P A;  5E9I A;  5HQ5 A;  4QF3 A;  4Z6H A;  2ECI A;  2VJE A;  3N9Q A;  2OO1 A;  5FH8 A;  3RTR B;  4IR4 A;  5E9V A;  5ENG A;  5HJC A;  4MEN A;  3ZYU A;  4Q6F A;  5CUB A;  5TAB A;  2R0S A;  2QIZ A;  2CT2 A;  4IC3 A;  2F6J A;  3DWY A;  5BT3 A;  5CS8 A;  5BT4 A;  4R7E A;  2UZG A;  1XWH A;  4X2I A;  5G4S A;  4QY4 A;  4PPE A;  5COI A;  5ENE A;  5CP5 A;  4BW2 A;  4CUP A;  2JMJ A;  2YHN A;  2C2L A;  4A9M A;  2FSA A;  4QEU A;  4LZ2 A;  5IGM A;  4YY6 A;  5CQT A;  2ZET C;  1G25 A;  3LQH A;  4CCG X;  5I40 A;  5A5Q A;  5LKU A;  1U6G B;  5F1H A;  5EIS A;  2KFT A;  3N9O A;  4XUA A;  3ONI A;  2MT5 A;  5F5Z A;  2DWW A;  5I86 A;  5DFC A;  5CTL A;  5LVR A;  3S91 A;  2KRE A;  5C8G A;  2VPB A;  4F52 B;  3O36 A;  2RI7 A;  1WEE A;  5EYA F;  4QSU A;  4RVR A;  3I2D A;  5DX4 A;  3O33 A;  5DKC A;  5CUA A;  2L84 A;  2WP2 A;  3UVW A;  2ECW A;  2VPE A;  4MSX A;  5H9M A;  3ZVZ B;  5CQ7 A;  4HBY A;  4XY9 A;  4HBW A;  3L11 A;  4BW3 A;  5CUE A;  2Y43 A;  4YK0 A;  1WEN A;  5L8T A;  4V3K C;  5CQ5 A;  1WEM A;  5JI8 A;  5ETD A;  4NR9 A;  1WEW A;  4KV1 A;  1FBV A;  5E3D A;  2MA6 A;  3T6R A;  2E3K A;  1WEQ A;  5FG5 A;  4QSV A;  2YHO A;  4Z93 A;  5KTW A;  1WEO A;  2LRI C;  2CSY A;  4GNE A;  4NR5 A;  4Z1S A;  5A83 A;  3RPG B;  1EQF A;  4A9L A;  4YYH A;  4AKN A;  3U5J A;  3SHB A;  5AMF A;  5FE5 A;  2L5U A;  2VPG A;  4QR3 A;  5J0D A;  4Z6I A;  4S3O B;  5I80 A;  4BW4 A;  2HDP A;  4QUU A;  4LDF A;  4MR5 A;  4TT6 A;  5LVQ A;  4O64 A;  4QSS A;  4A4B A;  5A5S A;  2YW5 A;  1Z60 A;  5CGP A;  2VJF B;  3O70 A;  2KTB B;  2YU4 A;  5AD3 A;  4YBT A;  3P1D A;  3RPG C;  5FER A;  4E96 A;  5KO4 A;  2JRJ A;  2NXB A;  5LKX A;  3MXF A;  3M62 A;  4XY8 A;  4GNF A;  5I29 A;  4MVT A;  4YY4 A;  4LK9 A;  5F3A A;  4YYM A;  5TRB A;  4S3O C;  5EPS A;  2D82 A;  3UV5 A;  4X3G A;  5G05 B;  4QYL A;  3G0J A;  4O72 A;  2ECV A;  3LJW A;  5FE2 A;  5A5O A;  3GV4 A;  5D3T A;  5EWC A;  4ALH A;  2EA6 A;  2DAT A;  5D7X A;  1WEU A;  5ETB A;  5CFW A;  5D3S A;  5FG4 A;  2G6Q A;  5FH7 A;  4A9I A;  2YW8 A;  5E74 A;  3LQJ A;  4CL9 A;  4YYD A;  4YYJ A;  4IR5 A;  2KWK A;  5AIT A;  4O71 A;  5FE1 A;  3ZPV E;  2CSZ A;  5AIU A;  2MJV B;  4UIU A;  5KH7 A;  5FFV A;  3JVJ A;  4QR5 A;  3C6W A;  3N9L A;  2YYN A;  5DLZ A;  3FL2 A;  5KTU A;  4A4C A;  3L1Z B;  4PCI A;  4CFK A;  3P1E A;  3P1F A;  5CQ4 A;  5E73 A;  4CUR A;  1LDK C;  4UYF A;  5E9L A;  2G45 A;  5FDZ A;  3SVG A;  4IR3 A;  3ZYQ A;  4J3I A;  4OGJ A;  4YBS A;  4CFL A;  3LXJ A;  2M3H A;  3HCU A;  4IC2 A;  4A9O A;  3ZPV 1;  4Y03 A;  1Z6U A;  2H0D A;  2LGG A;  2MD7 B;  5HEL A;  4NR7 A;  2LXH C;  4TQN A;  4TT4 A;  4MR6 A;  5H1T A;  5H85 A;  4LRG A;  5E3G A;  4YYG A;  4YAD A;  4NRB A;  5CQ6 A;  2HYE D;  2LGK A;  4QZS A;  4WHW A;  5DLX A;  3I3J A;  2G43 A;  3ASL A;  1HYJ A;  2K17 A;  4UYE A;  5ACY A;  5HM0 A;  3DQV R;  4F3I A;  5EQ1 A;  2L0B A;  2MNZ A;  2DVR A;  5HRX A;  3HMF A;  5KHM A;  4UYG A;  5EPB A;  5C11 A;  4XI1 A;  2DX8 A;  4YAB A;  4QC1 A;  4UP0 A;  4A9E A;  3T7L A;  4LYW A;  3P1C A;  3U5N A;  4PS5 A;  5KH9 A;  2LGV A;  3G0L A;  5IGL A;  2DVS A;  4NRA A;  4UIZ A;  5F63 A;  4AUQ B;  4PKL A;  2DVV A;  5LJ1 A;  2M1R A;  3NG2 A;  4I7D A;  1JOC A;  2MUM A;  1T1H A;  2KU3 A;  1X4I A;  4NQN A;  5EVA A;  4QSX A;  5JWM A;  4UI9 B;  4O76 A;  3P5O A;  5C89 A;  2VPD A;  5D3J A;  3IU5 A;  1WES A;  2R0Y A;  4C67 A;  4AYC A;  5EWW A;  2E6R A;  2L85 A;  5EWD A;  4N4G A;  5B78 A;  3Q2F A;  4UIX A;  1VFY A;  3U5O A;  5CQ3 A;  5IGN A;  4I7B A;  3SOW A;  2Y1N A;  5G04 B;  2LQ6 A;  4ZW1 A;  3U5L A;  5D1L B;  2I8N A;  4WZ0 A;  3D7C A;  4NR8 A;  4LJN A;  4L7X A;  4MEQ A;  4IOQ A;  3Q2E A;  2L5E A;  4P5O B;  2VJE B;  1WIM A;  5K29 A;  1V87 A;  4NR4 A;  2PNX A;  4WA6 A;  2FUI A;  5J3X A;  5EU1 A;  5F62 A;  3U5M A;  3IHP A;  4OUF A;  5EGU A;  2D8S A;  2YEM A;  5A5P A;  4LC2 A;  4UIW A;  5D3P A;  3N9N A;  1WUG A;  5DBM A;  4ZQL A;  4MEP A;  5A82 A;  4UYD A;  3ZVY A;  5I3L A;  3QZT A;  1X4U A;  4YC9 A;  4LYS A;  5FB1 A;  5EIC A;  4PTB A;  4XYA A;  2G4A A;  4LZR A;  4PY6 A;  4QYD A;  2EGP A;  5IGK A;  3LQI A;  4J0R A;  2CKL A;  2XEU A;  4B7Y C;  5G4R A;  2C2V S;  4YYI A;  4A9N A;  2FUU A;  3K2J A;  4OGI A;  5D25 A;  2LV9 A;  3HMH A;  4FK5 A;  2I50 A;  2L75 A;  1ZBD B;  4A9H A;  4NYX A;  5A81 A;  5HEN A;  5FEY A;  3MB3 A;  2RSD A;  3DPL R;  2YSJ A;  1F62 A;  4QSR A;  5F60 A;  3U5K A;  5CUD A;  3ZTG A;  2YUR A;  4UIV A;  4LAD B;  5F61 A;  5DYU A;  2KE1 A;  4PCE A;  3MHH A;  1JM4 B;  5D1K B;  1JM7 A;  5D3N A;  5LJ0 A;  2MIQ A;  4QST A;  4MR4 A;  4YH4 A;  3HCS A;  2E7O A;  5AME A;  2LSP B;  3UVD A;  4WZ3 B;  3N9M A;  2KIZ A;  2M85 A;  5D3H A;  5A7C A;  5F1L A;  2E6S A;  4CUS A;  4FIP A;  1JSP B;  4NS5 A;  2K16 A;  5CPE A;  2AN6 A;  4CA1 A;  5CUG A;  5HLS A;  5EM3 A;  4NXJ A;  1X0J A;  2LXP C;  5HQ7 A;  2OXQ C;  1LDJ B;  1F68 A;  4BBQ A;  4QR4 A;  3GG3 A;  4YH3 A;  5E9M A;  5BT5 A;  3C5K A;  4R2Y A;  5HFQ A;  4LZS A;  5F25 A;  2F6N A;  4UIT A;  5FE9 A;  2K4D A;  4AP4 A;  5FFY A;  5D26 A;  4AVX A;  5FE3 A;  1WEP A;  2MD8 C;  5B75 A;  5B79 A;  4HXP A;  2JMD A;  4DON A;  4TU6 A;  4ALG A;  4LKA A;  5IBN A;  2R10 A;  4NUD A;  4XUB A;  2IDA A;  5EWH A;  4NYV A;  5DFD A;  4YBM A;  4NYW A;  5H1V A;  4BW1 A;  5KTX A;  5HEM A;  5TB6 A;  5ENJ A;  2KYU A;  2KGI A;  5D3L A;  5DY7 A;  5CZG A;  4BHW A;  2KWJ A;  4N4I A;  3GL6 A;  4O75 A;  1WFK A;  5G0F A;  4QB3 A;  2PUY A;  2YEL A;  4HXR A;  3V43 A;  2RO1 A;  4TT2 A;  5EPR A;  3MUK A;  2DKW A;  2QJ0 A;  2L43 A;  4YYN A;  1MM3 A;  3UW9 A;  5E0R A;  3MB4 A;  5I7X A;  4O70 A;  2I7K A;  4CUU A;  4KV4 A;  2JMI A;  3MHS A;  4NN2 A;  3HCT A;  5D1M B;  5HRW A;  2RNW A;  3KV6 A;  5DKA A;  3PHD A;  3KNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...