4YABA

Crystal structure of trim24 phd-bromodomain complexed with 1-methyl-5-(2-methyl-1 3-thiazol-4-yl)-2 3-dihydro-1h-indol-2-one (1)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
178
Chain Sequence
SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 54
structure length 178
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yabA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yabA01
4NS5A 2LXPC 4GNDA 4YYIA 5EPRA 4YYGA 5D3HA 4YYJA 5CUBA 5FE8A 1WEWA 4HXNA 4UIZA 3M62A 4CUPA 3I2DA 1WILA 5IGLA 2KTBB 2DKWA 5LKTA 5FG4A 4NRAA 4QSTA 4FO9A 3U5OA 5EQ1A 4YBSA 5H9MA 4XUBA 5C8GA 2CKLA 5FE2A 3U5NA 4LYSA 2G6QA 5DKHA 4MEPA 2E7OA 4MR6A 5CRZA 5A5QA 5IIDA 3U5PA 5DBMA 4A0CD 4J3IA 1MM2A 5I3LA 4NR6A 3AQAA 2LN0A 2DATA 5FE7A 5LJ2A 3C5KA 4GB0A 4NRBA 3TLPA 4QSPA 5CQ5A 5FE6A 2DX8A 1N87A 4A9EA 3QZVA 3MULA 3KQIA 4UIWA 2PNXA 3N9NA 5D7XA 2JMDA 5FB0A 3IU6A 3RTRB 1WENA 5G04B 5A7CA 4IOOA 5E3DA 4A9NA 3SVHA 2G4AA 5F62A 3ASLA 2I8NA 4W4UA 5A82A 4KCXA 4O75A 4QSQA 5D3RA 4I7DA 3G0LA 4CUUA 3MUKA 2VPDA 2ECGA 1ZBDB 2RS9B 1T1HA 5CQTA 2JMIA 5CUGA 4QB3A 2VPGA 4QEWA 5HLSA 5CUEA 5KTXA 4IOQA 3QZTA 2FSAA 5BT5A 5HELA 3PURA 5EK9A 4S3OC 2I50A 3SHBA 4HXOA 3HCUA 4LZ2A 3FKMX 5I80A 2M3HA 4QSXA 4UYHA 5EU1A 1LDKC 4TKPB 5CTLA 5FE0A 1RMDA 2PUYA 5AIUA 4F3IA 4QSWA 3MHSA 1HYIA 2OXQC 2KWKA 3IHPA 3L1ZB 5KH3A 5TDWA 4ALHA 4LYIA 3P1DA 3UV5A 2XEUA 2R0SA 4PS5A 4RVRA 3ZPVE 4HXLA 5EWWA 4Q0NA 3EB5A 4O70A 2WP1A 4QY4A 1WUMA 4QYLA 1WEPA 2ECVA 3D7CA 3ZYQA 2KWOA 1VYXA 1JSPB 4O64A 3M99A 3ZNIA 2RO1A 3JVLA 4NYWA 4R8PK 3PHDA 3DWYA 5DYCA 4NN2A 4QR4A 1K2FA 5I29A 2YHNA 5EVAA 3FL2A 5EICA 1WUGA 1FBVA 2HYED 4MSXA 2E7NA 5ENJA 4CLBA 4NR8A 4AP4A 5CQ3A 5EM3A 3ZPV1 5FB1A 5HEMA 4Z6IA 3SOUA 4UI9B 5FEYA 2DWWA 5CUDA 2YYRA 2L75A 3DAIA 4O78A 4S3OB 5F3AA 2F6JA 4AYCA 1WE9A 2VPEA 2YUCA 3UW9A 4HXSA 3HMEA 1EQFA 4TU4A 5HFQA 5DW2A 2R0YA 4YYHA 4YYKA 5E9LA 4XI1A 4IR4A 1BORA 4QF3A 2AN6A 5E9YA 2ECNA 4QYDA 5A81A 4BW2A 5D1MB 4WZ3B 5FH6A 2ZETC 5FBXA 2K4DA 4BHWA 2WP2A 4CURA 5D26A 2DVRA 3ZYUA 3U5LA 3DPLR 4A4CA 4C66A 3JVJA 2F6NA 1MM3A 5G4SA 2D8SA 5D1LB 2CT2A 5EA1A 4CCGX 4NQNA 5EPBA 1IYMA 2YU4A 1VFYA 4O7EA 5E9VA 1WEMA 5E0RA 3RPGB 2LGGA 3O7AA 5FE5A 5A5NA 4A9MA 4O72A 4P5OB 3UVXA 4AKNA 2E6SA 2L85A 4IR6A 2M1RA 3GV4A 5D3NA 3S91A 4TU6A 1JM7A 3U5KA 4MVTA 5F1LA 2H60A 5EWCA 5B77A 2OSSA 2YELA 4A9LA 4WHWA 5ENBA 5FE1A 3HMHA 3DQVR 3SVGA 4MR3A 2RI7A 5EISA 5AMEA 5B8DA 4KV1A 1E6IA 3JVKA 5IGMA 5DFBA 2JRJA 2KWNA 5I7XA 4CL9A 3Q2EA 2L84A 4TZ8A 4GNGA 3S92A 4NR9A 5H1UA 5ETDA 3QZSA 5HQ7A 5HRVA 4BW3A 5ENGA 4MR5A 2VNFA 4UYFB 2L43A 3Q2FA 5B76A 4HXMA 2D9EA 3N9OA 1DVPA 4NUCA 1VD4A 2LRIC 4O74A 5LKXA 3UVDA 1G25A 3P1FA 4TYLA 3NXBA 3SOWA 5G0FA 1X4UA 2KGIA 5E9KA 2LGVA 3GG3A 5DFCA 5K29A 4IC2A 5D3JA 4ZQLA 2LV9A 4J0RA 2C2VS 3KV6A 4GNFA 4LDFA 4MEQA 4UP0A 4UIUA 5F2PA 5DLXA 5I40A 5D1KB 3V43A 3P5OA 3LXJA 2MIQA 2QJ0A 2RFJA 2L80A 4LJNA 4FJCA 4AVXA 2F42A 5CQ8A 4Z1QA 3UV2A 4B7YC 2DVSA 2CSZA 4OGJA 4YATA 5ENHA 3G0JA 2NXBA 3I3JA 5D24A 5KH7A 4UIVA 2HDPA 2XB1A 4HBVA 4TZ2A 3JVMA 5DYUA 5C13A 2DVQA 4TT6A 3MXFA 5CRMA 4N3WA 5E7DA 5HJCA 2Y1NA 3O35A 4HXKA 4Q6FA 4UYGA 2C2LA 2YSMA 4LRGA 5LKUA 2FUIA 4PPEA 4YYNA 2RSDA 2KYUA 2L5EA 4HBWA 1WESA 2EA6A 5AD3A 4ZDTA 5F60A 5EV9A 1WEOA 5ACYA 2BAYA 2ECWA 5I83A 4CUSA 4YBTA 5H85A 2D82A 5FH7A 3ZTGA 5E9MA 1WEQA 3L11A 3LQHA 5CGPA 3UV4A 5DW1A 4XY8A 5HRXA 5IGNA 5D3TA 5FE3A 4BBQA 4KV4A 5FDZA 5BT4A 1F68A 3T7LA 5D3SA 4O7AA 2CSYA 4QR3A 4UYEA 3N9LA 4LYWA 2KGGA 4O7CA 4A9JA 2YEMA 5DKCA 5L96A 4IR3A 5CQ7A 4QNSA 5LVRA 2FUUA 4QR5A 4O76A 4WIVA 5LUUA 3KV5A 1X4JA 4IORA 3P1EA 3PUQA 4WZ2A 1WFKA 2YT5A 5TCMA 4CFKA 4LK9A 5LJ0A 4Y03A 4NQMA 4FK5A 3MB4A 3T6RA 4PY6A 3SVFA 2YW8A 3N9QA 5CU8A 4YH3A 4A9FA 5FH8A 4LADB 4C9ZA 4I7CA 4LKAA 2YURA 4ZW1A 2VJEB 3O70A 2VPBA 5TABA 5C89A 2MT5A 4YABA 5C4QA 5COIA 3N9PA 4NUEA 5D25A 1FP0A 2YHOA 5DINA 5LKZA 5DFDA 3U5MA 4TQNA 4YYDA 5C87A 4UYFA 1WEEA 4UITA 4TT4A 5ENIA 2YEKA 2H0DA 4QUUA 3UVWA 2KR4A 3EB6A 5KHMA 5HM0A 4MR4A 5KTWA 2L5UA 4BW4A 4NYXA 4E96A 5CQ4A 5II1A 5B75A 5AD2A 5A83A 2YQDA 5A85A 1ZS5A 4XYAA 4IR5A 5CUAA 3LRQA 4DONA 5EYAF 4CA1A 2LDRA 2RNXA 4QEUA 3O36A 3IU5A 4QEVA 2MNZA 5I88A 3UVYA 2YREA 2KIZA 1HYJA 4N4GA 5I7YA 4NR7A 2H0DB 5HQ6A 1F62A 4LR6A 5E9IA 5FG5A 5DYXA 5E3GA 2VJFB 5A5SA 4NXJA 5JI8A 2YQMA 2KE1A 4QUTA 3LQIA 5J3XA 4Z6HA 5F1HA 5FE4A 2VP7A 2M85A 2R0VA 4N4FA 5D0CA 2DVVA 2LQ6A 4QF2A 3VK6A 2YW5A 5FE9A 4O71A 4YAXA 4GPJA 4LZSA 4J0SA 4YADA 4MEOA 4XUAA 4F52B 4YH4A 4NUDA 2L0BA 2VJFA 5L97A 4O7FA 5HQ5A 2ECIA 4HXRA 2KFTA 3HTKC 5DYAA 2GRCA 1JM4B 2OUOA 1Z6UA 3MHHA 5JG6A 4CFLA 4LZRA 2G43A 4A9IA 3K2JA 5G4RA 3LJWA 4CUTA 4FIPA 3ZVYA 2MJVB 1N72A 5B78A 4TTEA 1XWHA 4OUFA 3SOXA 5EGUA 5CFWA 5IBNA 5E74A 3AADA 5DX4A 2YSJA 4YY4A 3N9MA 4UIXA 5DKDA 5H1TA 4PCEA 5EWHA 5F63A 3O33A 5B79A 5CS8A 4AYCB 5A5RA 4A9HA 5ENEA 4YBMA 5BT3A 1Z2QA 5TBNA 4J1PA 5CUCA 2QICA 4IC3A 3HCTA 2N9GA 5AMFA 1V87A 4XY9A 4YY6A 1X4IA 4NRCA 3KNVA 4HXPA 5I89A 5J0DA 4X3GA 4O7BA 4QC3A 2VJEA 3MQMA 2YYNA 2RNYA 5HENA 4NR4A 4BJXA 1WIMA 4PTBA 2JMJA 1JM7B 2R10A 4O77A 4NR5A 5ENCA 3LQJA 4OGIA 5A5PA 5HRWA 3M63A 5ENFA 5H1VA 5C7NA 4A9KA 4HBYA 5AITA 2IDAA 5DKAA 2EGPA 3MB3A 4R2YA 2LSPB 1WGMA 2K16A 2RNWA 3HMFA 4A9OA 3GL6A 5L99A 4MENA 5JWMA 4WA6A 3C6WA 4C67A 3RCWA 2Y43A 4TS8A 4L7XA 5CQAA 5F5ZA 5II2A 2LGKA 2Y1MA 4R7EA 5CQ6A 3O37A 4QC1A 4QSRA 2QIZA 4Q0OA 5TDRA 4YYMA 5IGKA 3U5JA 1JOCA 4LLBA 4QZSA 5DLZA 5HFRA 2MUMA 2NAAA 4PCIA 5L8UA 5CY9A 5KH9A 2KREA 3P1CA 4UYDA 4X2IA 4ZC9A 4QSUA 5EWDA 5I86A 3ZVZB 5EI4A 2MA6A 5EWVA 1U6GB 4QSVA 5LVQA 4PKLA 1CHCA 5TB6A 5HCLA 2E6RA 5IG6A 1Z60A 2ECTA 5CP5A 5LJ1A 3L1XA 5TRBA 1E4UA 5FFVA 5C85A 2YQLA 4UP5A 5F61A 4GNEA 4FLPA 4UIYA 4HBXA 4WHUA 5L8TA 3ONIA 4YK0A 4I7BA 5EPSA 4WZ0A 4CUQA 4A4BA 4ALGA 5G05B 1LDJB 2K1JA 2K17A 4Z1SA 5L98A 5C11A 2KU3A 4V3LC 5KTUA 4V3KC 2CKLB 2MA5A 5DY7A 1WEVA 4N4IA 4Z93A 5LCWB 4N4HA 1WEUA 3RPGC 2M6MA 4ZUXU 5D3LA 2LXHC 4QBMA 4L58A 2YDWA 4QSSA 2MD8C 4YC9A 2MD7B 4BW1A 4LC2A 5FFWA 3O34A 5F36A 2OO1A 2EODA 4AUQB 5E73A 2I7KA 2UZGA 5CZGA 5KU3A 5ETBA 4A49A 3HCSA 1X0JA 2E3KA 5FFYA 2MNYA 2ECJA 4NYVA 2LGLA 2G45A 5FG6A 5CPEA 5EP7A 3NG2A 5F25A 4B86C 5KO4A 5A5OA 5I1QA 5FERA 4TT2A 5D3PA 2KWJA
chains in the Genus database with same CATH superfamily
4NS5A 2LXPC 4GNDA 4YYIA 5EPRA 4YYGA 5D3HA 4YYJA 5CUBA 5FE8A 3E2DA 1WEWA 4HXNA 4UIZA 3M62A 4CUPA 3I2DA 1WILA 5IGLA 3O47A 2KTBB 2DKWA 5LKTA 5FG4A 4NRAA 4QSTA 4FO9A 3U5OA 5EQ1A 4YBSA 5H9MA 4XUBA 5C8GA 2CKLA 5FE2A 3U5NA 4LYSA 2G6QA 5DKHA 4MEPA 2E7OA 4MR6A 5CRZA 5A5QA 5IIDA 3U5PA 5DBMA 4A0CD 4J3IA 1MM2A 5I3LA 4NR6A 3AQAA 2LN0A 2DATA 5FE7A 5LJ2A 3C5KA 4GB0A 4NRBA 3TLPA 4QSPA 5CQ5A 5FE6A 2DX8A 1N87A 3T9KA 4A9EA 3QZVA 3MULA 3KQIA 4UIWA 2PNXA 3D1DA 3N9NA 5D7XA 2JMDA 5FB0A 3IU6A 3RTRB 1WENA 5G04B 5A7CA 4IOOA 5E3DA 4A9NA 3SVHA 2G4AA 5F62A 3ASLA 2I8NA 4W4UA 5A82A 4KCXA 4O75A 4QSQA 5D3RA 4I7DA 3G0LA 4CUUA 3MUKA 2VPDA 2ECGA 1ZBDB 4QQ4A 2RS9B 2DJAA 1T1HA 5CQTA 2JMIA 5CUGA 4QB3A 2VPGA 4QEWA 2JM3A 4Z0RA 5HLSA 5CUEA 5KTXA 4IOQA 3QZTA 2FSAA 5BT5A 5HELA 3PURA 5EK9A 4S3OC 2I50A 3SHBA 4HXOA 2EGMA 4LZ2A 3FKMX 5I80A 2M3HA 3DWDA 3HCUA 4QSXA 4UYHA 5EU1A 1LDKC 4TKPB 5CTLA 2YVRA 5FE0A 1RMDA 2PUYA 5AIUA 4F3IA 4QSWA 3MHSA 1HYIA 2OXQC 2KWKA 3IHPA 3ERRA 3L1ZB 5KH3A 5TDWA 4ALHA 4LYIA 3P1DA 3UV5A 2XEUA 2R0SA 4PS5A 4RVRA 3ZPVE 4HXLA 5EWWA 4Q0NA 3EB5A 4O70A 2WP1A 4QY4A 1WUMA 4QYLA 1WEPA 2ECVA 3D7CA 3ZYQA 2KWOA 1VYXA 1JSPB 4O64A 3M99A 3ZNIA 4F1PA 2RO1A 2D8UA 3JVLA 4NYWA 4R8PK 3PHDA 3DWYA 5DYCA 4NN2A 4QR4A 1K2FA 5I29A 3LJUX 2YHNA 5EVAA 3FL2A 5EICA 1WUGA 1FBVA 2HYED 4MSXA 2E7NA 5ENJA 4CLBA 4NR8A 4AP4A 5CQ3A 5EM3A 3Q1DA 3ZPV1 5FB1A 5HEMA 4Z6IA 3SOUA 4UI9B 5FEYA 2DWWA 5CUDA 2YYRA 2L75A 3DAIA 4O78A 4S3OB 5F3AA 2F6JA 2FFWA 3FM8C 4AYCA 1WE9A 2VPEA 2YUCA 3UW9A 4HXSA 3HMEA 1EQFA 4TU4A 2EXUA 5HFQA 5DW2A 2XP0A 2R0YA 4YYHA 4YYKA 5E9LA 4XI1A 4IR4A 1BORA 4QF3A 2AN6A 3LVQE 5E9YA 2ECNA 4QYDA 5A81A 4BW2A 5D1MB 4WZ3B 5FH6A 2ZETC 5FBXA 2K4DA 5SVYA 4BHWA 2M13A 2WP2A 4CURA 5D26A 2DVRA 3ZYUA 3U5LA 3DPLR 4A4CA 4C66A 3JVJA 2F6NA 1MM3A 5G4SA 2D8SA 5D1LB 2CT2A 5EA1A 4CCGX 4NQNA 5EPBA 1IYMA 2YU4A 3FEHA 1VFYA 4O7EA 5E9VA 1WEMA 5E0RA 3RPGB 2LGGA 3O7AA 5FE5A 5A5NA 4A9MA 4O72A 4P5OB 3UVXA 4AKNA 2E6SA 2L85A 4IR6A 2M1RA 3GV4A 5D3NA 3S91A 4TU6A 1JM7A 3U5KA 4MVTA 5F1LA 2H60A 5EWCA 5B77A 4AI6A 2OSSA 2YELA 4A9LA 4WHWA 5ENBA 5FE1A 3HMHA 3DQVR 3SVGA 4MR3A 2RI7A 5EISA 5AMEA 5B8DA 4KV1A 1E6IA 3JVKA 5IGMA 5DFBA 2JRJA 2KWNA 3DDTA 5I7XA 4CL9A 3Q2EA 2L84A 4TZ8A 4GNGA 3S92A 4NR9A 5H1UA 5ETDA 3QZSA 5HQ7A 5HRVA 4BW3A 3KDEC 5ENGA 4MR5A 2VNFA 2CRRA 4UYFB 2L43A 3Q2FA 5B76A 4HXMA 2D9EA 3N9OA 1DVPA 4NUCA 1VD4A 2LRIC 4O74A 5LKXA 3UVDA 1G25A 3P1FA 4TYLA 4O62A 3NXBA 3SOWA 5G0FA 1X4UA 2KGIA 5E9KA 2LGVA 3GG3A 2OWAA 5DFCA 5K29A 4IC2A 5D3JA 4ZQLA 2LV9A 4J0RA 2C2VS 2P57A 3KV6A 4GNFA 4LDFA 3VKHA 5SVIB 4MEQA 4UP0A 1DCQA 4UIUA 5F2PA 5DLXA 5I40A 5D1KB 3V43A 3P5OA 3LXJA 2MIQA 2QJ0A 2RFJA 2L80A 4LJNA 4FJCA 4AVXA 2F42A 5CQ8A 4Z1QA 3UV2A 4B7YC 2DVSA 2CSZA 3JUEA 4OGJA 4YATA 5ENHA 3G0JA 2NXBA 3I3JA 5D24A 5KH7A 4UIVA 2HDPA 2XB1A 4HBVA 4TZ2A 3JVMA 5DYUA 5C13A 2DVQA 4TT6A 3MXFA 5CRMA 4N3WA 5E7DA 5HJCA 2Y1NA 3O35A 4HXKA 4Q6FA 4UYGA 2C2LA 2YSMA 4LRGA 5LKUA 2FUIA 4PPEA 4YYNA 2RSDA 2KYUA 2L5EA 4HBWA 1WESA 2EA6A 5AD3A 4ZDTA 5F60A 3FANA 5EV9A 1WEOA 5ACYA 2BAYA 2ECWA 5I83A 4CUSA 4YBTA 5H85A 2D82A 5FH7A 4AKIA 3ZTGA 5E9MA 1WEQA 3L11A 3LQHA 5CGPA 3UV4A 5DW1A 4XY8A 5HRXA 5IGNA 5D3TA 5FE3A 4BBQA 4KV4A 1PUOA 5FDZA 5BT4A 1F68A 3T7LA 5D3SA 4O7AA 2CSYA 4QR3A 4UYEA 3N9LA 4LYWA 2KGGA 4O7CA 4A9JA 3MDBC 2YEMA 5DKCA 5L96A 4IR3A 5CQ7A 4QNSA 5LVRA 2FUUA 4QR5A 4O76A 4WIVA 5LUUA 3KV5A 1X4JA 4IORA 3P1EA 3PUQA 4WZ2A 1WFKA 2YT5A 5TCMA 4CFKA 4LK9A 5LJ0A 4Y03A 4NQMA 4FK5A 3MB4A 3T6RA 4PY6A 3SVFA 2YW8A 4OGCA 3N9QA 5CU8A 4YH3A 4A9FA 5FH8A 4LADB 4C9ZA 4I7CA 4LKAA 2YURA 4ZW1A 2VJEB 3O70A 2VPBA 5TABA 5C89A 2XOYA 2MT5A 4YABA 5C4QA 4H9DA 5COIA 3N9PA 4NUEA 5D25A 1FP0A 2YHOA 5DINA 5LKZA 5DFDA 3U5MA 4TQNA 4YYDA 1ZKRA 4UYFA 5C87A 4UITA 4TT4A 5ENIA 2YEKA 1WEEA 4QUUA 3UVWA 2CRWA 2H0DA 2KR4A 5KHMA 5HM0A 3EB6A 4MR4A 5KTWA 4AKGA 2L5UA 4BW4A 4NYXA 4E96A 5CQ4A 5II1A 5B75A 5AD2A 5A83A 2YQDA 5A85A 1ZS5A 4XYAA 4IR5A 5CUAA 3LRQA 4DONA 5EYAF 4CA1A 2LDRA 2EJNA 2RNXA 4QEUA 3O36A 2MKEA 3IU5A 4QEVA 2CONA 2MNZA 5I88A 3UVYA 2YREA 2KIZA 1HYJA 4N4GA 5I7YA 4NR7A 2H0DB 5HQ6A 1F62A 2KKYA 4LR6A 5E9IA 5FG5A 5DYXA 5E3GA 2VJFB 5A5SA 4NXJA 5JI8A 2YQMA 2KE1A 5K3QA 4QUTA 3LQIA 5J3XA 4Z6HA 5F1HA 5FE4A 2FD4A 2VP7A 2M85A 2R0VA 4N4FA 5D0CA 2DVVA 2LQ6A 2XOZA 4QF2A 3VK6A 2YW5A 3VKGA 3D1BA 5FE9A 4O71A 4YAXA 4GPJA 4LZSA 4J0SA 4YADA 4MEOA 4XUAA 4F52B 4YH4A 2B0OE 4NUDA 2L0BA 2CSVA 2VJFA 5L97A 4O7FA 5HQ5A 2ECIA 3FJUB 4HXRA 2KFTA 3HTKC 5DYAA 2GRCA 1JM4B 2OUOA 4AKHA 1Z6UA 3MHHA 5JG6A 4CFLA 4LZRA 2G43A 4A9IA 3K2JA 5G4RA 3LJWA 4CUTA 4FIPA 3ZVYA 2MJVB 1N72A 5B78A 4TTEA 1XWHA 4OUFA 3SOXA 5EGUA 5CFWA 5IBNA 5E74A 3AADA 5DX4A 2YSJA 3M7KA 4YY4A 3N9MA 4UIXA 5DKDA 5H1TA 4PCEA 5EWHA 5F63A 2XOCA 3O33A 5B79A 5CS8A 4AYCB 5A5RA 4A9HA 5ENEA 4YBMA 5BT3A 1Z2QA 5TBNA 4J1PA 5CUCA 2QICA 4IC3A 3HCTA 2N9GA 5AMFA 1V87A 4XY9A 4YY6A 1X4IA 4NRCA 3KNVA 4HXPA 5I89A 5J0DA 4X3GA 4O7BA 4QC3A 2VJEA 3MQMA 2YYNA 2RNYA 5HENA 4NR4A 4BJXA 1WIMA 4PTBA 2LAUA 2JMJA 1JM7B 2R10A 4O77A 4NR5A 5ENCA 3LQJA 4OGIA 5A5PA 5HRWA 3M63A 5ENFA 5H1VA 5C7NA 4A9KA 4HBYA 5AITA 2IDAA 5DKAA 4OGEA 2EGPA 3MB3A 4R2YA 2LSPB 1WGMA 2K16A 2RNWA 3HMFA 4A9OA 3GL6A 5L99A 4MENA 5JWMA 4WA6A 2RR4A 3C6WA 4C67A 3RCWA 2Y43A 4TS8A 4L7XA 1MBMA 5CQAA 5F5ZA 5II2A 2LGKA 2Y1MA 3FAOA 4R7EA 5SVIA 5CQ6A 3O37A 4QC1A 4QSRA 2QIZA 4Q0OA 2L7PA 5TDRA 4YYMA 5IGKA 3LVRE 3U5JA 1JOCA 5SVXA 4LLBA 4QZSA 5DLZA 5HFRA 2MUMA 2NAAA 4PCIA 5L8UA 5CY9A 5KH9A 2JUNA 2KKXA 3P1CA 4UYDA 4X2IA 4ZC9A 2KREA 4QSUA 5EWDA 5I86A 3ZVZB 5EI4A 2MA6A 5EWVA 1U6GB 4QSVA 5LVQA 4PKLA 1CHCA 3SUBA 5TB6A 5HCLA 2E6RA 5IG6A 1Z60A 2ECTA 5CP5A 5LJ1A 3L1XA 5TRBA 1E4UA 2DSMA 5FFVA 5C85A 2YQLA 4UP5A 5F61A 4GNEA 4FLPA 4UIYA 4HBXA 4WHUA 5L8TA 3ONIA 4YK0A 4I7BA 5EPSA 4WZ0A 4CUQA 4A4BA 4ALGA 5G05B 1LDJB 2K1JA 2K17A 4Z1SA 5L98A 3H7HA 5C11A 2KU3A 4V3LC 5KTUA 4V3KC 2CKLB 2MA5A 5DY7A 1WEVA 4N4IA 4Z93A 5LCWB 4N4HA 1WEUA 3RPGC 2M6MA 4ZUXU 5D3LA 2LXHC 4QBMA 2IQJA 4L58A 2YDWA 4QSSA 2MD8C 4YC9A 2MD7B 4BW1A 3LDYA 4LC2A 5FFWA 3O34A 5F36A 2OO1A 2E61A 4Z0OA 2EODA 4AUQB 5E73A 2I7KA 2UZGA 3PLWA 5CZGA 5KU3A 5ETBA 4A49A 3HCSA 1X0JA 2E3KA 5FFYA 2MNYA 2ECJA 4NYVA 2LGLA 2G45A 5FG6A 5CPEA 5EP7A 3NG2A 5F25A 4B86C 5KO4A 5A5OA 5I1QA 5FERA 4TT2A 5D3PA 2KWJA
chains in the Genus database with same CATH topology
4NS5A 2LXPC 4GNDA 4YYIA 5EPRA 4YYGA 5D3HA 4YYJA 5CUBA 5FE8A 1WEWA 4HXNA 4UIZA 3M62A 4CUPA 3I2DA 1WILA 5IGLA 2KTBB 2DKWA 5LKTA 5FG4A 4NRAA 4QSTA 4FO9A 3U5OA 5EQ1A 4YBSA 5H9MA 4XUBA 5C8GA 2CKLA 5FE2A 3U5NA 4LYSA 2G6QA 5DKHA 4MEPA 2E7OA 4MR6A 5CRZA 5A5QA 5IIDA 3U5PA 5DBMA 4A0CD 4J3IA 1MM2A 5I3LA 4NR6A 3AQAA 2LN0A 2DATA 5FE7A 5LJ2A 3C5KA 4GB0A 4NRBA 3TLPA 4QSPA 5CQ5A 5FE6A 2DX8A 1N87A 4A9EA 3QZVA 3MULA 3KQIA 4UIWA 2PNXA 3N9NA 5D7XA 2JMDA 5FB0A 3IU6A 3RTRB 1WENA 5G04B 5A7CA 4IOOA 5E3DA 4A9NA 3SVHA 2G4AA 5F62A 3ASLA 2I8NA 4W4UA 5A82A 4KCXA 4O75A 4QSQA 5D3RA 4I7DA 3G0LA 4CUUA 3MUKA 2VPDA 2ECGA 1ZBDB 2RS9B 1T1HA 5CQTA 2JMIA 5CUGA 4QB3A 2VPGA 4QEWA 5HLSA 5CUEA 5KTXA 4IOQA 3QZTA 2FSAA 5BT5A 5HELA 3PURA 5EK9A 4S3OC 2I50A 3SHBA 4HXOA 3HCUA 4LZ2A 3FKMX 5I80A 2M3HA 4QSXA 4UYHA 5EU1A 1LDKC 4TKPB 5CTLA 5FE0A 1RMDA 2PUYA 5AIUA 4F3IA 4QSWA 3MHSA 1HYIA 2OXQC 2KWKA 3IHPA 3L1ZB 5KH3A 5TDWA 4ALHA 4LYIA 3P1DA 3UV5A 2XEUA 2R0SA 4PS5A 4RVRA 3ZPVE 4HXLA 5EWWA 4Q0NA 3EB5A 4O70A 2WP1A 4QY4A 1WUMA 4QYLA 1WEPA 2ECVA 3D7CA 3ZYQA 2KWOA 1VYXA 1JSPB 4O64A 3M99A 3ZNIA 2RO1A 3JVLA 4NYWA 4R8PK 3PHDA 3DWYA 5DYCA 4NN2A 4QR4A 1K2FA 5I29A 2YHNA 5EVAA 3FL2A 5EICA 1WUGA 1FBVA 2HYED 4MSXA 2E7NA 5ENJA 4CLBA 4NR8A 4AP4A 5CQ3A 5EM3A 3ZPV1 5FB1A 5HEMA 4Z6IA 3SOUA 4UI9B 5FEYA 2DWWA 5CUDA 2YYRA 2L75A 3DAIA 4O78A 4S3OB 5F3AA 2F6JA 4AYCA 1WE9A 2VPEA 2YUCA 3UW9A 4HXSA 3HMEA 1EQFA 4TU4A 5HFQA 5DW2A 2R0YA 4YYHA 4YYKA 5E9LA 4XI1A 4IR4A 1BORA 4QF3A 2AN6A 5E9YA 2ECNA 4QYDA 5A81A 4BW2A 5D1MB 4WZ3B 5FH6A 2ZETC 5FBXA 2K4DA 4BHWA 2WP2A 4CURA 5D26A 2DVRA 3ZYUA 3U5LA 3DPLR 4A4CA 4C66A 3JVJA 2F6NA 1MM3A 5G4SA 2D8SA 5D1LB 2CT2A 5EA1A 4CCGX 4NQNA 5EPBA 1IYMA 2YU4A 1VFYA 4O7EA 5E9VA 1WEMA 5E0RA 3RPGB 2LGGA 3O7AA 5FE5A 5A5NA 4A9MA 4O72A 4P5OB 3UVXA 4AKNA 2E6SA 2L85A 4IR6A 2M1RA 3GV4A 5D3NA 3S91A 4TU6A 1JM7A 3U5KA 4MVTA 5F1LA 2H60A 5EWCA 5B77A 2OSSA 2YELA 4A9LA 4WHWA 5ENBA 5FE1A 3HMHA 3DQVR 3SVGA 4MR3A 2RI7A 5EISA 5AMEA 5B8DA 4KV1A 1E6IA 3JVKA 5IGMA 5DFBA 2JRJA 2KWNA 5I7XA 4CL9A 3Q2EA 2L84A 4TZ8A 4GNGA 3S92A 4NR9A 5H1UA 5ETDA 3QZSA 5HQ7A 5HRVA 4BW3A 5ENGA 4MR5A 2VNFA 4UYFB 2L43A 3Q2FA 5B76A 4HXMA 2D9EA 3N9OA 1DVPA 4NUCA 1VD4A 2LRIC 4O74A 5LKXA 3UVDA 1G25A 3P1FA 4TYLA 3NXBA 3SOWA 5G0FA 1X4UA 2KGIA 5E9KA 2LGVA 3GG3A 5DFCA 5K29A 4IC2A 5D3JA 4ZQLA 2LV9A 4J0RA 2C2VS 3KV6A 4GNFA 4LDFA 4MEQA 4UP0A 4UIUA 5F2PA 5DLXA 5I40A 5D1KB 3V43A 3P5OA 3LXJA 2MIQA 2QJ0A 2RFJA 2L80A 4LJNA 4FJCA 4AVXA 2F42A 5CQ8A 4Z1QA 3UV2A 4B7YC 2DVSA 2CSZA 4OGJA 4YATA 5ENHA 3G0JA 2NXBA 3I3JA 5D24A 5KH7A 4UIVA 2HDPA 2XB1A 4HBVA 4TZ2A 3JVMA 5DYUA 5C13A 2DVQA 4TT6A 3MXFA 5CRMA 4N3WA 5E7DA 5HJCA 2Y1NA 3O35A 4HXKA 4Q6FA 4UYGA 2C2LA 2YSMA 4LRGA 5LKUA 2FUIA 4PPEA 4YYNA 2RSDA 2KYUA 2L5EA 4HBWA 1WESA 2EA6A 5AD3A 4ZDTA 5F60A 5EV9A 1WEOA 5ACYA 2BAYA 2ECWA 5I83A 4CUSA 4YBTA 5H85A 2D82A 5FH7A 3ZTGA 5E9MA 1WEQA 3L11A 3LQHA 5CGPA 3UV4A 5DW1A 4XY8A 5HRXA 5IGNA 5D3TA 5FE3A 4BBQA 4KV4A 5FDZA 5BT4A 1F68A 3T7LA 5D3SA 4O7AA 2CSYA 4QR3A 4UYEA 3N9LA 4LYWA 2KGGA 4O7CA 4A9JA 2YEMA 5DKCA 5L96A 4IR3A 5CQ7A 4QNSA 5LVRA 2FUUA 4QR5A 4O76A 4WIVA 5LUUA 3KV5A 1X4JA 4IORA 3P1EA 3PUQA 4WZ2A 1WFKA 2YT5A 5TCMA 4CFKA 4LK9A 5LJ0A 4Y03A 4NQMA 4FK5A 3MB4A 3T6RA 4PY6A 3SVFA 2YW8A 3N9QA 5CU8A 4YH3A 4A9FA 5FH8A 4LADB 4C9ZA 4I7CA 4LKAA 2YURA 4ZW1A 2VJEB 3O70A 2VPBA 5TABA 5C89A 2MT5A 4YABA 5C4QA 5COIA 3N9PA 4NUEA 5D25A 1FP0A 2YHOA 5DINA 5LKZA 5DFDA 3U5MA 4TQNA 4YYDA 5C87A 4UYFA 1WEEA 4UITA 4TT4A 5ENIA 2YEKA 2H0DA 4QUUA 3UVWA 2KR4A 3EB6A 5KHMA 5HM0A 4MR4A 5KTWA 2L5UA 4BW4A 4NYXA 4E96A 5CQ4A 5II1A 5B75A 5AD2A 5A83A 2YQDA 5A85A 1ZS5A 4XYAA 4IR5A 5CUAA 3LRQA 4DONA 5EYAF 4CA1A 2LDRA 2RNXA 4QEUA 3O36A 3IU5A 4QEVA 2MNZA 5I88A 3UVYA 2YREA 2KIZA 1HYJA 4N4GA 5I7YA 4NR7A 2H0DB 5HQ6A 1F62A 4LR6A 5E9IA 5FG5A 5DYXA 5E3GA 2VJFB 5A5SA 4NXJA 5JI8A 2YQMA 2KE1A 4QUTA 3LQIA 5J3XA 4Z6HA 5F1HA 5FE4A 2VP7A 2M85A 2R0VA 4N4FA 5D0CA 2DVVA 2LQ6A 4QF2A 3VK6A 2YW5A 5FE9A 4O71A 4YAXA 4GPJA 4LZSA 4J0SA 4YADA 4MEOA 4XUAA 4F52B 4YH4A 4NUDA 2L0BA 2VJFA 5L97A 4O7FA 5HQ5A 2ECIA 4HXRA 2KFTA 3HTKC 5DYAA 2GRCA 1JM4B 2OUOA 1Z6UA 3MHHA 5JG6A 4CFLA 4LZRA 2G43A 4A9IA 3K2JA 5G4RA 3LJWA 4CUTA 4FIPA 3ZVYA 2MJVB 1N72A 5B78A 4TTEA 1XWHA 4OUFA 3SOXA 5EGUA 5CFWA 5IBNA 5E74A 3AADA 5DX4A 2YSJA 4YY4A 3N9MA 4UIXA 5DKDA 5H1TA 4PCEA 5EWHA 5F63A 3O33A 5B79A 5CS8A 4AYCB 5A5RA 4A9HA 5ENEA 4YBMA 5BT3A 1Z2QA 5TBNA 4J1PA 5CUCA 2QICA 4IC3A 3HCTA 2N9GA 5AMFA 1V87A 4XY9A 4YY6A 1X4IA 4NRCA 3KNVA 4HXPA 5I89A 5J0DA 4X3GA 4O7BA 4QC3A 2VJEA 3MQMA 2YYNA 2RNYA 5HENA 4NR4A 4BJXA 1WIMA 4PTBA 2JMJA 1JM7B 2R10A 4O77A 4NR5A 5ENCA 3LQJA 4OGIA 5A5PA 5HRWA 3M63A 5ENFA 5H1VA 5C7NA 4A9KA 4HBYA 5AITA 2IDAA 5DKAA 2EGPA 3MB3A 4R2YA 2LSPB 1WGMA 2K16A 2RNWA 3HMFA 4A9OA 3GL6A 5L99A 4MENA 5JWMA 4WA6A 3C6WA 4C67A 3RCWA 2Y43A 4TS8A 4L7XA 5CQAA 5F5ZA 5II2A 2LGKA 2Y1MA 4R7EA 5CQ6A 3O37A 4QC1A 4QSRA 2QIZA 4Q0OA 5TDRA 4YYMA 5IGKA 3U5JA 1JOCA 4LLBA 4QZSA 5DLZA 5HFRA 2MUMA 2NAAA 4PCIA 5L8UA 5CY9A 5KH9A 2KREA 3P1CA 4UYDA 4X2IA 4ZC9A 4QSUA 5EWDA 5I86A 3ZVZB 5EI4A 2MA6A 5EWVA 1U6GB 4QSVA 5LVQA 4PKLA 1CHCA 5TB6A 5HCLA 2E6RA 5IG6A 1Z60A 2ECTA 5CP5A 5LJ1A 3L1XA 5TRBA 1E4UA 5FFVA 5C85A 2YQLA 4UP5A 5F61A 4GNEA 4FLPA 4UIYA 4HBXA 4WHUA 5L8TA 3ONIA 4YK0A 4I7BA 5EPSA 4WZ0A 4CUQA 4A4BA 4ALGA 5G05B 1LDJB 2K1JA 2K17A 4Z1SA 5L98A 5C11A 2KU3A 4V3LC 5KTUA 4V3KC 2CKLB 2MA5A 5DY7A 1WEVA 4N4IA 4Z93A 5LCWB 4N4HA 1WEUA 3RPGC 2M6MA 4ZUXU 5D3LA 2LXHC 4QBMA 4L58A 2YDWA 4QSSA 2MD8C 4YC9A 2MD7B 4BW1A 4LC2A 5FFWA 3O34A 5F36A 2OO1A 2EODA 4AUQB 5E73A 2I7KA 2UZGA 5CZGA 5KU3A 5ETBA 4A49A 3HCSA 1X0JA 2E3KA 5FFYA 2MNYA 2ECJA 4NYVA 2LGLA 2G45A 5FG6A 5CPEA 5EP7A 3NG2A 5F25A 4B86C 5KO4A 5A5OA 5I1QA 5FERA 4TT2A 5D3PA 2KWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NS5 A;  2LXP C;  4GND A;  4YYI A;  5EPR A;  4YYG A;  5D3H A;  4YYJ A;  5CUB A;  5FE8 A;  1WEW A;  4HXN A;  4UIZ A;  3M62 A;  4CUP A;  3I2D A;  1WIL A;  5IGL A;  2KTB B;  2DKW A;  5LKT A;  5FG4 A;  4NRA A;  4QST A;  4FO9 A;  3U5O A;  5EQ1 A;  4YBS A;  5H9M A;  4XUB A;  5C8G A;  2CKL A;  5FE2 A;  3U5N A;  4LYS A;  2G6Q A;  5DKH A;  4MEP A;  2E7O A;  4MR6 A;  5CRZ A;  5A5Q A;  5IID A;  3U5P A;  5DBM A;  4A0C D;  4J3I A;  1MM2 A;  5I3L A;  4NR6 A;  3AQA A;  2LN0 A;  2DAT A;  5FE7 A;  5LJ2 A;  3C5K A;  4GB0 A;  4NRB A;  3TLP A;  4QSP A;  5CQ5 A;  5FE6 A;  2DX8 A;  1N87 A;  4A9E A;  3QZV A;  3MUL A;  3KQI A;  4UIW A;  2PNX A;  3N9N A;  5D7X A;  2JMD A;  5FB0 A;  3IU6 A;  3RTR B;  1WEN A;  5G04 B;  5A7C A;  4IOO A;  5E3D A;  4A9N A;  3SVH A;  2G4A A;  5F62 A;  3ASL A;  2I8N A;  4W4U A;  5A82 A;  4KCX A;  4O75 A;  4QSQ A;  5D3R A;  4I7D A;  3G0L A;  4CUU A;  3MUK A;  2VPD A;  2ECG A;  1ZBD B;  2RS9 B;  1T1H A;  5CQT A;  2JMI A;  5CUG A;  4QB3 A;  2VPG A;  4QEW A;  5HLS A;  5CUE A;  5KTX A;  4IOQ A;  3QZT A;  2FSA A;  5BT5 A;  5HEL A;  3PUR A;  5EK9 A;  4S3O C;  2I50 A;  3SHB A;  4HXO A;  3HCU A;  4LZ2 A;  3FKM X;  5I80 A;  2M3H A;  4QSX A;  4UYH A;  5EU1 A;  1LDK C;  4TKP B;  5CTL A;  5FE0 A;  1RMD A;  2PUY A;  5AIU A;  4F3I A;  4QSW A;  3MHS A;  1HYI A;  2OXQ C;  2KWK A;  3IHP A;  3L1Z B;  5KH3 A;  5TDW A;  4ALH A;  4LYI A;  3P1D A;  3UV5 A;  2XEU A;  2R0S A;  4PS5 A;  4RVR A;  3ZPV E;  4HXL A;  5EWW A;  4Q0N A;  3EB5 A;  4O70 A;  2WP1 A;  4QY4 A;  1WUM A;  4QYL A;  1WEP A;  2ECV A;  3D7C A;  3ZYQ A;  2KWO A;  1VYX A;  1JSP B;  4O64 A;  3M99 A;  3ZNI A;  2RO1 A;  3JVL A;  4NYW A;  4R8P K;  3PHD A;  3DWY A;  5DYC A;  4NN2 A;  4QR4 A;  1K2F A;  5I29 A;  2YHN A;  5EVA A;  3FL2 A;  5EIC A;  1WUG A;  1FBV A;  2HYE D;  4MSX A;  2E7N A;  5ENJ A;  4CLB A;  4NR8 A;  4AP4 A;  5CQ3 A;  5EM3 A;  3ZPV 1;  5FB1 A;  5HEM A;  4Z6I A;  3SOU A;  4UI9 B;  5FEY A;  2DWW A;  5CUD A;  2YYR A;  2L75 A;  3DAI A;  4O78 A;  4S3O B;  5F3A A;  2F6J A;  4AYC A;  1WE9 A;  2VPE A;  2YUC A;  3UW9 A;  4HXS A;  3HME A;  1EQF A;  4TU4 A;  5HFQ A;  5DW2 A;  2R0Y A;  4YYH A;  4YYK A;  5E9L A;  4XI1 A;  4IR4 A;  1BOR A;  4QF3 A;  2AN6 A;  5E9Y A;  2ECN A;  4QYD A;  5A81 A;  4BW2 A;  5D1M B;  4WZ3 B;  5FH6 A;  2ZET C;  5FBX A;  2K4D A;  4BHW A;  2WP2 A;  4CUR A;  5D26 A;  2DVR A;  3ZYU A;  3U5L A;  3DPL R;  4A4C A;  4C66 A;  3JVJ A;  2F6N A;  1MM3 A;  5G4S A;  2D8S A;  5D1L B;  2CT2 A;  5EA1 A;  4CCG X;  4NQN A;  5EPB A;  1IYM A;  2YU4 A;  1VFY A;  4O7E A;  5E9V A;  1WEM A;  5E0R A;  3RPG B;  2LGG A;  3O7A A;  5FE5 A;  5A5N A;  4A9M A;  4O72 A;  4P5O B;  3UVX A;  4AKN A;  2E6S A;  2L85 A;  4IR6 A;  2M1R A;  3GV4 A;  5D3N A;  3S91 A;  4TU6 A;  1JM7 A;  3U5K A;  4MVT A;  5F1L A;  2H60 A;  5EWC A;  5B77 A;  2OSS A;  2YEL A;  4A9L A;  4WHW A;  5ENB A;  5FE1 A;  3HMH A;  3DQV R;  3SVG A;  4MR3 A;  2RI7 A;  5EIS A;  5AME A;  5B8D A;  4KV1 A;  1E6I A;  3JVK A;  5IGM A;  5DFB A;  2JRJ A;  2KWN A;  5I7X A;  4CL9 A;  3Q2E A;  2L84 A;  4TZ8 A;  4GNG A;  3S92 A;  4NR9 A;  5H1U A;  5ETD A;  3QZS A;  5HQ7 A;  5HRV A;  4BW3 A;  5ENG A;  4MR5 A;  2VNF A;  4UYF B;  2L43 A;  3Q2F A;  5B76 A;  4HXM A;  2D9E A;  3N9O A;  1DVP A;  4NUC A;  1VD4 A;  2LRI C;  4O74 A;  5LKX A;  3UVD A;  1G25 A;  3P1F A;  4TYL A;  3NXB A;  3SOW A;  5G0F A;  1X4U A;  2KGI A;  5E9K A;  2LGV A;  3GG3 A;  5DFC A;  5K29 A;  4IC2 A;  5D3J A;  4ZQL A;  2LV9 A;  4J0R A;  2C2V S;  3KV6 A;  4GNF A;  4LDF A;  4MEQ A;  4UP0 A;  4UIU A;  5F2P A;  5DLX A;  5I40 A;  5D1K B;  3V43 A;  3P5O A;  3LXJ A;  2MIQ A;  2QJ0 A;  2RFJ A;  2L80 A;  4LJN A;  4FJC A;  4AVX A;  2F42 A;  5CQ8 A;  4Z1Q A;  3UV2 A;  4B7Y C;  2DVS A;  2CSZ A;  4OGJ A;  4YAT A;  5ENH A;  3G0J A;  2NXB A;  3I3J A;  5D24 A;  5KH7 A;  4UIV A;  2HDP A;  2XB1 A;  4HBV A;  4TZ2 A;  3JVM A;  5DYU A;  5C13 A;  2DVQ A;  4TT6 A;  3MXF A;  5CRM A;  4N3W A;  5E7D A;  5HJC A;  2Y1N A;  3O35 A;  4HXK A;  4Q6F A;  4UYG A;  2C2L A;  2YSM A;  4LRG A;  5LKU A;  2FUI A;  4PPE A;  4YYN A;  2RSD A;  2KYU A;  2L5E A;  4HBW A;  1WES A;  2EA6 A;  5AD3 A;  4ZDT A;  5F60 A;  5EV9 A;  1WEO A;  5ACY A;  2BAY A;  2ECW A;  5I83 A;  4CUS A;  4YBT A;  5H85 A;  2D82 A;  5FH7 A;  3ZTG A;  5E9M A;  1WEQ A;  3L11 A;  3LQH A;  5CGP A;  3UV4 A;  5DW1 A;  4XY8 A;  5HRX A;  5IGN A;  5D3T A;  5FE3 A;  4BBQ A;  4KV4 A;  5FDZ A;  5BT4 A;  1F68 A;  3T7L A;  5D3S A;  4O7A A;  2CSY A;  4QR3 A;  4UYE A;  3N9L A;  4LYW A;  2KGG A;  4O7C A;  4A9J A;  2YEM A;  5DKC A;  5L96 A;  4IR3 A;  5CQ7 A;  4QNS A;  5LVR A;  2FUU A;  4QR5 A;  4O76 A;  4WIV A;  5LUU A;  3KV5 A;  1X4J A;  4IOR A;  3P1E A;  3PUQ A;  4WZ2 A;  1WFK A;  2YT5 A;  5TCM A;  4CFK A;  4LK9 A;  5LJ0 A;  4Y03 A;  4NQM A;  4FK5 A;  3MB4 A;  3T6R A;  4PY6 A;  3SVF A;  2YW8 A;  3N9Q A;  5CU8 A;  4YH3 A;  4A9F A;  5FH8 A;  4LAD B;  4C9Z A;  4I7C A;  4LKA A;  2YUR A;  4ZW1 A;  2VJE B;  3O70 A;  2VPB A;  5TAB A;  5C89 A;  2MT5 A;  4YAB A;  5C4Q A;  5COI A;  3N9P A;  4NUE A;  5D25 A;  1FP0 A;  2YHO A;  5DIN A;  5LKZ A;  5DFD A;  3U5M A;  4TQN A;  4YYD A;  5C87 A;  4UYF A;  1WEE A;  4UIT A;  4TT4 A;  5ENI A;  2YEK A;  2H0D A;  4QUU A;  3UVW A;  2KR4 A;  3EB6 A;  5KHM A;  5HM0 A;  4MR4 A;  5KTW A;  2L5U A;  4BW4 A;  4NYX A;  4E96 A;  5CQ4 A;  5II1 A;  5B75 A;  5AD2 A;  5A83 A;  2YQD A;  5A85 A;  1ZS5 A;  4XYA A;  4IR5 A;  5CUA A;  3LRQ A;  4DON A;  5EYA F;  4CA1 A;  2LDR A;  2RNX A;  4QEU A;  3O36 A;  3IU5 A;  4QEV A;  2MNZ A;  5I88 A;  3UVY A;  2YRE A;  2KIZ A;  1HYJ A;  4N4G A;  5I7Y A;  4NR7 A;  2H0D B;  5HQ6 A;  1F62 A;  4LR6 A;  5E9I A;  5FG5 A;  5DYX A;  5E3G A;  2VJF B;  5A5S A;  4NXJ A;  5JI8 A;  2YQM A;  2KE1 A;  4QUT A;  3LQI A;  5J3X A;  4Z6H A;  5F1H A;  5FE4 A;  2VP7 A;  2M85 A;  2R0V A;  4N4F A;  5D0C A;  2DVV A;  2LQ6 A;  4QF2 A;  3VK6 A;  2YW5 A;  5FE9 A;  4O71 A;  4YAX A;  4GPJ A;  4LZS A;  4J0S A;  4YAD A;  4MEO A;  4XUA A;  4F52 B;  4YH4 A;  4NUD A;  2L0B A;  2VJF A;  5L97 A;  4O7F A;  5HQ5 A;  2ECI A;  4HXR A;  2KFT A;  3HTK C;  5DYA A;  2GRC A;  1JM4 B;  2OUO A;  1Z6U A;  3MHH A;  5JG6 A;  4CFL A;  4LZR A;  2G43 A;  4A9I A;  3K2J A;  5G4R A;  3LJW A;  4CUT A;  4FIP A;  3ZVY A;  2MJV B;  1N72 A;  5B78 A;  4TTE A;  1XWH A;  4OUF A;  3SOX A;  5EGU A;  5CFW A;  5IBN A;  5E74 A;  3AAD A;  5DX4 A;  2YSJ A;  4YY4 A;  3N9M A;  4UIX A;  5DKD A;  5H1T A;  4PCE A;  5EWH A;  5F63 A;  3O33 A;  5B79 A;  5CS8 A;  4AYC B;  5A5R A;  4A9H A;  5ENE A;  4YBM A;  5BT3 A;  1Z2Q A;  5TBN A;  4J1P A;  5CUC A;  2QIC A;  4IC3 A;  3HCT A;  2N9G A;  5AMF A;  1V87 A;  4XY9 A;  4YY6 A;  1X4I A;  4NRC A;  3KNV A;  4HXP A;  5I89 A;  5J0D A;  4X3G A;  4O7B A;  4QC3 A;  2VJE A;  3MQM A;  2YYN A;  2RNY A;  5HEN A;  4NR4 A;  4BJX A;  1WIM A;  4PTB A;  2JMJ A;  1JM7 B;  2R10 A;  4O77 A;  4NR5 A;  5ENC A;  3LQJ A;  4OGI A;  5A5P A;  5HRW A;  3M63 A;  5ENF A;  5H1V A;  5C7N A;  4A9K A;  4HBY A;  5AIT A;  2IDA A;  5DKA A;  2EGP A;  3MB3 A;  4R2Y A;  2LSP B;  1WGM A;  2K16 A;  2RNW A;  3HMF A;  4A9O A;  3GL6 A;  5L99 A;  4MEN A;  5JWM A;  4WA6 A;  3C6W A;  4C67 A;  3RCW A;  2Y43 A;  4TS8 A;  4L7X A;  5CQA A;  5F5Z A;  5II2 A;  2LGK A;  2Y1M A;  4R7E A;  5CQ6 A;  3O37 A;  4QC1 A;  4QSR A;  2QIZ A;  4Q0O A;  5TDR A;  4YYM A;  5IGK A;  3U5J A;  1JOC A;  4LLB A;  4QZS A;  5DLZ A;  5HFR A;  2MUM A;  2NAA A;  4PCI A;  5L8U A;  5CY9 A;  5KH9 A;  2KRE A;  3P1C A;  4UYD A;  4X2I A;  4ZC9 A;  4QSU A;  5EWD A;  5I86 A;  3ZVZ B;  5EI4 A;  2MA6 A;  5EWV A;  1U6G B;  4QSV A;  5LVQ A;  4PKL A;  1CHC A;  5TB6 A;  5HCL A;  2E6R A;  5IG6 A;  1Z60 A;  2ECT A;  5CP5 A;  5LJ1 A;  3L1X A;  5TRB A;  1E4U A;  5FFV A;  5C85 A;  2YQL A;  4UP5 A;  5F61 A;  4GNE A;  4FLP A;  4UIY A;  4HBX A;  4WHU A;  5L8T A;  3ONI A;  4YK0 A;  4I7B A;  5EPS A;  4WZ0 A;  4CUQ A;  4A4B A;  4ALG A;  5G05 B;  1LDJ B;  2K1J A;  2K17 A;  4Z1S A;  5L98 A;  5C11 A;  2KU3 A;  4V3L C;  5KTU A;  4V3K C;  2CKL B;  2MA5 A;  5DY7 A;  1WEV A;  4N4I A;  4Z93 A;  5LCW B;  4N4H A;  1WEU A;  3RPG C;  2M6M A;  4ZUX U;  5D3L A;  2LXH C;  4QBM A;  4L58 A;  2YDW A;  4QSS A;  2MD8 C;  4YC9 A;  2MD7 B;  4BW1 A;  4LC2 A;  5FFW A;  3O34 A;  5F36 A;  2OO1 A;  2EOD A;  4AUQ B;  5E73 A;  2I7K A;  2UZG A;  5CZG A;  5KU3 A;  5ETB A;  4A49 A;  3HCS A;  1X0J A;  2E3K A;  5FFY A;  2MNY A;  2ECJ A;  4NYV A;  2LGL A;  2G45 A;  5FG6 A;  5CPE A;  5EP7 A;  3NG2 A;  5F25 A;  4B86 C;  5KO4 A;  5A5O A;  5I1Q A;  5FER A;  4TT2 A;  5D3P A;  2KWJ A; 
#chains in the Genus database with same CATH topology
 4NS5 A;  2LXP C;  4GND A;  4YYI A;  5EPR A;  4YYG A;  5D3H A;  4YYJ A;  5CUB A;  5FE8 A;  3E2D A;  1WEW A;  4HXN A;  4UIZ A;  3M62 A;  4CUP A;  3I2D A;  1WIL A;  5IGL A;  3O47 A;  2KTB B;  2DKW A;  5LKT A;  5FG4 A;  4NRA A;  4QST A;  4FO9 A;  3U5O A;  5EQ1 A;  4YBS A;  5H9M A;  4XUB A;  5C8G A;  2CKL A;  5FE2 A;  3U5N A;  4LYS A;  2G6Q A;  5DKH A;  4MEP A;  2E7O A;  4MR6 A;  5CRZ A;  5A5Q A;  5IID A;  3U5P A;  5DBM A;  4A0C D;  4J3I A;  1MM2 A;  5I3L A;  4NR6 A;  3AQA A;  2LN0 A;  2DAT A;  5FE7 A;  5LJ2 A;  3C5K A;  4GB0 A;  4NRB A;  3TLP A;  4QSP A;  5CQ5 A;  5FE6 A;  2DX8 A;  1N87 A;  3T9K A;  4A9E A;  3QZV A;  3MUL A;  3KQI A;  4UIW A;  2PNX A;  3D1D A;  3N9N A;  5D7X A;  2JMD A;  5FB0 A;  3IU6 A;  3RTR B;  1WEN A;  5G04 B;  5A7C A;  4IOO A;  5E3D A;  4A9N A;  3SVH A;  2G4A A;  5F62 A;  3ASL A;  2I8N A;  4W4U A;  5A82 A;  4KCX A;  4O75 A;  4QSQ A;  5D3R A;  4I7D A;  3G0L A;  4CUU A;  3MUK A;  2VPD A;  2ECG A;  1ZBD B;  4QQ4 A;  2RS9 B;  2DJA A;  1T1H A;  5CQT A;  2JMI A;  5CUG A;  4QB3 A;  2VPG A;  4QEW A;  2JM3 A;  4Z0R A;  5HLS A;  5CUE A;  5KTX A;  4IOQ A;  3QZT A;  2FSA A;  5BT5 A;  5HEL A;  3PUR A;  5EK9 A;  4S3O C;  2I50 A;  3SHB A;  4HXO A;  2EGM A;  4LZ2 A;  3FKM X;  5I80 A;  2M3H A;  3DWD A;  3HCU A;  4QSX A;  4UYH A;  5EU1 A;  1LDK C;  4TKP B;  5CTL A;  2YVR A;  5FE0 A;  1RMD A;  2PUY A;  5AIU A;  4F3I A;  4QSW A;  3MHS A;  1HYI A;  2OXQ C;  2KWK A;  3IHP A;  3ERR A;  3L1Z B;  5KH3 A;  5TDW A;  4ALH A;  4LYI A;  3P1D A;  3UV5 A;  2XEU A;  2R0S A;  4PS5 A;  4RVR A;  3ZPV E;  4HXL A;  5EWW A;  4Q0N A;  3EB5 A;  4O70 A;  2WP1 A;  4QY4 A;  1WUM A;  4QYL A;  1WEP A;  2ECV A;  3D7C A;  3ZYQ A;  2KWO A;  1VYX A;  1JSP B;  4O64 A;  3M99 A;  3ZNI A;  4F1P A;  2RO1 A;  2D8U A;  3JVL A;  4NYW A;  4R8P K;  3PHD A;  3DWY A;  5DYC A;  4NN2 A;  4QR4 A;  1K2F A;  5I29 A;  3LJU X;  2YHN A;  5EVA A;  3FL2 A;  5EIC A;  1WUG A;  1FBV A;  2HYE D;  4MSX A;  2E7N A;  5ENJ A;  4CLB A;  4NR8 A;  4AP4 A;  5CQ3 A;  5EM3 A;  3Q1D A;  3ZPV 1;  5FB1 A;  5HEM A;  4Z6I A;  3SOU A;  4UI9 B;  5FEY A;  2DWW A;  5CUD A;  2YYR A;  2L75 A;  3DAI A;  4O78 A;  4S3O B;  5F3A A;  2F6J A;  2FFW A;  3FM8 C;  4AYC A;  1WE9 A;  2VPE A;  2YUC A;  3UW9 A;  4HXS A;  3HME A;  1EQF A;  4TU4 A;  2EXU A;  5HFQ A;  5DW2 A;  2XP0 A;  2R0Y A;  4YYH A;  4YYK A;  5E9L A;  4XI1 A;  4IR4 A;  1BOR A;  4QF3 A;  2AN6 A;  3LVQ E;  5E9Y A;  2ECN A;  4QYD A;  5A81 A;  4BW2 A;  5D1M B;  4WZ3 B;  5FH6 A;  2ZET C;  5FBX A;  2K4D A;  5SVY A;  4BHW A;  2M13 A;  2WP2 A;  4CUR A;  5D26 A;  2DVR A;  3ZYU A;  3U5L A;  3DPL R;  4A4C A;  4C66 A;  3JVJ A;  2F6N A;  1MM3 A;  5G4S A;  2D8S A;  5D1L B;  2CT2 A;  5EA1 A;  4CCG X;  4NQN A;  5EPB A;  1IYM A;  2YU4 A;  3FEH A;  1VFY A;  4O7E A;  5E9V A;  1WEM A;  5E0R A;  3RPG B;  2LGG A;  3O7A A;  5FE5 A;  5A5N A;  4A9M A;  4O72 A;  4P5O B;  3UVX A;  4AKN A;  2E6S A;  2L85 A;  4IR6 A;  2M1R A;  3GV4 A;  5D3N A;  3S91 A;  4TU6 A;  1JM7 A;  3U5K A;  4MVT A;  5F1L A;  2H60 A;  5EWC A;  5B77 A;  4AI6 A;  2OSS A;  2YEL A;  4A9L A;  4WHW A;  5ENB A;  5FE1 A;  3HMH A;  3DQV R;  3SVG A;  4MR3 A;  2RI7 A;  5EIS A;  5AME A;  5B8D A;  4KV1 A;  1E6I A;  3JVK A;  5IGM A;  5DFB A;  2JRJ A;  2KWN A;  3DDT A;  5I7X A;  4CL9 A;  3Q2E A;  2L84 A;  4TZ8 A;  4GNG A;  3S92 A;  4NR9 A;  5H1U A;  5ETD A;  3QZS A;  5HQ7 A;  5HRV A;  4BW3 A;  3KDE C;  5ENG A;  4MR5 A;  2VNF A;  2CRR A;  4UYF B;  2L43 A;  3Q2F A;  5B76 A;  4HXM A;  2D9E A;  3N9O A;  1DVP A;  4NUC A;  1VD4 A;  2LRI C;  4O74 A;  5LKX A;  3UVD A;  1G25 A;  3P1F A;  4TYL A;  4O62 A;  3NXB A;  3SOW A;  5G0F A;  1X4U A;  2KGI A;  5E9K A;  2LGV A;  3GG3 A;  2OWA A;  5DFC A;  5K29 A;  4IC2 A;  5D3J A;  4ZQL A;  2LV9 A;  4J0R A;  2C2V S;  2P57 A;  3KV6 A;  4GNF A;  4LDF A;  3VKH A;  5SVI B;  4MEQ A;  4UP0 A;  1DCQ A;  4UIU A;  5F2P A;  5DLX A;  5I40 A;  5D1K B;  3V43 A;  3P5O A;  3LXJ A;  2MIQ A;  2QJ0 A;  2RFJ A;  2L80 A;  4LJN A;  4FJC A;  4AVX A;  2F42 A;  5CQ8 A;  4Z1Q A;  3UV2 A;  4B7Y C;  2DVS A;  2CSZ A;  3JUE A;  4OGJ A;  4YAT A;  5ENH A;  3G0J A;  2NXB A;  3I3J A;  5D24 A;  5KH7 A;  4UIV A;  2HDP A;  2XB1 A;  4HBV A;  4TZ2 A;  3JVM A;  5DYU A;  5C13 A;  2DVQ A;  4TT6 A;  3MXF A;  5CRM A;  4N3W A;  5E7D A;  5HJC A;  2Y1N A;  3O35 A;  4HXK A;  4Q6F A;  4UYG A;  2C2L A;  2YSM A;  4LRG A;  5LKU A;  2FUI A;  4PPE A;  4YYN A;  2RSD A;  2KYU A;  2L5E A;  4HBW A;  1WES A;  2EA6 A;  5AD3 A;  4ZDT A;  5F60 A;  3FAN A;  5EV9 A;  1WEO A;  5ACY A;  2BAY A;  2ECW A;  5I83 A;  4CUS A;  4YBT A;  5H85 A;  2D82 A;  5FH7 A;  4AKI A;  3ZTG A;  5E9M A;  1WEQ A;  3L11 A;  3LQH A;  5CGP A;  3UV4 A;  5DW1 A;  4XY8 A;  5HRX A;  5IGN A;  5D3T A;  5FE3 A;  4BBQ A;  4KV4 A;  1PUO A;  5FDZ A;  5BT4 A;  1F68 A;  3T7L A;  5D3S A;  4O7A A;  2CSY A;  4QR3 A;  4UYE A;  3N9L A;  4LYW A;  2KGG A;  4O7C A;  4A9J A;  3MDB C;  2YEM A;  5DKC A;  5L96 A;  4IR3 A;  5CQ7 A;  4QNS A;  5LVR A;  2FUU A;  4QR5 A;  4O76 A;  4WIV A;  5LUU A;  3KV5 A;  1X4J A;  4IOR A;  3P1E A;  3PUQ A;  4WZ2 A;  1WFK A;  2YT5 A;  5TCM A;  4CFK A;  4LK9 A;  5LJ0 A;  4Y03 A;  4NQM A;  4FK5 A;  3MB4 A;  3T6R A;  4PY6 A;  3SVF A;  2YW8 A;  4OGC A;  3N9Q A;  5CU8 A;  4YH3 A;  4A9F A;  5FH8 A;  4LAD B;  4C9Z A;  4I7C A;  4LKA A;  2YUR A;  4ZW1 A;  2VJE B;  3O70 A;  2VPB A;  5TAB A;  5C89 A;  2XOY A;  2MT5 A;  4YAB A;  5C4Q A;  4H9D A;  5COI A;  3N9P A;  4NUE A;  5D25 A;  1FP0 A;  2YHO A;  5DIN A;  5LKZ A;  5DFD A;  3U5M A;  4TQN A;  4YYD A;  1ZKR A;  4UYF A;  5C87 A;  4UIT A;  4TT4 A;  5ENI A;  2YEK A;  1WEE A;  4QUU A;  3UVW A;  2CRW A;  2H0D A;  2KR4 A;  5KHM A;  5HM0 A;  3EB6 A;  4MR4 A;  5KTW A;  4AKG A;  2L5U A;  4BW4 A;  4NYX A;  4E96 A;  5CQ4 A;  5II1 A;  5B75 A;  5AD2 A;  5A83 A;  2YQD A;  5A85 A;  1ZS5 A;  4XYA A;  4IR5 A;  5CUA A;  3LRQ A;  4DON A;  5EYA F;  4CA1 A;  2LDR A;  2EJN A;  2RNX A;  4QEU A;  3O36 A;  2MKE A;  3IU5 A;  4QEV A;  2CON A;  2MNZ A;  5I88 A;  3UVY A;  2YRE A;  2KIZ A;  1HYJ A;  4N4G A;  5I7Y A;  4NR7 A;  2H0D B;  5HQ6 A;  1F62 A;  2KKY A;  4LR6 A;  5E9I A;  5FG5 A;  5DYX A;  5E3G A;  2VJF B;  5A5S A;  4NXJ A;  5JI8 A;  2YQM A;  2KE1 A;  5K3Q A;  4QUT A;  3LQI A;  5J3X A;  4Z6H A;  5F1H A;  5FE4 A;  2FD4 A;  2VP7 A;  2M85 A;  2R0V A;  4N4F A;  5D0C A;  2DVV A;  2LQ6 A;  2XOZ A;  4QF2 A;  3VK6 A;  2YW5 A;  3VKG A;  3D1B A;  5FE9 A;  4O71 A;  4YAX A;  4GPJ A;  4LZS A;  4J0S A;  4YAD A;  4MEO A;  4XUA A;  4F52 B;  4YH4 A;  2B0O E;  4NUD A;  2L0B A;  2CSV A;  2VJF A;  5L97 A;  4O7F A;  5HQ5 A;  2ECI A;  3FJU B;  4HXR A;  2KFT A;  3HTK C;  5DYA A;  2GRC A;  1JM4 B;  2OUO A;  4AKH A;  1Z6U A;  3MHH A;  5JG6 A;  4CFL A;  4LZR A;  2G43 A;  4A9I A;  3K2J A;  5G4R A;  3LJW A;  4CUT A;  4FIP A;  3ZVY A;  2MJV B;  1N72 A;  5B78 A;  4TTE A;  1XWH A;  4OUF A;  3SOX A;  5EGU A;  5CFW A;  5IBN A;  5E74 A;  3AAD A;  5DX4 A;  2YSJ A;  3M7K A;  4YY4 A;  3N9M A;  4UIX A;  5DKD A;  5H1T A;  4PCE A;  5EWH A;  5F63 A;  2XOC A;  3O33 A;  5B79 A;  5CS8 A;  4AYC B;  5A5R A;  4A9H A;  5ENE A;  4YBM A;  5BT3 A;  1Z2Q A;  5TBN A;  4J1P A;  5CUC A;  2QIC A;  4IC3 A;  3HCT A;  2N9G A;  5AMF A;  1V87 A;  4XY9 A;  4YY6 A;  1X4I A;  4NRC A;  3KNV A;  4HXP A;  5I89 A;  5J0D A;  4X3G A;  4O7B A;  4QC3 A;  2VJE A;  3MQM A;  2YYN A;  2RNY A;  5HEN A;  4NR4 A;  4BJX A;  1WIM A;  4PTB A;  2LAU A;  2JMJ A;  1JM7 B;  2R10 A;  4O77 A;  4NR5 A;  5ENC A;  3LQJ A;  4OGI A;  5A5P A;  5HRW A;  3M63 A;  5ENF A;  5H1V A;  5C7N A;  4A9K A;  4HBY A;  5AIT A;  2IDA A;  5DKA A;  4OGE A;  2EGP A;  3MB3 A;  4R2Y A;  2LSP B;  1WGM A;  2K16 A;  2RNW A;  3HMF A;  4A9O A;  3GL6 A;  5L99 A;  4MEN A;  5JWM A;  4WA6 A;  2RR4 A;  3C6W A;  4C67 A;  3RCW A;  2Y43 A;  4TS8 A;  4L7X A;  1MBM A;  5CQA A;  5F5Z A;  5II2 A;  2LGK A;  2Y1M A;  3FAO A;  4R7E A;  5SVI A;  5CQ6 A;  3O37 A;  4QC1 A;  4QSR A;  2QIZ A;  4Q0O A;  2L7P A;  5TDR A;  4YYM A;  5IGK A;  3LVR E;  3U5J A;  1JOC A;  5SVX A;  4LLB A;  4QZS A;  5DLZ A;  5HFR A;  2MUM A;  2NAA A;  4PCI A;  5L8U A;  5CY9 A;  5KH9 A;  2JUN A;  2KKX A;  3P1C A;  4UYD A;  4X2I A;  4ZC9 A;  2KRE A;  4QSU A;  5EWD A;  5I86 A;  3ZVZ B;  5EI4 A;  2MA6 A;  5EWV A;  1U6G B;  4QSV A;  5LVQ A;  4PKL A;  1CHC A;  3SUB A;  5TB6 A;  5HCL A;  2E6R A;  5IG6 A;  1Z60 A;  2ECT A;  5CP5 A;  5LJ1 A;  3L1X A;  5TRB A;  1E4U A;  2DSM A;  5FFV A;  5C85 A;  2YQL A;  4UP5 A;  5F61 A;  4GNE A;  4FLP A;  4UIY A;  4HBX A;  4WHU A;  5L8T A;  3ONI A;  4YK0 A;  4I7B A;  5EPS A;  4WZ0 A;  4CUQ A;  4A4B A;  4ALG A;  5G05 B;  1LDJ B;  2K1J A;  2K17 A;  4Z1S A;  5L98 A;  3H7H A;  5C11 A;  2KU3 A;  4V3L C;  5KTU A;  4V3K C;  2CKL B;  2MA5 A;  5DY7 A;  1WEV A;  4N4I A;  4Z93 A;  5LCW B;  4N4H A;  1WEU A;  3RPG C;  2M6M A;  4ZUX U;  5D3L A;  2LXH C;  4QBM A;  2IQJ A;  4L58 A;  2YDW A;  4QSS A;  2MD8 C;  4YC9 A;  2MD7 B;  4BW1 A;  3LDY A;  4LC2 A;  5FFW A;  3O34 A;  5F36 A;  2OO1 A;  2E61 A;  4Z0O A;  2EOD A;  4AUQ B;  5E73 A;  2I7K A;  2UZG A;  3PLW A;  5CZG A;  5KU3 A;  5ETB A;  4A49 A;  3HCS A;  1X0J A;  2E3K A;  5FFY A;  2MNY A;  2ECJ A;  4NYV A;  2LGL A;  2G45 A;  5FG6 A;  5CPE A;  5EP7 A;  3NG2 A;  5F25 A;  4B86 C;  5KO4 A;  5A5O A;  5I1Q A;  5FER A;  4TT2 A;  5D3P A;  2KWJ A; 
#chains in the Genus database with same CATH homology
 4NS5 A;  2LXP C;  4GND A;  4YYI A;  5EPR A;  4YYG A;  5D3H A;  4YYJ A;  5CUB A;  5FE8 A;  1WEW A;  4HXN A;  4UIZ A;  3M62 A;  4CUP A;  3I2D A;  1WIL A;  5IGL A;  2KTB B;  2DKW A;  5LKT A;  5FG4 A;  4NRA A;  4QST A;  4FO9 A;  3U5O A;  5EQ1 A;  4YBS A;  5H9M A;  4XUB A;  5C8G A;  2CKL A;  5FE2 A;  3U5N A;  4LYS A;  2G6Q A;  5DKH A;  4MEP A;  2E7O A;  4MR6 A;  5CRZ A;  5A5Q A;  5IID A;  3U5P A;  5DBM A;  4A0C D;  4J3I A;  1MM2 A;  5I3L A;  4NR6 A;  3AQA A;  2LN0 A;  2DAT A;  5FE7 A;  5LJ2 A;  3C5K A;  4GB0 A;  4NRB A;  3TLP A;  4QSP A;  5CQ5 A;  5FE6 A;  2DX8 A;  1N87 A;  4A9E A;  3QZV A;  3MUL A;  3KQI A;  4UIW A;  2PNX A;  3N9N A;  5D7X A;  2JMD A;  5FB0 A;  3IU6 A;  3RTR B;  1WEN A;  5G04 B;  5A7C A;  4IOO A;  5E3D A;  4A9N A;  3SVH A;  2G4A A;  5F62 A;  3ASL A;  2I8N A;  4W4U A;  5A82 A;  4KCX A;  4O75 A;  4QSQ A;  5D3R A;  4I7D A;  3G0L A;  4CUU A;  3MUK A;  2VPD A;  2ECG A;  1ZBD B;  2RS9 B;  1T1H A;  5CQT A;  2JMI A;  5CUG A;  4QB3 A;  2VPG A;  4QEW A;  5HLS A;  5CUE A;  5KTX A;  4IOQ A;  3QZT A;  2FSA A;  5BT5 A;  5HEL A;  3PUR A;  5EK9 A;  4S3O C;  2I50 A;  3SHB A;  4HXO A;  3HCU A;  4LZ2 A;  3FKM X;  5I80 A;  2M3H A;  4QSX A;  4UYH A;  5EU1 A;  1LDK C;  4TKP B;  5CTL A;  5FE0 A;  1RMD A;  2PUY A;  5AIU A;  4F3I A;  4QSW A;  3MHS A;  1HYI A;  2OXQ C;  2KWK A;  3IHP A;  3L1Z B;  5KH3 A;  5TDW A;  4ALH A;  4LYI A;  3P1D A;  3UV5 A;  2XEU A;  2R0S A;  4PS5 A;  4RVR A;  3ZPV E;  4HXL A;  5EWW A;  4Q0N A;  3EB5 A;  4O70 A;  2WP1 A;  4QY4 A;  1WUM A;  4QYL A;  1WEP A;  2ECV A;  3D7C A;  3ZYQ A;  2KWO A;  1VYX A;  1JSP B;  4O64 A;  3M99 A;  3ZNI A;  2RO1 A;  3JVL A;  4NYW A;  4R8P K;  3PHD A;  3DWY A;  5DYC A;  4NN2 A;  4QR4 A;  1K2F A;  5I29 A;  2YHN A;  5EVA A;  3FL2 A;  5EIC A;  1WUG A;  1FBV A;  2HYE D;  4MSX A;  2E7N A;  5ENJ A;  4CLB A;  4NR8 A;  4AP4 A;  5CQ3 A;  5EM3 A;  3ZPV 1;  5FB1 A;  5HEM A;  4Z6I A;  3SOU A;  4UI9 B;  5FEY A;  2DWW A;  5CUD A;  2YYR A;  2L75 A;  3DAI A;  4O78 A;  4S3O B;  5F3A A;  2F6J A;  4AYC A;  1WE9 A;  2VPE A;  2YUC A;  3UW9 A;  4HXS A;  3HME A;  1EQF A;  4TU4 A;  5HFQ A;  5DW2 A;  2R0Y A;  4YYH A;  4YYK A;  5E9L A;  4XI1 A;  4IR4 A;  1BOR A;  4QF3 A;  2AN6 A;  5E9Y A;  2ECN A;  4QYD A;  5A81 A;  4BW2 A;  5D1M B;  4WZ3 B;  5FH6 A;  2ZET C;  5FBX A;  2K4D A;  4BHW A;  2WP2 A;  4CUR A;  5D26 A;  2DVR A;  3ZYU A;  3U5L A;  3DPL R;  4A4C A;  4C66 A;  3JVJ A;  2F6N A;  1MM3 A;  5G4S A;  2D8S A;  5D1L B;  2CT2 A;  5EA1 A;  4CCG X;  4NQN A;  5EPB A;  1IYM A;  2YU4 A;  1VFY A;  4O7E A;  5E9V A;  1WEM A;  5E0R A;  3RPG B;  2LGG A;  3O7A A;  5FE5 A;  5A5N A;  4A9M A;  4O72 A;  4P5O B;  3UVX A;  4AKN A;  2E6S A;  2L85 A;  4IR6 A;  2M1R A;  3GV4 A;  5D3N A;  3S91 A;  4TU6 A;  1JM7 A;  3U5K A;  4MVT A;  5F1L A;  2H60 A;  5EWC A;  5B77 A;  2OSS A;  2YEL A;  4A9L A;  4WHW A;  5ENB A;  5FE1 A;  3HMH A;  3DQV R;  3SVG A;  4MR3 A;  2RI7 A;  5EIS A;  5AME A;  5B8D A;  4KV1 A;  1E6I A;  3JVK A;  5IGM A;  5DFB A;  2JRJ A;  2KWN A;  5I7X A;  4CL9 A;  3Q2E A;  2L84 A;  4TZ8 A;  4GNG A;  3S92 A;  4NR9 A;  5H1U A;  5ETD A;  3QZS A;  5HQ7 A;  5HRV A;  4BW3 A;  5ENG A;  4MR5 A;  2VNF A;  4UYF B;  2L43 A;  3Q2F A;  5B76 A;  4HXM A;  2D9E A;  3N9O A;  1DVP A;  4NUC A;  1VD4 A;  2LRI C;  4O74 A;  5LKX A;  3UVD A;  1G25 A;  3P1F A;  4TYL A;  3NXB A;  3SOW A;  5G0F A;  1X4U A;  2KGI A;  5E9K A;  2LGV A;  3GG3 A;  5DFC A;  5K29 A;  4IC2 A;  5D3J A;  4ZQL A;  2LV9 A;  4J0R A;  2C2V S;  3KV6 A;  4GNF A;  4LDF A;  4MEQ A;  4UP0 A;  4UIU A;  5F2P A;  5DLX A;  5I40 A;  5D1K B;  3V43 A;  3P5O A;  3LXJ A;  2MIQ A;  2QJ0 A;  2RFJ A;  2L80 A;  4LJN A;  4FJC A;  4AVX A;  2F42 A;  5CQ8 A;  4Z1Q A;  3UV2 A;  4B7Y C;  2DVS A;  2CSZ A;  4OGJ A;  4YAT A;  5ENH A;  3G0J A;  2NXB A;  3I3J A;  5D24 A;  5KH7 A;  4UIV A;  2HDP A;  2XB1 A;  4HBV A;  4TZ2 A;  3JVM A;  5DYU A;  5C13 A;  2DVQ A;  4TT6 A;  3MXF A;  5CRM A;  4N3W A;  5E7D A;  5HJC A;  2Y1N A;  3O35 A;  4HXK A;  4Q6F A;  4UYG A;  2C2L A;  2YSM A;  4LRG A;  5LKU A;  2FUI A;  4PPE A;  4YYN A;  2RSD A;  2KYU A;  2L5E A;  4HBW A;  1WES A;  2EA6 A;  5AD3 A;  4ZDT A;  5F60 A;  5EV9 A;  1WEO A;  5ACY A;  2BAY A;  2ECW A;  5I83 A;  4CUS A;  4YBT A;  5H85 A;  2D82 A;  5FH7 A;  3ZTG A;  5E9M A;  1WEQ A;  3L11 A;  3LQH A;  5CGP A;  3UV4 A;  5DW1 A;  4XY8 A;  5HRX A;  5IGN A;  5D3T A;  5FE3 A;  4BBQ A;  4KV4 A;  5FDZ A;  5BT4 A;  1F68 A;  3T7L A;  5D3S A;  4O7A A;  2CSY A;  4QR3 A;  4UYE A;  3N9L A;  4LYW A;  2KGG A;  4O7C A;  4A9J A;  2YEM A;  5DKC A;  5L96 A;  4IR3 A;  5CQ7 A;  4QNS A;  5LVR A;  2FUU A;  4QR5 A;  4O76 A;  4WIV A;  5LUU A;  3KV5 A;  1X4J A;  4IOR A;  3P1E A;  3PUQ A;  4WZ2 A;  1WFK A;  2YT5 A;  5TCM A;  4CFK A;  4LK9 A;  5LJ0 A;  4Y03 A;  4NQM A;  4FK5 A;  3MB4 A;  3T6R A;  4PY6 A;  3SVF A;  2YW8 A;  3N9Q A;  5CU8 A;  4YH3 A;  4A9F A;  5FH8 A;  4LAD B;  4C9Z A;  4I7C A;  4LKA A;  2YUR A;  4ZW1 A;  2VJE B;  3O70 A;  2VPB A;  5TAB A;  5C89 A;  2MT5 A;  4YAB A;  5C4Q A;  5COI A;  3N9P A;  4NUE A;  5D25 A;  1FP0 A;  2YHO A;  5DIN A;  5LKZ A;  5DFD A;  3U5M A;  4TQN A;  4YYD A;  5C87 A;  4UYF A;  1WEE A;  4UIT A;  4TT4 A;  5ENI A;  2YEK A;  2H0D A;  4QUU A;  3UVW A;  2KR4 A;  3EB6 A;  5KHM A;  5HM0 A;  4MR4 A;  5KTW A;  2L5U A;  4BW4 A;  4NYX A;  4E96 A;  5CQ4 A;  5II1 A;  5B75 A;  5AD2 A;  5A83 A;  2YQD A;  5A85 A;  1ZS5 A;  4XYA A;  4IR5 A;  5CUA A;  3LRQ A;  4DON A;  5EYA F;  4CA1 A;  2LDR A;  2RNX A;  4QEU A;  3O36 A;  3IU5 A;  4QEV A;  2MNZ A;  5I88 A;  3UVY A;  2YRE A;  2KIZ A;  1HYJ A;  4N4G A;  5I7Y A;  4NR7 A;  2H0D B;  5HQ6 A;  1F62 A;  4LR6 A;  5E9I A;  5FG5 A;  5DYX A;  5E3G A;  2VJF B;  5A5S A;  4NXJ A;  5JI8 A;  2YQM A;  2KE1 A;  4QUT A;  3LQI A;  5J3X A;  4Z6H A;  5F1H A;  5FE4 A;  2VP7 A;  2M85 A;  2R0V A;  4N4F A;  5D0C A;  2DVV A;  2LQ6 A;  4QF2 A;  3VK6 A;  2YW5 A;  5FE9 A;  4O71 A;  4YAX A;  4GPJ A;  4LZS A;  4J0S A;  4YAD A;  4MEO A;  4XUA A;  4F52 B;  4YH4 A;  4NUD A;  2L0B A;  2VJF A;  5L97 A;  4O7F A;  5HQ5 A;  2ECI A;  4HXR A;  2KFT A;  3HTK C;  5DYA A;  2GRC A;  1JM4 B;  2OUO A;  1Z6U A;  3MHH A;  5JG6 A;  4CFL A;  4LZR A;  2G43 A;  4A9I A;  3K2J A;  5G4R A;  3LJW A;  4CUT A;  4FIP A;  3ZVY A;  2MJV B;  1N72 A;  5B78 A;  4TTE A;  1XWH A;  4OUF A;  3SOX A;  5EGU A;  5CFW A;  5IBN A;  5E74 A;  3AAD A;  5DX4 A;  2YSJ A;  4YY4 A;  3N9M A;  4UIX A;  5DKD A;  5H1T A;  4PCE A;  5EWH A;  5F63 A;  3O33 A;  5B79 A;  5CS8 A;  4AYC B;  5A5R A;  4A9H A;  5ENE A;  4YBM A;  5BT3 A;  1Z2Q A;  5TBN A;  4J1P A;  5CUC A;  2QIC A;  4IC3 A;  3HCT A;  2N9G A;  5AMF A;  1V87 A;  4XY9 A;  4YY6 A;  1X4I A;  4NRC A;  3KNV A;  4HXP A;  5I89 A;  5J0D A;  4X3G A;  4O7B A;  4QC3 A;  2VJE A;  3MQM A;  2YYN A;  2RNY A;  5HEN A;  4NR4 A;  4BJX A;  1WIM A;  4PTB A;  2JMJ A;  1JM7 B;  2R10 A;  4O77 A;  4NR5 A;  5ENC A;  3LQJ A;  4OGI A;  5A5P A;  5HRW A;  3M63 A;  5ENF A;  5H1V A;  5C7N A;  4A9K A;  4HBY A;  5AIT A;  2IDA A;  5DKA A;  2EGP A;  3MB3 A;  4R2Y A;  2LSP B;  1WGM A;  2K16 A;  2RNW A;  3HMF A;  4A9O A;  3GL6 A;  5L99 A;  4MEN A;  5JWM A;  4WA6 A;  3C6W A;  4C67 A;  3RCW A;  2Y43 A;  4TS8 A;  4L7X A;  5CQA A;  5F5Z A;  5II2 A;  2LGK A;  2Y1M A;  4R7E A;  5CQ6 A;  3O37 A;  4QC1 A;  4QSR A;  2QIZ A;  4Q0O A;  5TDR A;  4YYM A;  5IGK A;  3U5J A;  1JOC A;  4LLB A;  4QZS A;  5DLZ A;  5HFR A;  2MUM A;  2NAA A;  4PCI A;  5L8U A;  5CY9 A;  5KH9 A;  2KRE A;  3P1C A;  4UYD A;  4X2I A;  4ZC9 A;  4QSU A;  5EWD A;  5I86 A;  3ZVZ B;  5EI4 A;  2MA6 A;  5EWV A;  1U6G B;  4QSV A;  5LVQ A;  4PKL A;  1CHC A;  5TB6 A;  5HCL A;  2E6R A;  5IG6 A;  1Z60 A;  2ECT A;  5CP5 A;  5LJ1 A;  3L1X A;  5TRB A;  1E4U A;  5FFV A;  5C85 A;  2YQL A;  4UP5 A;  5F61 A;  4GNE A;  4FLP A;  4UIY A;  4HBX A;  4WHU A;  5L8T A;  3ONI A;  4YK0 A;  4I7B A;  5EPS A;  4WZ0 A;  4CUQ A;  4A4B A;  4ALG A;  5G05 B;  1LDJ B;  2K1J A;  2K17 A;  4Z1S A;  5L98 A;  5C11 A;  2KU3 A;  4V3L C;  5KTU A;  4V3K C;  2CKL B;  2MA5 A;  5DY7 A;  1WEV A;  4N4I A;  4Z93 A;  5LCW B;  4N4H A;  1WEU A;  3RPG C;  2M6M A;  4ZUX U;  5D3L A;  2LXH C;  4QBM A;  4L58 A;  2YDW A;  4QSS A;  2MD8 C;  4YC9 A;  2MD7 B;  4BW1 A;  4LC2 A;  5FFW A;  3O34 A;  5F36 A;  2OO1 A;  2EOD A;  4AUQ B;  5E73 A;  2I7K A;  2UZG A;  5CZG A;  5KU3 A;  5ETB A;  4A49 A;  3HCS A;  1X0J A;  2E3K A;  5FFY A;  2MNY A;  2ECJ A;  4NYV A;  2LGL A;  2G45 A;  5FG6 A;  5CPE A;  5EP7 A;  3NG2 A;  5F25 A;  4B86 C;  5KO4 A;  5A5O A;  5I1Q A;  5FER A;  4TT2 A;  5D3P A;  2KWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...