4YABA

Crystal structure of trim24 phd-bromodomain complexed with 1-methyl-5-(2-methyl-1 3-thiazol-4-yl)-2 3-dihydro-1h-indol-2-one (1)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
178
Chain Sequence
SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 54
structure length 178
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yabA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yabA01
5E9YA 3GV4A 4NR6A 5CQ3A 2N9GA 4QR3A 4AYCB 3I3JA 2E7NA 2VPDA 2M1RA 3ZVZB 4O76A 4ZC9A 1E4UA 5BT4A 1WESA 3UVYA 2YQMA 5FE3A 3O36A 4QB3A 2EGPA 4CL9A 4QYDA 4A9NA 1WEPA 2ECIA 3HCUA 3SOXA 5A83A 5D3TA 4Q6FA 4NR9A 5HELA 5I7XA 5II1A 4LKAA 2VPGA 5LJ2A 2YHOA 2KWOA 5FE9A 4N4HA 2QICA 4PCIA 4A9LA 5LKZA 4O7BA 2E6SA 4IC3A 2RI7A 4AKNA 3PURA 1VYXA 5D0CA 4X2IA 1WFKA 4CUTA 5ACYA 4HBYA 2RNYA 5F25A 4HXNA 4J3IA 4UP0A 4LC2A 1WEMA 1HYJA 4O75A 4Q0OA 5F63A 3U5NA 5C89A 3MULA 4L58A 3ZYUA 4CUQA 5EICA 5CQ6A 3T6RA 4HXRA 4A49A 5C8GA 2KWJA 5F1HA 2R0SA 1WIMA 4HBWA 2VPEA 5FE1A 4O78A 4TZ2A 4A9IA 2FSAA 4LK9A 5FE5A 4R8PK 2DATA 5C4QA 2JMIA 2YELA 5FB0A 5EK9A 3O33A 2VJFA 5DKDA 1LDKC 4PS5A 2CSYA 5EPBA 5TB6A 2E3KA 4HXPA 5I83A 2RNXA 2KYUA 3P1CA 5CQAA 2YU4A 2YUCA 5FE8A 4MEQA 4LLBA 4GNGA 5D3HA 5L8UA 4TZ8A 4YABA 4N4FA 5E3DA 3TLPA 3KQIA 5EWHA 2EA6A 4PTBA 3AADA 2OXQC 5HCLA 4NUCA 4BW1A 5HQ5A 5AIUA 1WEQA 3SVFA 3I2DA 1X4IA 3DWYA 3P5OA 4MENA 4A9OA 1X4UA 2UZGA 1WUMA 2IDAA 4IOQA 4ZQLA 2VJFB 5B75A 2MNYA 5A5RA 5ETDA 4QR5A 5HFQA 5ENEA 3JVLA 3N9LA 2ECJA 4ZUXU 3G0LA 5I40A 4NN2A 2R0YA 3O37A 5DKCA 4TT4A 2OUOA 3P1DA 4TT2A 5E9KA 2DX8A 2YYRA 4QSTA 2L5UA 4QC3A 4O7AA 3V43A 3PHDA 2YT5A 3MHHA 2H60A 5D1KB 4XUAA 3U5KA 4LYWA 4IR6A 1EQFA 4NYVA 4UP5A 2E6RA 5D26A 5ENFA 4YYGA 5C7NA 4UIYA 5D3NA 4A9KA 3DQVR 3SHBA 1WEVA 4A0CD 4PPEA 4YBSA 5B78A 5KH7A 5EYAF 5IGKA 2D8SA 4QEVA 5I1QA 5A5NA 5BT5A 5TBNA 1RMDA 4QNSA 3PUQA 3EB5A 4MSXA 5KH9A 5HM0A 2LDRA 3U5LA 3M62A 3ZPVE 5FG5A 4UIUA 2YREA 4O64A 4QSVA 5DKHA 3Q2FA 4E96A 2ECTA 1Z60A 3MQMA 4XYAA 4UYGA 3LXJA 4TQNA 4NUDA 5B8DA 5FFYA 2G4AA 1JM4B 4QSUA 5ENGA 5FG4A 2D82A 2LXHC 5D24A 5JG6A 5H1VA 4CUPA 1U6GB 3HMEA 4O72A 4MVTA 3SOUA 5C13A 5EWDA 3ASLA 2M6MA 5CUBA 4MEPA 1N87A 2MJVB 1Z6UA 5E9MA 2RNWA 5CTLA 5IG6A 2JMJA 5LUUA 5KTXA 4NYWA 3IU6A 3HCSA 5J0DA 4NR8A 5AMEA 1JM7B 2L75A 4LADB 4QYLA 3LQIA 5F36A 4FIPA 4YH3A 4YYHA 5K29A 2H0DA 4HBVA 4UYHA 5IGLA 2MT5A 2E7OA 2L85A 3MB3A 4CUUA 2YDWA 4LDFA 4J0SA 1WEUA 4R7EA 5FE2A 2VJEA 3UVWA 5F1LA 3UVXA 4QY4A 1HYIA 5DYAA 2L84A 5D3PA 4S3OC 5FBXA 4TKPB 5E0RA 2YYNA 4O70A 2YSJA 2LRIC 5HENA 4YY4A 4AUQB 5LVRA 1F62A 4J1PA 4NXJA 2KTBB 5DY7A 2RO1A 4O71A 5L96A 4UIVA 2G45A 2MIQA 2H0DB 3O7AA 4P5OB 4OGJA 2L5EA 1JOCA 4OUFA 5HJCA 4CA1A 4YH4A 2YEMA 4YYNA 5CUGA 2K4DA 4A9FA 3KNVA 3HCTA 2VJEB 4Z6IA 4F52B 5HLSA 4XY9A 5EV9A 3FL2A 2I7KA 5A5OA 5L98A 1IYMA 5CQ8A 3GL6A 5FFVA 4NRBA 4BBQA 5H9MA 4YYDA 5F3AA 5HQ6A 2KWKA 2YQDA 4O7CA 1BORA 5DBMA 5HRXA 4LZ2A 2LXPC 4YC9A 3O34A 5E7DA 2VNFA 4A9EA 2RFJA 2YW5A 5I80A 4QUUA 5ENBA 4XY8A 2WP1A 1E6IA 4DONA 4N4IA 4FO9A 5B77A 2LQ6A 5LJ0A 1K2FA 4LZRA 5FE4A 1LDJB 3KV6A 2M85A 2MUMA 5ENIA 3HMHA 4NYXA 5ENJA 3JVKA 4Z6HA 4TS8A 4V3LC 4X3GA 5ETBA 2GRCA 2RS9B 4A9HA 4ALGA 5FE7A 5TRBA 4IOOA 4S3OB 4PY6A 2L80A 5HRWA 5EWVA 5CUEA 3M63A 4QSRA 5EWCA 1T1HA 2C2VS 2YW8A 4N4GA 5CP5A 5I88A 2YURA 3DPLR 4HXMA 2DKWA 5IIDA 1VD4A 2ZETC 3QZSA 5AMFA 1WUGA 4YK0A 5J3XA 4UIZA 5A5QA 5CQ4A 5DYCA 3VK6A 1WEEA 4IR4A 2R0VA 2YHNA 3UV2A 1VFYA 5EA1A 4WZ0A 4WZ3B 5L99A 2VPBA 5L8TA 4FLPA 5KU3A 5II2A 5A81A 5LCWB 4YADA 1WEWA 3LJWA 5I86A 5DW2A 5COIA 2C2LA 4AP4A 4BW2A 5CUCA 5F62A 3U5PA 5LKTA 4MR5A 5TCMA 3DAIA 4QSPA 3AQAA 2LGVA 4C67A 1MM2A 5JWMA 3RCWA 4YYMA 5E73A 4HBXA 3N9QA 5AITA 4FJCA 4C66A 5D3SA 2DVVA 4Y03A 5EI4A 2ECNA 4TTEA 3S91A 4I7DA 2LGLA 4TT6A 2G43A 3N9NA 5FB1A 4QSQA 4CFLA 2I50A 3K2JA 4O7EA 3HMFA 2LSPB 4NQMA 5CZGA 4ALHA 4MR3A 4QZSA 2Y1MA 2L0BA 3M99A 4A4CA 5DYUA 1JM7A 3P1FA 2OSSA 5EM3A 4HXOA 4WIVA 2PUYA 4HXSA 4TU4A 3ZNIA 4LYIA 5F2PA 4YAXA 4QR4A 5EQ1A 2KIZA 5CQ7A 2F42A 5DLXA 4QSSA 5TDWA 4LR6A 2ECGA 4HXLA 5F60A 3GG3A 5BT3A 5AD2A 4UYFA 5F61A 5A7CA 5I7YA 1XWHA 2EODA 1X0JA 5KTWA 2JRJA 4WHUA 5H1UA 3O35A 2CT2A 2LV9A 4IR5A 4UIWA 4Q0NA 5L97A 4PCEA 5HQ7A 2KFTA 5DFBA 3SVGA 4Z93A 4I7CA 5C85A 4UYFB 5D1LB 5E74A 5IGMA 3ONIA 4KCXA 2QIZA 4BW3A 5CY9A 1MM3A 3JVMA 2MD8C 4QEWA 5DINA 4Z1QA 4IR3A 4NUEA 5FH8A 4GPJA 4GNEA 5KHMA 4ZDTA 4ZW1A 2MD7B 1WILA 2ECWA 4V3KC 3N9PA 4O7FA 5CPEA 5E9VA 5EP7A 2KE1A 2XB1A 5HEMA 3NXBA 5KTUA 2HYED 4CCGX 4GB0A 5TDRA 5D7XA 2K1JA 4LRGA 3C6WA 3U5JA 5LKUA 5CRMA 5DLZA 5HFRA 5TABA 4BW4A 4YBTA 5CS8A 3EB6A 4XI1A 4YYKA 2KGIA 3D7CA 4FK5A 2DVQA 5E9IA 2YSMA 1WEOA 2DVRA 4W4UA 4MEOA 3ZTGA 4TU6A 4HXKA 2LN0A 4WHWA 3ZYQA 2YQLA 4WZ2A 5FE6A 2KREA 5A82A 2I8NA 2CSZA 2KWNA 3RTRB 4BHWA 2K16A 4J0RA 3NG2A 5CUDA 5G4SA 3UW9A 4LZSA 5ENCA 5FE0A 3UV5A 1F68A 4QBMA 5KO4A 4UYEA 4QC1A 2KU3A 3HTKC 3RPGB 5D3JA 5G4RA 4UITA 4NRCA 3Q2EA 5E9LA 5EISA 5CQTA 4CURA 2G6QA 4UI9B 2XEUA 4KV1A 4MR4A 5I29A 5JI8A 3C5KA 4QSWA 5IGNA 5I89A 5B76A 2OO1A 4O74A 4QSXA 2DWWA 4LJNA 4O77A 2KGGA 5LJ1A 5CQ5A 5G04B 3FKMX 4LYSA 5C87A 4XUBA 4NR7A 4IORA 3MHSA 5EPSA 4CUSA 5CRZA 1Z2QA 4YYIA 3LQJA 2Y43A 5DYXA 2FUUA 3LRQA 3N9OA 2VP7A 4OGIA 4UIXA 5ENHA 2RSDA 2PNXA 5A85A 5A5PA 5B79A 1G25A 4C9ZA 2FUIA 4CFKA 5C11A 3QZVA 3QZTA 4AVXA 2WP2A 5CGPA 5EVAA 5FFWA 4YY6A 5LVQA 3UVDA 5D25A 2YEKA 3SVHA 5IBNA 5HRVA 2M3HA 5EWWA 2MNZA 4A9JA 4A4BA 4UYDA 3ZVYA 3G0JA 4BJXA 3L1XA 5FDZA 2L43A 1ZBDB 3MXFA 2CKLA 3U5MA 3UV4A 5FEYA 5DFDA 2AN6A 2JMDA 3L11A 5E3GA 2HDPA 4NQNA 3KV5A 1FBVA 4B86C 5FH6A 5FERA 4N3WA 1CHCA 2QJ0A 5CU8A 3S92A 1WENA 2D9EA 5G0FA 5D3RA 3T7LA 5DFCA 2MA5A 5DW1A 4RVRA 3P1EA 4PKLA 5CFWA 2KR4A 3IHPA 4IC2A 5D1MB 4NRAA 4A9MA 4WA6A 4QEUA 1X4JA 1FP0A 3O70A 2LGGA 4MR6A 4GNDA 5KH3A 3MB4A 2CKLB 4F3IA 3U5OA 2BAYA 4Z1SA 2Y1NA 3SOWA 2NAAA 2K17A 4CLBA 4I7BA 2R10A 5D3LA 5H1TA 3N9MA 4YYJA 5EPRA 3LQHA 4NR4A 5AD3A 2ECVA 4QF3A 5F5ZA 4AYCA 5FG6A 3ZPV1 5DX4A 5A5SA 5DKAA 5G05B 5I3LA 4R2YA 4NR5A 5CUAA 5EGUA 3MUKA 2NXBA 2F6JA 3IU5A 4YATA 5LKXA 4QF2A 5EU1A 4NS5A 3L1ZB 4YBMA 1WGMA 2LGKA 3RPGC 4GNFA 5FH7A 1V87A 4KV4A 2DVSA 4QUTA 5H85A 4B7YC 1N72A 1WE9A 3JVJA 1ZS5A 1JSPB 1DVPA 4L7XA 2MA6A 2F6NA 4TYLA
chains in the Genus database with same CATH superfamily
5E9YA 2D8UA 4NR6A 5CQ3A 3GV4A 2N9GA 2CRRA 4QR3A 4AYCB 3I3JA 2E7NA 2VPDA 2M1RA 3ZVZB 4O76A 4ZC9A 1E4UA 5BT4A 1WESA 3UVYA 2YQMA 5FE3A 3O36A 4QB3A 2EGPA 4CL9A 4QYDA 4A9NA 1WEPA 3MDBC 2ECIA 3HCUA 3SOXA 5A83A 3E2DA 2RR4A 3M7KA 5D3TA 4Q6FA 4NR9A 5HELA 5I7XA 5II1A 4LKAA 3VKGA 5LJ2A 2VPGA 2EXUA 2YHOA 2KWOA 3JUEA 5FE9A 4N4HA 2XOZA 2QICA 4PCIA 4A9LA 5LKZA 4O7BA 2E6SA 4IC3A 2RI7A 4AKNA 3PURA 1VYXA 5D0CA 4X2IA 1WFKA 4CUTA 5ACYA 4HBYA 2RNYA 5F25A 4HXNA 4J3IA 4UP0A 4LC2A 1WEMA 2YVRA 1HYJA 4O75A 4Q0OA 5F63A 4O62A 3U5NA 5C89A 3MULA 4L58A 3ZYUA 4CUQA 5EICA 5CQ6A 4AKIA 4AI6A 3T6RA 4HXRA 4A49A 5C8GA 2KWJA 5F1HA 3H7HA 2R0SA 1WIMA 2XOCA 4HBWA 2VPEA 3FAOA 5FE1A 4O78A 4TZ2A 4A9IA 2FSAA 4LK9A 5FE5A 2EGMA 2DATA 4R8PK 5C4QA 2JMIA 2YELA 5FB0A 5EK9A 3O33A 2VJFA 5DKDA 1LDKC 4PS5A 2CSYA 5EPBA 5TB6A 2E3KA 4HXPA 5I83A 2RNXA 2KYUA 3P1CA 5CQAA 2YU4A 2YUCA 5FE8A 4MEQA 4LLBA 4GNGA 5D3HA 5L8UA 4TZ8A 4YABA 4N4FA 5E3DA 3TLPA 3KQIA 5EWHA 2EA6A 4PTBA 2L7PA 3AADA 2OXQC 5HCLA 4NUCA 4BW1A 5HQ5A 5AIUA 1WEQA 3SVFA 3I2DA 1X4IA 3DWYA 3P5OA 4MENA 4A9OA 1X4UA 2UZGA 1WUMA 2IDAA 4IOQA 2CRWA 4ZQLA 2VJFB 5B75A 2MNYA 5A5RA 5ETDA 4QR5A 5HFQA 5ENEA 3JVLA 3N9LA 2P57A 2ECJA 4ZUXU 3G0LA 5I40A 4NN2A 2R0YA 3O37A 5DKCA 4TT4A 2OUOA 3P1DA 4TT2A 5E9KA 2DX8A 2YYRA 4QSTA 2L5UA 4QC3A 4O7AA 3V43A 3PHDA 2YT5A 3MHHA 2H60A 5D1KB 4XUAA 3U5KA 4LYWA 4IR6A 1EQFA 4NYVA 4UP5A 3VKHA 5D26A 2E6RA 5ENFA 4YYGA 5C7NA 5D3NA 4UIYA 4A9KA 3DQVR 3SHBA 1WEVA 4A0CD 4PPEA 4YBSA 4OGEA 5B78A 5KH7A 5EYAF 5IGKA 2D8SA 4QEVA 5I1QA 5A5NA 5BT5A 2JM3A 5TBNA 1RMDA 4QNSA 3PUQA 3EB5A 4MSXA 5KH9A 5HM0A 2LDRA 3U5LA 3M62A 3ZPVE 5FG5A 4UIUA 2YREA 4O64A 4QSVA 5DKHA 3Q2FA 4E96A 2ECTA 1Z60A 3MQMA 4XYAA 4UYGA 3LXJA 4TQNA 4NUDA 5B8DA 5FFYA 2G4AA 1JM4B 4QSUA 5ENGA 5FG4A 2D82A 2LXHC 5D24A 5JG6A 5H1VA 4CUPA 1U6GB 3HMEA 3LDYA 4O72A 4MVTA 3SOUA 5C13A 5EWDA 3ASLA 2DSMA 2M6MA 5CUBA 1MBMA 4MEPA 1N87A 2MJVB 1Z6UA 5E9MA 2EJNA 2RNWA 5CTLA 5IG6A 2JMJA 5LUUA 5KTXA 4NYWA 3IU6A 3HCSA 5J0DA 4NR8A 5AMEA 1JM7B 2L75A 4LADB 4QYLA 2MKEA 3LQIA 5F36A 4FIPA 4YH3A 4YYHA 5K29A 2H0DA 4HBVA 4UYHA 5IGLA 2MT5A 2E7OA 2L85A 3MB3A 4CUUA 4H9DA 2YDWA 2E61A 4LDFA 4J0SA 1WEUA 4R7EA 5FE2A 2VJEA 5K3QA 3UVWA 5F1LA 3UVXA 4QY4A 1HYIA 5DYAA 2L84A 5D3PA 3LJUX 5FBXA 4S3OC 5E0RA 4TKPB 2YYNA 4O70A 2IQJA 2LRIC 2YSJA 5HENA 4YY4A 4AUQB 5LVRA 1F62A 4J1PA 4NXJA 2KTBB 5DY7A 2RO1A 4O71A 5L96A 4UIVA 2G45A 2MIQA 2H0DB 2OWAA 3FJUB 3O7AA 4P5OB 4OGJA 2L5EA 1JOCA 4OUFA 5HJCA 4CA1A 4YH4A 2YEMA 4YYNA 5CUGA 2K4DA 4A9FA 3KNVA 3HCTA 2VJEB 4Z6IA 4F52B 5HLSA 4XY9A 5EV9A 3FL2A 2I7KA 5A5OA 5L98A 1IYMA 5CQ8A 3GL6A 5FFVA 4NRBA 1ZKRA 5H9MA 4BBQA 4YYDA 5F3AA 2JUNA 2KKXA 5HQ6A 2KWKA 2YQDA 4O7CA 1BORA 5DBMA 5HRXA 4LZ2A 2LXPC 4YC9A 3O34A 5E7DA 2VNFA 4A9EA 2RFJA 2YW5A 5I80A 4QUUA 5ENBA 4XY8A 2WP1A 1E6IA 4DONA 4N4IA 4FO9A 5B77A 2LQ6A 5LJ0A 2XP0A 1K2FA 4LZRA 5FE4A 1LDJB 3KV6A 2M85A 2MUMA 5ENIA 3HMHA 4NYXA 5ENJA 3JVKA 4Z6HA 4TS8A 4V3LC 4X3GA 5ETBA 2GRCA 2RS9B 4A9HA 4ALGA 5FE7A 2B0OE 5TRBA 4IOOA 4S3OB 4PY6A 2L80A 5HRWA 5EWVA 5CUEA 3M63A 4QSRA 5EWCA 1T1HA 2C2VS 2YW8A 4N4GA 3D1DA 5CP5A 5I88A 2YURA 3DPLR 4HXMA 2FD4A 2DKWA 3DDTA 5IIDA 1VD4A 2ZETC 3QZSA 5AMFA 1WUGA 4Z0RA 4YK0A 5J3XA 4UIZA 5A5QA 5CQ4A 5DYCA 3VK6A 1WEEA 3FANA 4IR4A 2R0VA 2YHNA 3UV2A 2DJAA 3KDEC 1VFYA 5EA1A 4WZ0A 4WZ3B 5L99A 2VPBA 5L8TA 4FLPA 5KU3A 5II2A 5A81A 5LCWB 4YADA 1WEWA 3LJWA 5I86A 5DW2A 5COIA 2C2LA 4AP4A 4BW2A 5CUCA 5F62A 3U5PA 5LKTA 4MR5A 5TCMA 3DAIA 4QSPA 3AQAA 2LGVA 4C67A 1MM2A 5JWMA 3RCWA 4YYMA 5E73A 1PUOA 4HBXA 3N9QA 5AITA 4FJCA 4C66A 5D3SA 2DVVA 4Y03A 5EI4A 2ECNA 4TTEA 3S91A 4I7DA 2LGLA 4TT6A 4OGCA 2G43A 3N9NA 5FB1A 4QSQA 4CFLA 2I50A 3K2JA 4O7EA 3HMFA 2LSPB 4NQMA 5CZGA 4ALHA 4MR3A 4QZSA 2Y1MA 2L0BA 3M99A 4A4CA 5DYUA 1JM7A 3P1FA 2OSSA 5EM3A 4HXOA 4WIVA 2PUYA 5SVXA 4HXSA 4TU4A 3ZNIA 4LYIA 2XOYA 5F2PA 4YAXA 4QR4A 5EQ1A 2KIZA 5CQ7A 2F42A 5DLXA 4QSSA 5TDWA 4LR6A 2ECGA 4HXLA 5F60A 3GG3A 5BT3A 5AD2A 4UYFA 5F61A 5A7CA 3D1BA 5I7YA 1XWHA 2EODA 1X0JA 5KTWA 2JRJA 4WHUA 5H1UA 3O35A 2CT2A 2LV9A 4IR5A 4UIWA 4Q0NA 5L97A 4PCEA 5HQ7A 2KFTA 5DFBA 3SVGA 4Z93A 4I7CA 5C85A 4UYFB 5D1LB 5E74A 3FM8C 5IGMA 3ONIA 4KCXA 2QIZA 4BW3A 5CY9A 1MM3A 3JVMA 2MD8C 4QEWA 5DINA 4Z1QA 4IR3A 4NUEA 5FH8A 4GPJA 4GNEA 5KHMA 4ZDTA 4ZW1A 2MD7B 1WILA 2ECWA 4V3KC 3N9PA 4O7FA 5CPEA 5E9VA 5EP7A 2KE1A 2XB1A 5HEMA 3O47A 3NXBA 5KTUA 2HYED 3SUBA 4CCGX 4GB0A 5TDRA 5D7XA 2K1JA 4AKHA 4LRGA 3C6WA 3U5JA 5LKUA 5CRMA 5DLZA 5HFRA 2KKYA 4BW4A 5TABA 4YBTA 5CS8A 3EB6A 4XI1A 4YYKA 3DWDA 2KGIA 3D7CA 4FK5A 2DVQA 5E9IA 2YSMA 1WEOA 2DVRA 4W4UA 2CONA 4MEOA 3ZTGA 4TU6A 4HXKA 2LN0A 4WHWA 3ZYQA 2YQLA 4WZ2A 5FE6A 2KREA 5A82A 2I8NA 2CSZA 2KWNA 3RTRB 4BHWA 2K16A 4J0RA 3NG2A 5CUDA 5G4SA 3UW9A 4LZSA 5ENCA 5FE0A 3UV5A 1F68A 4QBMA 5KO4A 4UYEA 4QC1A 2KU3A 3HTKC 3RPGB 5D3JA 5G4RA 4B7YC 4UITA 4NRCA 3Q2EA 5E9LA 5EISA 5CQTA 4CURA 2G6QA 4UI9B 2XEUA 4KV1A 4MR4A 5I29A 5JI8A 3C5KA 3PLWA 4QSWA 5IGNA 5I89A 5B76A 2OO1A 4O74A 4QSXA 2DWWA 4LJNA 4O77A 2KGGA 5LJ1A 5CQ5A 5G04B 3FKMX 4LYSA 5C87A 4XUBA 4NR7A 4IORA 3MHSA 5EPSA 4CUSA 5CRZA 1Z2QA 4YYIA 3LQJA 2Y43A 5DYXA 2FUUA 5SVIA 3LRQA 3N9OA 2VP7A 3LVRE 4OGIA 4UIXA 5ENHA 2RSDA 2PNXA 5A85A 5A5PA 5B79A 1G25A 4C9ZA 2FUIA 4CFKA 5C11A 3QZVA 3QZTA 4AVXA 2WP2A 5CGPA 5EVAA 5FFWA 4YY6A 5LVQA 3UVDA 5D25A 2YEKA 3SVHA 5IBNA 5HRVA 2M3HA 5EWWA 2MNZA 4A9JA 4A4BA 4UYDA 3ZVYA 3G0JA 4BJXA 3L1XA 5FDZA 2L43A 1ZBDB 5SVIB 3MXFA 2CKLA 3U5MA 3UV4A 5FEYA 5DFDA 2AN6A 2JMDA 3L11A 5E3GA 2HDPA 4NQNA 3KV5A 1FBVA 4B86C 5FH6A 5FERA 4N3WA 1CHCA 2QJ0A 5CU8A 3S92A 1WENA 2D9EA 5G0FA 5D3RA 3T7LA 5DFCA 2MA5A 3T9KA 5DW1A 4RVRA 3P1EA 4PKLA 5CFWA 2KR4A 3IHPA 4IC2A 5D1MB 4NRAA 4A9MA 4WA6A 4QEUA 1X4JA 1FP0A 3O70A 2LGGA 4MR6A 4GNDA 5KH3A 3MB4A 2CKLB 4QQ4A 3FEHA 4AKGA 4F3IA 3U5OA 2BAYA 4Z1SA 2Y1NA 3SOWA 2NAAA 2K17A 4CLBA 1DCQA 4I7BA 2R10A 5D3LA 5H1TA 2M13A 4YYJA 5EPRA 3N9MA 3LQHA 4NR4A 5AD3A 2ECVA 3Q1DA 4QF3A 4Z0OA 5F5ZA 4AYCA 4F1PA 5FG6A 5SVYA 3ZPV1 5DX4A 5A5SA 5DKAA 5G05B 5I3LA 4R2YA 4NR5A 5CUAA 5EGUA 3MUKA 2NXBA 2F6JA 3IU5A 4YATA 5LKXA 4QF2A 5EU1A 4NS5A 3L1ZB 4YBMA 3LVQE 1WGMA 2LGKA 3RPGC 4GNFA 5FH7A 1V87A 4KV4A 2DVSA 4QUTA 3ERRA 5H85A 1N72A 1WE9A 3JVJA 1ZS5A 1JSPB 2CSVA 2FFWA 2LAUA 1DVPA 4L7XA 2MA6A 2F6NA 4TYLA
chains in the Genus database with same CATH topology
5E9YA 3GV4A 4NR6A 5CQ3A 2N9GA 4QR3A 4AYCB 3I3JA 2E7NA 2VPDA 2M1RA 3ZVZB 4O76A 4ZC9A 1E4UA 5BT4A 1WESA 3UVYA 2YQMA 5FE3A 3O36A 4QB3A 2EGPA 4CL9A 4QYDA 4A9NA 1WEPA 2ECIA 3HCUA 3SOXA 5A83A 5D3TA 4Q6FA 4NR9A 5HELA 5I7XA 5II1A 4LKAA 2VPGA 5LJ2A 2YHOA 2KWOA 5FE9A 4N4HA 2QICA 4PCIA 4A9LA 5LKZA 4O7BA 2E6SA 4IC3A 2RI7A 4AKNA 3PURA 1VYXA 5D0CA 4X2IA 1WFKA 4CUTA 5ACYA 4HBYA 2RNYA 5F25A 4HXNA 4J3IA 4UP0A 4LC2A 1WEMA 1HYJA 4O75A 4Q0OA 5F63A 3U5NA 5C89A 3MULA 4L58A 3ZYUA 4CUQA 5EICA 5CQ6A 3T6RA 4HXRA 4A49A 5C8GA 2KWJA 5F1HA 2R0SA 1WIMA 4HBWA 2VPEA 5FE1A 4O78A 4TZ2A 4A9IA 2FSAA 4LK9A 5FE5A 4R8PK 2DATA 5C4QA 2JMIA 2YELA 5FB0A 5EK9A 3O33A 2VJFA 5DKDA 1LDKC 4PS5A 2CSYA 5EPBA 5TB6A 2E3KA 4HXPA 5I83A 2RNXA 2KYUA 3P1CA 5CQAA 2YU4A 2YUCA 5FE8A 4MEQA 4LLBA 4GNGA 5D3HA 5L8UA 4TZ8A 4YABA 4N4FA 5E3DA 3TLPA 3KQIA 5EWHA 2EA6A 4PTBA 3AADA 2OXQC 5HCLA 4NUCA 4BW1A 5HQ5A 5AIUA 1WEQA 3SVFA 3I2DA 1X4IA 3DWYA 3P5OA 4MENA 4A9OA 1X4UA 2UZGA 1WUMA 2IDAA 4IOQA 4ZQLA 2VJFB 5B75A 2MNYA 5A5RA 5ETDA 4QR5A 5HFQA 5ENEA 3JVLA 3N9LA 2ECJA 4ZUXU 3G0LA 5I40A 4NN2A 2R0YA 3O37A 5DKCA 4TT4A 2OUOA 3P1DA 4TT2A 5E9KA 2DX8A 2YYRA 4QSTA 2L5UA 4QC3A 4O7AA 3V43A 3PHDA 2YT5A 3MHHA 2H60A 5D1KB 4XUAA 3U5KA 4LYWA 4IR6A 1EQFA 4NYVA 4UP5A 2E6RA 5D26A 5ENFA 4YYGA 5C7NA 4UIYA 5D3NA 4A9KA 3DQVR 3SHBA 1WEVA 4A0CD 4PPEA 4YBSA 5B78A 5KH7A 5EYAF 5IGKA 2D8SA 4QEVA 5I1QA 5A5NA 5BT5A 5TBNA 1RMDA 4QNSA 3PUQA 3EB5A 4MSXA 5KH9A 5HM0A 2LDRA 3U5LA 3M62A 3ZPVE 5FG5A 4UIUA 2YREA 4O64A 4QSVA 5DKHA 3Q2FA 4E96A 2ECTA 1Z60A 3MQMA 4XYAA 4UYGA 3LXJA 4TQNA 4NUDA 5B8DA 5FFYA 2G4AA 1JM4B 4QSUA 5ENGA 5FG4A 2D82A 2LXHC 5D24A 5JG6A 5H1VA 4CUPA 1U6GB 3HMEA 4O72A 4MVTA 3SOUA 5C13A 5EWDA 3ASLA 2M6MA 5CUBA 4MEPA 1N87A 2MJVB 1Z6UA 5E9MA 2RNWA 5CTLA 5IG6A 2JMJA 5LUUA 5KTXA 4NYWA 3IU6A 3HCSA 5J0DA 4NR8A 5AMEA 1JM7B 2L75A 4LADB 4QYLA 3LQIA 5F36A 4FIPA 4YH3A 4YYHA 5K29A 2H0DA 4HBVA 4UYHA 5IGLA 2MT5A 2E7OA 2L85A 3MB3A 4CUUA 2YDWA 4LDFA 4J0SA 1WEUA 4R7EA 5FE2A 2VJEA 3UVWA 5F1LA 3UVXA 4QY4A 1HYIA 5DYAA 2L84A 5D3PA 4S3OC 5FBXA 4TKPB 5E0RA 2YYNA 4O70A 2YSJA 2LRIC 5HENA 4YY4A 4AUQB 5LVRA 1F62A 4J1PA 4NXJA 2KTBB 5DY7A 2RO1A 4O71A 5L96A 4UIVA 2G45A 2MIQA 2H0DB 3O7AA 4P5OB 4OGJA 2L5EA 1JOCA 4OUFA 5HJCA 4CA1A 4YH4A 2YEMA 4YYNA 5CUGA 2K4DA 4A9FA 3KNVA 3HCTA 2VJEB 4Z6IA 4F52B 5HLSA 4XY9A 5EV9A 3FL2A 2I7KA 5A5OA 5L98A 1IYMA 5CQ8A 3GL6A 5FFVA 4NRBA 4BBQA 5H9MA 4YYDA 5F3AA 5HQ6A 2KWKA 2YQDA 4O7CA 1BORA 5DBMA 5HRXA 4LZ2A 2LXPC 4YC9A 3O34A 5E7DA 2VNFA 4A9EA 2RFJA 2YW5A 5I80A 4QUUA 5ENBA 4XY8A 2WP1A 1E6IA 4DONA 4N4IA 4FO9A 5B77A 2LQ6A 5LJ0A 1K2FA 4LZRA 5FE4A 1LDJB 3KV6A 2M85A 2MUMA 5ENIA 3HMHA 4NYXA 5ENJA 3JVKA 4Z6HA 4TS8A 4V3LC 4X3GA 5ETBA 2GRCA 2RS9B 4A9HA 4ALGA 5FE7A 5TRBA 4IOOA 4S3OB 4PY6A 2L80A 5HRWA 5EWVA 5CUEA 3M63A 4QSRA 5EWCA 1T1HA 2C2VS 2YW8A 4N4GA 5CP5A 5I88A 2YURA 3DPLR 4HXMA 2DKWA 5IIDA 1VD4A 2ZETC 3QZSA 5AMFA 1WUGA 4YK0A 5J3XA 4UIZA 5A5QA 5CQ4A 5DYCA 3VK6A 1WEEA 4IR4A 2R0VA 2YHNA 3UV2A 1VFYA 5EA1A 4WZ0A 4WZ3B 5L99A 2VPBA 5L8TA 4FLPA 5KU3A 5II2A 5A81A 5LCWB 4YADA 1WEWA 3LJWA 5I86A 5DW2A 5COIA 2C2LA 4AP4A 4BW2A 5CUCA 5F62A 3U5PA 5LKTA 4MR5A 5TCMA 3DAIA 4QSPA 3AQAA 2LGVA 4C67A 1MM2A 5JWMA 3RCWA 4YYMA 5E73A 4HBXA 3N9QA 5AITA 4FJCA 4C66A 5D3SA 2DVVA 4Y03A 5EI4A 2ECNA 4TTEA 3S91A 4I7DA 2LGLA 4TT6A 2G43A 3N9NA 5FB1A 4QSQA 4CFLA 2I50A 3K2JA 4O7EA 3HMFA 2LSPB 4NQMA 5CZGA 4ALHA 4MR3A 4QZSA 2Y1MA 2L0BA 3M99A 4A4CA 5DYUA 1JM7A 3P1FA 2OSSA 5EM3A 4HXOA 4WIVA 2PUYA 4HXSA 4TU4A 3ZNIA 4LYIA 5F2PA 4YAXA 4QR4A 5EQ1A 2KIZA 5CQ7A 2F42A 5DLXA 4QSSA 5TDWA 4LR6A 2ECGA 4HXLA 5F60A 3GG3A 5BT3A 5AD2A 4UYFA 5F61A 5A7CA 5I7YA 1XWHA 2EODA 1X0JA 5KTWA 2JRJA 4WHUA 5H1UA 3O35A 2CT2A 2LV9A 4IR5A 4UIWA 4Q0NA 5L97A 4PCEA 5HQ7A 2KFTA 5DFBA 3SVGA 4Z93A 4I7CA 5C85A 4UYFB 5D1LB 5E74A 5IGMA 3ONIA 4KCXA 2QIZA 4BW3A 5CY9A 1MM3A 3JVMA 2MD8C 4QEWA 5DINA 4Z1QA 4IR3A 4NUEA 5FH8A 4GPJA 4GNEA 5KHMA 4ZDTA 4ZW1A 2MD7B 1WILA 2ECWA 4V3KC 3N9PA 4O7FA 5CPEA 5E9VA 5EP7A 2KE1A 2XB1A 5HEMA 3NXBA 5KTUA 2HYED 4CCGX 4GB0A 5TDRA 5D7XA 2K1JA 4LRGA 3C6WA 3U5JA 5LKUA 5CRMA 5DLZA 5HFRA 5TABA 4BW4A 4YBTA 5CS8A 3EB6A 4XI1A 4YYKA 2KGIA 3D7CA 4FK5A 2DVQA 5E9IA 2YSMA 1WEOA 2DVRA 4W4UA 4MEOA 3ZTGA 4TU6A 4HXKA 2LN0A 4WHWA 3ZYQA 2YQLA 4WZ2A 5FE6A 2KREA 5A82A 2I8NA 2CSZA 2KWNA 3RTRB 4BHWA 2K16A 4J0RA 3NG2A 5CUDA 5G4SA 3UW9A 4LZSA 5ENCA 5FE0A 3UV5A 1F68A 4QBMA 5KO4A 4UYEA 4QC1A 2KU3A 3HTKC 3RPGB 5D3JA 5G4RA 4UITA 4NRCA 3Q2EA 5E9LA 5EISA 5CQTA 4CURA 2G6QA 4UI9B 2XEUA 4KV1A 4MR4A 5I29A 5JI8A 3C5KA 4QSWA 5IGNA 5I89A 5B76A 2OO1A 4O74A 4QSXA 2DWWA 4LJNA 4O77A 2KGGA 5LJ1A 5CQ5A 5G04B 3FKMX 4LYSA 5C87A 4XUBA 4NR7A 4IORA 3MHSA 5EPSA 4CUSA 5CRZA 1Z2QA 4YYIA 3LQJA 2Y43A 5DYXA 2FUUA 3LRQA 3N9OA 2VP7A 4OGIA 4UIXA 5ENHA 2RSDA 2PNXA 5A85A 5A5PA 5B79A 1G25A 4C9ZA 2FUIA 4CFKA 5C11A 3QZVA 3QZTA 4AVXA 2WP2A 5CGPA 5EVAA 5FFWA 4YY6A 5LVQA 3UVDA 5D25A 2YEKA 3SVHA 5IBNA 5HRVA 2M3HA 5EWWA 2MNZA 4A9JA 4A4BA 4UYDA 3ZVYA 3G0JA 4BJXA 3L1XA 5FDZA 2L43A 1ZBDB 3MXFA 2CKLA 3U5MA 3UV4A 5FEYA 5DFDA 2AN6A 2JMDA 3L11A 5E3GA 2HDPA 4NQNA 3KV5A 1FBVA 4B86C 5FH6A 5FERA 4N3WA 1CHCA 2QJ0A 5CU8A 3S92A 1WENA 2D9EA 5G0FA 5D3RA 3T7LA 5DFCA 2MA5A 5DW1A 4RVRA 3P1EA 4PKLA 5CFWA 2KR4A 3IHPA 4IC2A 5D1MB 4NRAA 4A9MA 4WA6A 4QEUA 1X4JA 1FP0A 3O70A 2LGGA 4MR6A 4GNDA 5KH3A 3MB4A 2CKLB 4F3IA 3U5OA 2BAYA 4Z1SA 2Y1NA 3SOWA 2NAAA 2K17A 4CLBA 4I7BA 2R10A 5D3LA 5H1TA 3N9MA 4YYJA 5EPRA 3LQHA 4NR4A 5AD3A 2ECVA 4QF3A 5F5ZA 4AYCA 5FG6A 3ZPV1 5DX4A 5A5SA 5DKAA 5G05B 5I3LA 4R2YA 4NR5A 5CUAA 5EGUA 3MUKA 2NXBA 2F6JA 3IU5A 4YATA 5LKXA 4QF2A 5EU1A 4NS5A 3L1ZB 4YBMA 1WGMA 2LGKA 3RPGC 4GNFA 5FH7A 1V87A 4KV4A 2DVSA 4QUTA 5H85A 4B7YC 1N72A 1WE9A 3JVJA 1ZS5A 1JSPB 1DVPA 4L7XA 2MA6A 2F6NA 4TYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E9Y A;  3GV4 A;  4NR6 A;  5CQ3 A;  2N9G A;  4QR3 A;  4AYC B;  3I3J A;  2E7N A;  2VPD A;  2M1R A;  3ZVZ B;  4O76 A;  4ZC9 A;  1E4U A;  5BT4 A;  1WES A;  3UVY A;  2YQM A;  5FE3 A;  3O36 A;  4QB3 A;  2EGP A;  4CL9 A;  4QYD A;  4A9N A;  1WEP A;  2ECI A;  3HCU A;  3SOX A;  5A83 A;  5D3T A;  4Q6F A;  4NR9 A;  5HEL A;  5I7X A;  5II1 A;  4LKA A;  2VPG A;  5LJ2 A;  2YHO A;  2KWO A;  5FE9 A;  4N4H A;  2QIC A;  4PCI A;  4A9L A;  5LKZ A;  4O7B A;  2E6S A;  4IC3 A;  2RI7 A;  4AKN A;  3PUR A;  1VYX A;  5D0C A;  4X2I A;  1WFK A;  4CUT A;  5ACY A;  4HBY A;  2RNY A;  5F25 A;  4HXN A;  4J3I A;  4UP0 A;  4LC2 A;  1WEM A;  1HYJ A;  4O75 A;  4Q0O A;  5F63 A;  3U5N A;  5C89 A;  3MUL A;  4L58 A;  3ZYU A;  4CUQ A;  5EIC A;  5CQ6 A;  3T6R A;  4HXR A;  4A49 A;  5C8G A;  2KWJ A;  5F1H A;  2R0S A;  1WIM A;  4HBW A;  2VPE A;  5FE1 A;  4O78 A;  4TZ2 A;  4A9I A;  2FSA A;  4LK9 A;  5FE5 A;  4R8P K;  2DAT A;  5C4Q A;  2JMI A;  2YEL A;  5FB0 A;  5EK9 A;  3O33 A;  2VJF A;  5DKD A;  1LDK C;  4PS5 A;  2CSY A;  5EPB A;  5TB6 A;  2E3K A;  4HXP A;  5I83 A;  2RNX A;  2KYU A;  3P1C A;  5CQA A;  2YU4 A;  2YUC A;  5FE8 A;  4MEQ A;  4LLB A;  4GNG A;  5D3H A;  5L8U A;  4TZ8 A;  4YAB A;  4N4F A;  5E3D A;  3TLP A;  3KQI A;  5EWH A;  2EA6 A;  4PTB A;  3AAD A;  2OXQ C;  5HCL A;  4NUC A;  4BW1 A;  5HQ5 A;  5AIU A;  1WEQ A;  3SVF A;  3I2D A;  1X4I A;  3DWY A;  3P5O A;  4MEN A;  4A9O A;  1X4U A;  2UZG A;  1WUM A;  2IDA A;  4IOQ A;  4ZQL A;  2VJF B;  5B75 A;  2MNY A;  5A5R A;  5ETD A;  4QR5 A;  5HFQ A;  5ENE A;  3JVL A;  3N9L A;  2ECJ A;  4ZUX U;  3G0L A;  5I40 A;  4NN2 A;  2R0Y A;  3O37 A;  5DKC A;  4TT4 A;  2OUO A;  3P1D A;  4TT2 A;  5E9K A;  2DX8 A;  2YYR A;  4QST A;  2L5U A;  4QC3 A;  4O7A A;  3V43 A;  3PHD A;  2YT5 A;  3MHH A;  2H60 A;  5D1K B;  4XUA A;  3U5K A;  4LYW A;  4IR6 A;  1EQF A;  4NYV A;  4UP5 A;  2E6R A;  5D26 A;  5ENF A;  4YYG A;  5C7N A;  4UIY A;  5D3N A;  4A9K A;  3DQV R;  3SHB A;  1WEV A;  4A0C D;  4PPE A;  4YBS A;  5B78 A;  5KH7 A;  5EYA F;  5IGK A;  2D8S A;  4QEV A;  5I1Q A;  5A5N A;  5BT5 A;  5TBN A;  1RMD A;  4QNS A;  3PUQ A;  3EB5 A;  4MSX A;  5KH9 A;  5HM0 A;  2LDR A;  3U5L A;  3M62 A;  3ZPV E;  5FG5 A;  4UIU A;  2YRE A;  4O64 A;  4QSV A;  5DKH A;  3Q2F A;  4E96 A;  2ECT A;  1Z60 A;  3MQM A;  4XYA A;  4UYG A;  3LXJ A;  4TQN A;  4NUD A;  5B8D A;  5FFY A;  2G4A A;  1JM4 B;  4QSU A;  5ENG A;  5FG4 A;  2D82 A;  2LXH C;  5D24 A;  5JG6 A;  5H1V A;  4CUP A;  1U6G B;  3HME A;  4O72 A;  4MVT A;  3SOU A;  5C13 A;  5EWD A;  3ASL A;  2M6M A;  5CUB A;  4MEP A;  1N87 A;  2MJV B;  1Z6U A;  5E9M A;  2RNW A;  5CTL A;  5IG6 A;  2JMJ A;  5LUU A;  5KTX A;  4NYW A;  3IU6 A;  3HCS A;  5J0D A;  4NR8 A;  5AME A;  1JM7 B;  2L75 A;  4LAD B;  4QYL A;  3LQI A;  5F36 A;  4FIP A;  4YH3 A;  4YYH A;  5K29 A;  2H0D A;  4HBV A;  4UYH A;  5IGL A;  2MT5 A;  2E7O A;  2L85 A;  3MB3 A;  4CUU A;  2YDW A;  4LDF A;  4J0S A;  1WEU A;  4R7E A;  5FE2 A;  2VJE A;  3UVW A;  5F1L A;  3UVX A;  4QY4 A;  1HYI A;  5DYA A;  2L84 A;  5D3P A;  4S3O C;  5FBX A;  4TKP B;  5E0R A;  2YYN A;  4O70 A;  2YSJ A;  2LRI C;  5HEN A;  4YY4 A;  4AUQ B;  5LVR A;  1F62 A;  4J1P A;  4NXJ A;  2KTB B;  5DY7 A;  2RO1 A;  4O71 A;  5L96 A;  4UIV A;  2G45 A;  2MIQ A;  2H0D B;  3O7A A;  4P5O B;  4OGJ A;  2L5E A;  1JOC A;  4OUF A;  5HJC A;  4CA1 A;  4YH4 A;  2YEM A;  4YYN A;  5CUG A;  2K4D A;  4A9F A;  3KNV A;  3HCT A;  2VJE B;  4Z6I A;  4F52 B;  5HLS A;  4XY9 A;  5EV9 A;  3FL2 A;  2I7K A;  5A5O A;  5L98 A;  1IYM A;  5CQ8 A;  3GL6 A;  5FFV A;  4NRB A;  4BBQ A;  5H9M A;  4YYD A;  5F3A A;  5HQ6 A;  2KWK A;  2YQD A;  4O7C A;  1BOR A;  5DBM A;  5HRX A;  4LZ2 A;  2LXP C;  4YC9 A;  3O34 A;  5E7D A;  2VNF A;  4A9E A;  2RFJ A;  2YW5 A;  5I80 A;  4QUU A;  5ENB A;  4XY8 A;  2WP1 A;  1E6I A;  4DON A;  4N4I A;  4FO9 A;  5B77 A;  2LQ6 A;  5LJ0 A;  1K2F A;  4LZR A;  5FE4 A;  1LDJ B;  3KV6 A;  2M85 A;  2MUM A;  5ENI A;  3HMH A;  4NYX A;  5ENJ A;  3JVK A;  4Z6H A;  4TS8 A;  4V3L C;  4X3G A;  5ETB A;  2GRC A;  2RS9 B;  4A9H A;  4ALG A;  5FE7 A;  5TRB A;  4IOO A;  4S3O B;  4PY6 A;  2L80 A;  5HRW A;  5EWV A;  5CUE A;  3M63 A;  4QSR A;  5EWC A;  1T1H A;  2C2V S;  2YW8 A;  4N4G A;  5CP5 A;  5I88 A;  2YUR A;  3DPL R;  4HXM A;  2DKW A;  5IID A;  1VD4 A;  2ZET C;  3QZS A;  5AMF A;  1WUG A;  4YK0 A;  5J3X A;  4UIZ A;  5A5Q A;  5CQ4 A;  5DYC A;  3VK6 A;  1WEE A;  4IR4 A;  2R0V A;  2YHN A;  3UV2 A;  1VFY A;  5EA1 A;  4WZ0 A;  4WZ3 B;  5L99 A;  2VPB A;  5L8T A;  4FLP A;  5KU3 A;  5II2 A;  5A81 A;  5LCW B;  4YAD A;  1WEW A;  3LJW A;  5I86 A;  5DW2 A;  5COI A;  2C2L A;  4AP4 A;  4BW2 A;  5CUC A;  5F62 A;  3U5P A;  5LKT A;  4MR5 A;  5TCM A;  3DAI A;  4QSP A;  3AQA A;  2LGV A;  4C67 A;  1MM2 A;  5JWM A;  3RCW A;  4YYM A;  5E73 A;  4HBX A;  3N9Q A;  5AIT A;  4FJC A;  4C66 A;  5D3S A;  2DVV A;  4Y03 A;  5EI4 A;  2ECN A;  4TTE A;  3S91 A;  4I7D A;  2LGL A;  4TT6 A;  2G43 A;  3N9N A;  5FB1 A;  4QSQ A;  4CFL A;  2I50 A;  3K2J A;  4O7E A;  3HMF A;  2LSP B;  4NQM A;  5CZG A;  4ALH A;  4MR3 A;  4QZS A;  2Y1M A;  2L0B A;  3M99 A;  4A4C A;  5DYU A;  1JM7 A;  3P1F A;  2OSS A;  5EM3 A;  4HXO A;  4WIV A;  2PUY A;  4HXS A;  4TU4 A;  3ZNI A;  4LYI A;  5F2P A;  4YAX A;  4QR4 A;  5EQ1 A;  2KIZ A;  5CQ7 A;  2F42 A;  5DLX A;  4QSS A;  5TDW A;  4LR6 A;  2ECG A;  4HXL A;  5F60 A;  3GG3 A;  5BT3 A;  5AD2 A;  4UYF A;  5F61 A;  5A7C A;  5I7Y A;  1XWH A;  2EOD A;  1X0J A;  5KTW A;  2JRJ A;  4WHU A;  5H1U A;  3O35 A;  2CT2 A;  2LV9 A;  4IR5 A;  4UIW A;  4Q0N A;  5L97 A;  4PCE A;  5HQ7 A;  2KFT A;  5DFB A;  3SVG A;  4Z93 A;  4I7C A;  5C85 A;  4UYF B;  5D1L B;  5E74 A;  5IGM A;  3ONI A;  4KCX A;  2QIZ A;  4BW3 A;  5CY9 A;  1MM3 A;  3JVM A;  2MD8 C;  4QEW A;  5DIN A;  4Z1Q A;  4IR3 A;  4NUE A;  5FH8 A;  4GPJ A;  4GNE A;  5KHM A;  4ZDT A;  4ZW1 A;  2MD7 B;  1WIL A;  2ECW A;  4V3K C;  3N9P A;  4O7F A;  5CPE A;  5E9V A;  5EP7 A;  2KE1 A;  2XB1 A;  5HEM A;  3NXB A;  5KTU A;  2HYE D;  4CCG X;  4GB0 A;  5TDR A;  5D7X A;  2K1J A;  4LRG A;  3C6W A;  3U5J A;  5LKU A;  5CRM A;  5DLZ A;  5HFR A;  5TAB A;  4BW4 A;  4YBT A;  5CS8 A;  3EB6 A;  4XI1 A;  4YYK A;  2KGI A;  3D7C A;  4FK5 A;  2DVQ A;  5E9I A;  2YSM A;  1WEO A;  2DVR A;  4W4U A;  4MEO A;  3ZTG A;  4TU6 A;  4HXK A;  2LN0 A;  4WHW A;  3ZYQ A;  2YQL A;  4WZ2 A;  5FE6 A;  2KRE A;  5A82 A;  2I8N A;  2CSZ A;  2KWN A;  3RTR B;  4BHW A;  2K16 A;  4J0R A;  3NG2 A;  5CUD A;  5G4S A;  3UW9 A;  4LZS A;  5ENC A;  5FE0 A;  3UV5 A;  1F68 A;  4QBM A;  5KO4 A;  4UYE A;  4QC1 A;  2KU3 A;  3HTK C;  3RPG B;  5D3J A;  5G4R A;  4UIT A;  4NRC A;  3Q2E A;  5E9L A;  5EIS A;  5CQT A;  4CUR A;  2G6Q A;  4UI9 B;  2XEU A;  4KV1 A;  4MR4 A;  5I29 A;  5JI8 A;  3C5K A;  4QSW A;  5IGN A;  5I89 A;  5B76 A;  2OO1 A;  4O74 A;  4QSX A;  2DWW A;  4LJN A;  4O77 A;  2KGG A;  5LJ1 A;  5CQ5 A;  5G04 B;  3FKM X;  4LYS A;  5C87 A;  4XUB A;  4NR7 A;  4IOR A;  3MHS A;  5EPS A;  4CUS A;  5CRZ A;  1Z2Q A;  4YYI A;  3LQJ A;  2Y43 A;  5DYX A;  2FUU A;  3LRQ A;  3N9O A;  2VP7 A;  4OGI A;  4UIX A;  5ENH A;  2RSD A;  2PNX A;  5A85 A;  5A5P A;  5B79 A;  1G25 A;  4C9Z A;  2FUI A;  4CFK A;  5C11 A;  3QZV A;  3QZT A;  4AVX A;  2WP2 A;  5CGP A;  5EVA A;  5FFW A;  4YY6 A;  5LVQ A;  3UVD A;  5D25 A;  2YEK A;  3SVH A;  5IBN A;  5HRV A;  2M3H A;  5EWW A;  2MNZ A;  4A9J A;  4A4B A;  4UYD A;  3ZVY A;  3G0J A;  4BJX A;  3L1X A;  5FDZ A;  2L43 A;  1ZBD B;  3MXF A;  2CKL A;  3U5M A;  3UV4 A;  5FEY A;  5DFD A;  2AN6 A;  2JMD A;  3L11 A;  5E3G A;  2HDP A;  4NQN A;  3KV5 A;  1FBV A;  4B86 C;  5FH6 A;  5FER A;  4N3W A;  1CHC A;  2QJ0 A;  5CU8 A;  3S92 A;  1WEN A;  2D9E A;  5G0F A;  5D3R A;  3T7L A;  5DFC A;  2MA5 A;  5DW1 A;  4RVR A;  3P1E A;  4PKL A;  5CFW A;  2KR4 A;  3IHP A;  4IC2 A;  5D1M B;  4NRA A;  4A9M A;  4WA6 A;  4QEU A;  1X4J A;  1FP0 A;  3O70 A;  2LGG A;  4MR6 A;  4GND A;  5KH3 A;  3MB4 A;  2CKL B;  4F3I A;  3U5O A;  2BAY A;  4Z1S A;  2Y1N A;  3SOW A;  2NAA A;  2K17 A;  4CLB A;  4I7B A;  2R10 A;  5D3L A;  5H1T A;  3N9M A;  4YYJ A;  5EPR A;  3LQH A;  4NR4 A;  5AD3 A;  2ECV A;  4QF3 A;  5F5Z A;  4AYC A;  5FG6 A;  3ZPV 1;  5DX4 A;  5A5S A;  5DKA A;  5G05 B;  5I3L A;  4R2Y A;  4NR5 A;  5CUA A;  5EGU A;  3MUK A;  2NXB A;  2F6J A;  3IU5 A;  4YAT A;  5LKX A;  4QF2 A;  5EU1 A;  4NS5 A;  3L1Z B;  4YBM A;  1WGM A;  2LGK A;  3RPG C;  4GNF A;  5FH7 A;  1V87 A;  4KV4 A;  2DVS A;  4QUT A;  5H85 A;  4B7Y C;  1N72 A;  1WE9 A;  3JVJ A;  1ZS5 A;  1JSP B;  1DVP A;  4L7X A;  2MA6 A;  2F6N A;  4TYL A; 
#chains in the Genus database with same CATH topology
 5E9Y A;  2D8U A;  4NR6 A;  5CQ3 A;  3GV4 A;  2N9G A;  2CRR A;  4QR3 A;  4AYC B;  3I3J A;  2E7N A;  2VPD A;  2M1R A;  3ZVZ B;  4O76 A;  4ZC9 A;  1E4U A;  5BT4 A;  1WES A;  3UVY A;  2YQM A;  5FE3 A;  3O36 A;  4QB3 A;  2EGP A;  4CL9 A;  4QYD A;  4A9N A;  1WEP A;  3MDB C;  2ECI A;  3HCU A;  3SOX A;  5A83 A;  3E2D A;  2RR4 A;  3M7K A;  5D3T A;  4Q6F A;  4NR9 A;  5HEL A;  5I7X A;  5II1 A;  4LKA A;  3VKG A;  5LJ2 A;  2VPG A;  2EXU A;  2YHO A;  2KWO A;  3JUE A;  5FE9 A;  4N4H A;  2XOZ A;  2QIC A;  4PCI A;  4A9L A;  5LKZ A;  4O7B A;  2E6S A;  4IC3 A;  2RI7 A;  4AKN A;  3PUR A;  1VYX A;  5D0C A;  4X2I A;  1WFK A;  4CUT A;  5ACY A;  4HBY A;  2RNY A;  5F25 A;  4HXN A;  4J3I A;  4UP0 A;  4LC2 A;  1WEM A;  2YVR A;  1HYJ A;  4O75 A;  4Q0O A;  5F63 A;  4O62 A;  3U5N A;  5C89 A;  3MUL A;  4L58 A;  3ZYU A;  4CUQ A;  5EIC A;  5CQ6 A;  4AKI A;  4AI6 A;  3T6R A;  4HXR A;  4A49 A;  5C8G A;  2KWJ A;  5F1H A;  3H7H A;  2R0S A;  1WIM A;  2XOC A;  4HBW A;  2VPE A;  3FAO A;  5FE1 A;  4O78 A;  4TZ2 A;  4A9I A;  2FSA A;  4LK9 A;  5FE5 A;  2EGM A;  2DAT A;  4R8P K;  5C4Q A;  2JMI A;  2YEL A;  5FB0 A;  5EK9 A;  3O33 A;  2VJF A;  5DKD A;  1LDK C;  4PS5 A;  2CSY A;  5EPB A;  5TB6 A;  2E3K A;  4HXP A;  5I83 A;  2RNX A;  2KYU A;  3P1C A;  5CQA A;  2YU4 A;  2YUC A;  5FE8 A;  4MEQ A;  4LLB A;  4GNG A;  5D3H A;  5L8U A;  4TZ8 A;  4YAB A;  4N4F A;  5E3D A;  3TLP A;  3KQI A;  5EWH A;  2EA6 A;  4PTB A;  2L7P A;  3AAD A;  2OXQ C;  5HCL A;  4NUC A;  4BW1 A;  5HQ5 A;  5AIU A;  1WEQ A;  3SVF A;  3I2D A;  1X4I A;  3DWY A;  3P5O A;  4MEN A;  4A9O A;  1X4U A;  2UZG A;  1WUM A;  2IDA A;  4IOQ A;  2CRW A;  4ZQL A;  2VJF B;  5B75 A;  2MNY A;  5A5R A;  5ETD A;  4QR5 A;  5HFQ A;  5ENE A;  3JVL A;  3N9L A;  2P57 A;  2ECJ A;  4ZUX U;  3G0L A;  5I40 A;  4NN2 A;  2R0Y A;  3O37 A;  5DKC A;  4TT4 A;  2OUO A;  3P1D A;  4TT2 A;  5E9K A;  2DX8 A;  2YYR A;  4QST A;  2L5U A;  4QC3 A;  4O7A A;  3V43 A;  3PHD A;  2YT5 A;  3MHH A;  2H60 A;  5D1K B;  4XUA A;  3U5K A;  4LYW A;  4IR6 A;  1EQF A;  4NYV A;  4UP5 A;  3VKH A;  5D26 A;  2E6R A;  5ENF A;  4YYG A;  5C7N A;  5D3N A;  4UIY A;  4A9K A;  3DQV R;  3SHB A;  1WEV A;  4A0C D;  4PPE A;  4YBS A;  4OGE A;  5B78 A;  5KH7 A;  5EYA F;  5IGK A;  2D8S A;  4QEV A;  5I1Q A;  5A5N A;  5BT5 A;  2JM3 A;  5TBN A;  1RMD A;  4QNS A;  3PUQ A;  3EB5 A;  4MSX A;  5KH9 A;  5HM0 A;  2LDR A;  3U5L A;  3M62 A;  3ZPV E;  5FG5 A;  4UIU A;  2YRE A;  4O64 A;  4QSV A;  5DKH A;  3Q2F A;  4E96 A;  2ECT A;  1Z60 A;  3MQM A;  4XYA A;  4UYG A;  3LXJ A;  4TQN A;  4NUD A;  5B8D A;  5FFY A;  2G4A A;  1JM4 B;  4QSU A;  5ENG A;  5FG4 A;  2D82 A;  2LXH C;  5D24 A;  5JG6 A;  5H1V A;  4CUP A;  1U6G B;  3HME A;  3LDY A;  4O72 A;  4MVT A;  3SOU A;  5C13 A;  5EWD A;  3ASL A;  2DSM A;  2M6M A;  5CUB A;  1MBM A;  4MEP A;  1N87 A;  2MJV B;  1Z6U A;  5E9M A;  2EJN A;  2RNW A;  5CTL A;  5IG6 A;  2JMJ A;  5LUU A;  5KTX A;  4NYW A;  3IU6 A;  3HCS A;  5J0D A;  4NR8 A;  5AME A;  1JM7 B;  2L75 A;  4LAD B;  4QYL A;  2MKE A;  3LQI A;  5F36 A;  4FIP A;  4YH3 A;  4YYH A;  5K29 A;  2H0D A;  4HBV A;  4UYH A;  5IGL A;  2MT5 A;  2E7O A;  2L85 A;  3MB3 A;  4CUU A;  4H9D A;  2YDW A;  2E61 A;  4LDF A;  4J0S A;  1WEU A;  4R7E A;  5FE2 A;  2VJE A;  5K3Q A;  3UVW A;  5F1L A;  3UVX A;  4QY4 A;  1HYI A;  5DYA A;  2L84 A;  5D3P A;  3LJU X;  5FBX A;  4S3O C;  5E0R A;  4TKP B;  2YYN A;  4O70 A;  2IQJ A;  2LRI C;  2YSJ A;  5HEN A;  4YY4 A;  4AUQ B;  5LVR A;  1F62 A;  4J1P A;  4NXJ A;  2KTB B;  5DY7 A;  2RO1 A;  4O71 A;  5L96 A;  4UIV A;  2G45 A;  2MIQ A;  2H0D B;  2OWA A;  3FJU B;  3O7A A;  4P5O B;  4OGJ A;  2L5E A;  1JOC A;  4OUF A;  5HJC A;  4CA1 A;  4YH4 A;  2YEM A;  4YYN A;  5CUG A;  2K4D A;  4A9F A;  3KNV A;  3HCT A;  2VJE B;  4Z6I A;  4F52 B;  5HLS A;  4XY9 A;  5EV9 A;  3FL2 A;  2I7K A;  5A5O A;  5L98 A;  1IYM A;  5CQ8 A;  3GL6 A;  5FFV A;  4NRB A;  1ZKR A;  5H9M A;  4BBQ A;  4YYD A;  5F3A A;  2JUN A;  2KKX A;  5HQ6 A;  2KWK A;  2YQD A;  4O7C A;  1BOR A;  5DBM A;  5HRX A;  4LZ2 A;  2LXP C;  4YC9 A;  3O34 A;  5E7D A;  2VNF A;  4A9E A;  2RFJ A;  2YW5 A;  5I80 A;  4QUU A;  5ENB A;  4XY8 A;  2WP1 A;  1E6I A;  4DON A;  4N4I A;  4FO9 A;  5B77 A;  2LQ6 A;  5LJ0 A;  2XP0 A;  1K2F A;  4LZR A;  5FE4 A;  1LDJ B;  3KV6 A;  2M85 A;  2MUM A;  5ENI A;  3HMH A;  4NYX A;  5ENJ A;  3JVK A;  4Z6H A;  4TS8 A;  4V3L C;  4X3G A;  5ETB A;  2GRC A;  2RS9 B;  4A9H A;  4ALG A;  5FE7 A;  2B0O E;  5TRB A;  4IOO A;  4S3O B;  4PY6 A;  2L80 A;  5HRW A;  5EWV A;  5CUE A;  3M63 A;  4QSR A;  5EWC A;  1T1H A;  2C2V S;  2YW8 A;  4N4G A;  3D1D A;  5CP5 A;  5I88 A;  2YUR A;  3DPL R;  4HXM A;  2FD4 A;  2DKW A;  3DDT A;  5IID A;  1VD4 A;  2ZET C;  3QZS A;  5AMF A;  1WUG A;  4Z0R A;  4YK0 A;  5J3X A;  4UIZ A;  5A5Q A;  5CQ4 A;  5DYC A;  3VK6 A;  1WEE A;  3FAN A;  4IR4 A;  2R0V A;  2YHN A;  3UV2 A;  2DJA A;  3KDE C;  1VFY A;  5EA1 A;  4WZ0 A;  4WZ3 B;  5L99 A;  2VPB A;  5L8T A;  4FLP A;  5KU3 A;  5II2 A;  5A81 A;  5LCW B;  4YAD A;  1WEW A;  3LJW A;  5I86 A;  5DW2 A;  5COI A;  2C2L A;  4AP4 A;  4BW2 A;  5CUC A;  5F62 A;  3U5P A;  5LKT A;  4MR5 A;  5TCM A;  3DAI A;  4QSP A;  3AQA A;  2LGV A;  4C67 A;  1MM2 A;  5JWM A;  3RCW A;  4YYM A;  5E73 A;  1PUO A;  4HBX A;  3N9Q A;  5AIT A;  4FJC A;  4C66 A;  5D3S A;  2DVV A;  4Y03 A;  5EI4 A;  2ECN A;  4TTE A;  3S91 A;  4I7D A;  2LGL A;  4TT6 A;  4OGC A;  2G43 A;  3N9N A;  5FB1 A;  4QSQ A;  4CFL A;  2I50 A;  3K2J A;  4O7E A;  3HMF A;  2LSP B;  4NQM A;  5CZG A;  4ALH A;  4MR3 A;  4QZS A;  2Y1M A;  2L0B A;  3M99 A;  4A4C A;  5DYU A;  1JM7 A;  3P1F A;  2OSS A;  5EM3 A;  4HXO A;  4WIV A;  2PUY A;  5SVX A;  4HXS A;  4TU4 A;  3ZNI A;  4LYI A;  2XOY A;  5F2P A;  4YAX A;  4QR4 A;  5EQ1 A;  2KIZ A;  5CQ7 A;  2F42 A;  5DLX A;  4QSS A;  5TDW A;  4LR6 A;  2ECG A;  4HXL A;  5F60 A;  3GG3 A;  5BT3 A;  5AD2 A;  4UYF A;  5F61 A;  5A7C A;  3D1B A;  5I7Y A;  1XWH A;  2EOD A;  1X0J A;  5KTW A;  2JRJ A;  4WHU A;  5H1U A;  3O35 A;  2CT2 A;  2LV9 A;  4IR5 A;  4UIW A;  4Q0N A;  5L97 A;  4PCE A;  5HQ7 A;  2KFT A;  5DFB A;  3SVG A;  4Z93 A;  4I7C A;  5C85 A;  4UYF B;  5D1L B;  5E74 A;  3FM8 C;  5IGM A;  3ONI A;  4KCX A;  2QIZ A;  4BW3 A;  5CY9 A;  1MM3 A;  3JVM A;  2MD8 C;  4QEW A;  5DIN A;  4Z1Q A;  4IR3 A;  4NUE A;  5FH8 A;  4GPJ A;  4GNE A;  5KHM A;  4ZDT A;  4ZW1 A;  2MD7 B;  1WIL A;  2ECW A;  4V3K C;  3N9P A;  4O7F A;  5CPE A;  5E9V A;  5EP7 A;  2KE1 A;  2XB1 A;  5HEM A;  3O47 A;  3NXB A;  5KTU A;  2HYE D;  3SUB A;  4CCG X;  4GB0 A;  5TDR A;  5D7X A;  2K1J A;  4AKH A;  4LRG A;  3C6W A;  3U5J A;  5LKU A;  5CRM A;  5DLZ A;  5HFR A;  2KKY A;  4BW4 A;  5TAB A;  4YBT A;  5CS8 A;  3EB6 A;  4XI1 A;  4YYK A;  3DWD A;  2KGI A;  3D7C A;  4FK5 A;  2DVQ A;  5E9I A;  2YSM A;  1WEO A;  2DVR A;  4W4U A;  2CON A;  4MEO A;  3ZTG A;  4TU6 A;  4HXK A;  2LN0 A;  4WHW A;  3ZYQ A;  2YQL A;  4WZ2 A;  5FE6 A;  2KRE A;  5A82 A;  2I8N A;  2CSZ A;  2KWN A;  3RTR B;  4BHW A;  2K16 A;  4J0R A;  3NG2 A;  5CUD A;  5G4S A;  3UW9 A;  4LZS A;  5ENC A;  5FE0 A;  3UV5 A;  1F68 A;  4QBM A;  5KO4 A;  4UYE A;  4QC1 A;  2KU3 A;  3HTK C;  3RPG B;  5D3J A;  5G4R A;  4B7Y C;  4UIT A;  4NRC A;  3Q2E A;  5E9L A;  5EIS A;  5CQT A;  4CUR A;  2G6Q A;  4UI9 B;  2XEU A;  4KV1 A;  4MR4 A;  5I29 A;  5JI8 A;  3C5K A;  3PLW A;  4QSW A;  5IGN A;  5I89 A;  5B76 A;  2OO1 A;  4O74 A;  4QSX A;  2DWW A;  4LJN A;  4O77 A;  2KGG A;  5LJ1 A;  5CQ5 A;  5G04 B;  3FKM X;  4LYS A;  5C87 A;  4XUB A;  4NR7 A;  4IOR A;  3MHS A;  5EPS A;  4CUS A;  5CRZ A;  1Z2Q A;  4YYI A;  3LQJ A;  2Y43 A;  5DYX A;  2FUU A;  5SVI A;  3LRQ A;  3N9O A;  2VP7 A;  3LVR E;  4OGI A;  4UIX A;  5ENH A;  2RSD A;  2PNX A;  5A85 A;  5A5P A;  5B79 A;  1G25 A;  4C9Z A;  2FUI A;  4CFK A;  5C11 A;  3QZV A;  3QZT A;  4AVX A;  2WP2 A;  5CGP A;  5EVA A;  5FFW A;  4YY6 A;  5LVQ A;  3UVD A;  5D25 A;  2YEK A;  3SVH A;  5IBN A;  5HRV A;  2M3H A;  5EWW A;  2MNZ A;  4A9J A;  4A4B A;  4UYD A;  3ZVY A;  3G0J A;  4BJX A;  3L1X A;  5FDZ A;  2L43 A;  1ZBD B;  5SVI B;  3MXF A;  2CKL A;  3U5M A;  3UV4 A;  5FEY A;  5DFD A;  2AN6 A;  2JMD A;  3L11 A;  5E3G A;  2HDP A;  4NQN A;  3KV5 A;  1FBV A;  4B86 C;  5FH6 A;  5FER A;  4N3W A;  1CHC A;  2QJ0 A;  5CU8 A;  3S92 A;  1WEN A;  2D9E A;  5G0F A;  5D3R A;  3T7L A;  5DFC A;  2MA5 A;  3T9K A;  5DW1 A;  4RVR A;  3P1E A;  4PKL A;  5CFW A;  2KR4 A;  3IHP A;  4IC2 A;  5D1M B;  4NRA A;  4A9M A;  4WA6 A;  4QEU A;  1X4J A;  1FP0 A;  3O70 A;  2LGG A;  4MR6 A;  4GND A;  5KH3 A;  3MB4 A;  2CKL B;  4QQ4 A;  3FEH A;  4AKG A;  4F3I A;  3U5O A;  2BAY A;  4Z1S A;  2Y1N A;  3SOW A;  2NAA A;  2K17 A;  4CLB A;  1DCQ A;  4I7B A;  2R10 A;  5D3L A;  5H1T A;  2M13 A;  4YYJ A;  5EPR A;  3N9M A;  3LQH A;  4NR4 A;  5AD3 A;  2ECV A;  3Q1D A;  4QF3 A;  4Z0O A;  5F5Z A;  4AYC A;  4F1P A;  5FG6 A;  5SVY A;  3ZPV 1;  5DX4 A;  5A5S A;  5DKA A;  5G05 B;  5I3L A;  4R2Y A;  4NR5 A;  5CUA A;  5EGU A;  3MUK A;  2NXB A;  2F6J A;  3IU5 A;  4YAT A;  5LKX A;  4QF2 A;  5EU1 A;  4NS5 A;  3L1Z B;  4YBM A;  3LVQ E;  1WGM A;  2LGK A;  3RPG C;  4GNF A;  5FH7 A;  1V87 A;  4KV4 A;  2DVS A;  4QUT A;  3ERR A;  5H85 A;  1N72 A;  1WE9 A;  3JVJ A;  1ZS5 A;  1JSP B;  2CSV A;  2FFW A;  2LAU A;  1DVP A;  4L7X A;  2MA6 A;  2F6N A;  4TYL A; 
#chains in the Genus database with same CATH homology
 5E9Y A;  3GV4 A;  4NR6 A;  5CQ3 A;  2N9G A;  4QR3 A;  4AYC B;  3I3J A;  2E7N A;  2VPD A;  2M1R A;  3ZVZ B;  4O76 A;  4ZC9 A;  1E4U A;  5BT4 A;  1WES A;  3UVY A;  2YQM A;  5FE3 A;  3O36 A;  4QB3 A;  2EGP A;  4CL9 A;  4QYD A;  4A9N A;  1WEP A;  2ECI A;  3HCU A;  3SOX A;  5A83 A;  5D3T A;  4Q6F A;  4NR9 A;  5HEL A;  5I7X A;  5II1 A;  4LKA A;  2VPG A;  5LJ2 A;  2YHO A;  2KWO A;  5FE9 A;  4N4H A;  2QIC A;  4PCI A;  4A9L A;  5LKZ A;  4O7B A;  2E6S A;  4IC3 A;  2RI7 A;  4AKN A;  3PUR A;  1VYX A;  5D0C A;  4X2I A;  1WFK A;  4CUT A;  5ACY A;  4HBY A;  2RNY A;  5F25 A;  4HXN A;  4J3I A;  4UP0 A;  4LC2 A;  1WEM A;  1HYJ A;  4O75 A;  4Q0O A;  5F63 A;  3U5N A;  5C89 A;  3MUL A;  4L58 A;  3ZYU A;  4CUQ A;  5EIC A;  5CQ6 A;  3T6R A;  4HXR A;  4A49 A;  5C8G A;  2KWJ A;  5F1H A;  2R0S A;  1WIM A;  4HBW A;  2VPE A;  5FE1 A;  4O78 A;  4TZ2 A;  4A9I A;  2FSA A;  4LK9 A;  5FE5 A;  4R8P K;  2DAT A;  5C4Q A;  2JMI A;  2YEL A;  5FB0 A;  5EK9 A;  3O33 A;  2VJF A;  5DKD A;  1LDK C;  4PS5 A;  2CSY A;  5EPB A;  5TB6 A;  2E3K A;  4HXP A;  5I83 A;  2RNX A;  2KYU A;  3P1C A;  5CQA A;  2YU4 A;  2YUC A;  5FE8 A;  4MEQ A;  4LLB A;  4GNG A;  5D3H A;  5L8U A;  4TZ8 A;  4YAB A;  4N4F A;  5E3D A;  3TLP A;  3KQI A;  5EWH A;  2EA6 A;  4PTB A;  3AAD A;  2OXQ C;  5HCL A;  4NUC A;  4BW1 A;  5HQ5 A;  5AIU A;  1WEQ A;  3SVF A;  3I2D A;  1X4I A;  3DWY A;  3P5O A;  4MEN A;  4A9O A;  1X4U A;  2UZG A;  1WUM A;  2IDA A;  4IOQ A;  4ZQL A;  2VJF B;  5B75 A;  2MNY A;  5A5R A;  5ETD A;  4QR5 A;  5HFQ A;  5ENE A;  3JVL A;  3N9L A;  2ECJ A;  4ZUX U;  3G0L A;  5I40 A;  4NN2 A;  2R0Y A;  3O37 A;  5DKC A;  4TT4 A;  2OUO A;  3P1D A;  4TT2 A;  5E9K A;  2DX8 A;  2YYR A;  4QST A;  2L5U A;  4QC3 A;  4O7A A;  3V43 A;  3PHD A;  2YT5 A;  3MHH A;  2H60 A;  5D1K B;  4XUA A;  3U5K A;  4LYW A;  4IR6 A;  1EQF A;  4NYV A;  4UP5 A;  2E6R A;  5D26 A;  5ENF A;  4YYG A;  5C7N A;  4UIY A;  5D3N A;  4A9K A;  3DQV R;  3SHB A;  1WEV A;  4A0C D;  4PPE A;  4YBS A;  5B78 A;  5KH7 A;  5EYA F;  5IGK A;  2D8S A;  4QEV A;  5I1Q A;  5A5N A;  5BT5 A;  5TBN A;  1RMD A;  4QNS A;  3PUQ A;  3EB5 A;  4MSX A;  5KH9 A;  5HM0 A;  2LDR A;  3U5L A;  3M62 A;  3ZPV E;  5FG5 A;  4UIU A;  2YRE A;  4O64 A;  4QSV A;  5DKH A;  3Q2F A;  4E96 A;  2ECT A;  1Z60 A;  3MQM A;  4XYA A;  4UYG A;  3LXJ A;  4TQN A;  4NUD A;  5B8D A;  5FFY A;  2G4A A;  1JM4 B;  4QSU A;  5ENG A;  5FG4 A;  2D82 A;  2LXH C;  5D24 A;  5JG6 A;  5H1V A;  4CUP A;  1U6G B;  3HME A;  4O72 A;  4MVT A;  3SOU A;  5C13 A;  5EWD A;  3ASL A;  2M6M A;  5CUB A;  4MEP A;  1N87 A;  2MJV B;  1Z6U A;  5E9M A;  2RNW A;  5CTL A;  5IG6 A;  2JMJ A;  5LUU A;  5KTX A;  4NYW A;  3IU6 A;  3HCS A;  5J0D A;  4NR8 A;  5AME A;  1JM7 B;  2L75 A;  4LAD B;  4QYL A;  3LQI A;  5F36 A;  4FIP A;  4YH3 A;  4YYH A;  5K29 A;  2H0D A;  4HBV A;  4UYH A;  5IGL A;  2MT5 A;  2E7O A;  2L85 A;  3MB3 A;  4CUU A;  2YDW A;  4LDF A;  4J0S A;  1WEU A;  4R7E A;  5FE2 A;  2VJE A;  3UVW A;  5F1L A;  3UVX A;  4QY4 A;  1HYI A;  5DYA A;  2L84 A;  5D3P A;  4S3O C;  5FBX A;  4TKP B;  5E0R A;  2YYN A;  4O70 A;  2YSJ A;  2LRI C;  5HEN A;  4YY4 A;  4AUQ B;  5LVR A;  1F62 A;  4J1P A;  4NXJ A;  2KTB B;  5DY7 A;  2RO1 A;  4O71 A;  5L96 A;  4UIV A;  2G45 A;  2MIQ A;  2H0D B;  3O7A A;  4P5O B;  4OGJ A;  2L5E A;  1JOC A;  4OUF A;  5HJC A;  4CA1 A;  4YH4 A;  2YEM A;  4YYN A;  5CUG A;  2K4D A;  4A9F A;  3KNV A;  3HCT A;  2VJE B;  4Z6I A;  4F52 B;  5HLS A;  4XY9 A;  5EV9 A;  3FL2 A;  2I7K A;  5A5O A;  5L98 A;  1IYM A;  5CQ8 A;  3GL6 A;  5FFV A;  4NRB A;  4BBQ A;  5H9M A;  4YYD A;  5F3A A;  5HQ6 A;  2KWK A;  2YQD A;  4O7C A;  1BOR A;  5DBM A;  5HRX A;  4LZ2 A;  2LXP C;  4YC9 A;  3O34 A;  5E7D A;  2VNF A;  4A9E A;  2RFJ A;  2YW5 A;  5I80 A;  4QUU A;  5ENB A;  4XY8 A;  2WP1 A;  1E6I A;  4DON A;  4N4I A;  4FO9 A;  5B77 A;  2LQ6 A;  5LJ0 A;  1K2F A;  4LZR A;  5FE4 A;  1LDJ B;  3KV6 A;  2M85 A;  2MUM A;  5ENI A;  3HMH A;  4NYX A;  5ENJ A;  3JVK A;  4Z6H A;  4TS8 A;  4V3L C;  4X3G A;  5ETB A;  2GRC A;  2RS9 B;  4A9H A;  4ALG A;  5FE7 A;  5TRB A;  4IOO A;  4S3O B;  4PY6 A;  2L80 A;  5HRW A;  5EWV A;  5CUE A;  3M63 A;  4QSR A;  5EWC A;  1T1H A;  2C2V S;  2YW8 A;  4N4G A;  5CP5 A;  5I88 A;  2YUR A;  3DPL R;  4HXM A;  2DKW A;  5IID A;  1VD4 A;  2ZET C;  3QZS A;  5AMF A;  1WUG A;  4YK0 A;  5J3X A;  4UIZ A;  5A5Q A;  5CQ4 A;  5DYC A;  3VK6 A;  1WEE A;  4IR4 A;  2R0V A;  2YHN A;  3UV2 A;  1VFY A;  5EA1 A;  4WZ0 A;  4WZ3 B;  5L99 A;  2VPB A;  5L8T A;  4FLP A;  5KU3 A;  5II2 A;  5A81 A;  5LCW B;  4YAD A;  1WEW A;  3LJW A;  5I86 A;  5DW2 A;  5COI A;  2C2L A;  4AP4 A;  4BW2 A;  5CUC A;  5F62 A;  3U5P A;  5LKT A;  4MR5 A;  5TCM A;  3DAI A;  4QSP A;  3AQA A;  2LGV A;  4C67 A;  1MM2 A;  5JWM A;  3RCW A;  4YYM A;  5E73 A;  4HBX A;  3N9Q A;  5AIT A;  4FJC A;  4C66 A;  5D3S A;  2DVV A;  4Y03 A;  5EI4 A;  2ECN A;  4TTE A;  3S91 A;  4I7D A;  2LGL A;  4TT6 A;  2G43 A;  3N9N A;  5FB1 A;  4QSQ A;  4CFL A;  2I50 A;  3K2J A;  4O7E A;  3HMF A;  2LSP B;  4NQM A;  5CZG A;  4ALH A;  4MR3 A;  4QZS A;  2Y1M A;  2L0B A;  3M99 A;  4A4C A;  5DYU A;  1JM7 A;  3P1F A;  2OSS A;  5EM3 A;  4HXO A;  4WIV A;  2PUY A;  4HXS A;  4TU4 A;  3ZNI A;  4LYI A;  5F2P A;  4YAX A;  4QR4 A;  5EQ1 A;  2KIZ A;  5CQ7 A;  2F42 A;  5DLX A;  4QSS A;  5TDW A;  4LR6 A;  2ECG A;  4HXL A;  5F60 A;  3GG3 A;  5BT3 A;  5AD2 A;  4UYF A;  5F61 A;  5A7C A;  5I7Y A;  1XWH A;  2EOD A;  1X0J A;  5KTW A;  2JRJ A;  4WHU A;  5H1U A;  3O35 A;  2CT2 A;  2LV9 A;  4IR5 A;  4UIW A;  4Q0N A;  5L97 A;  4PCE A;  5HQ7 A;  2KFT A;  5DFB A;  3SVG A;  4Z93 A;  4I7C A;  5C85 A;  4UYF B;  5D1L B;  5E74 A;  5IGM A;  3ONI A;  4KCX A;  2QIZ A;  4BW3 A;  5CY9 A;  1MM3 A;  3JVM A;  2MD8 C;  4QEW A;  5DIN A;  4Z1Q A;  4IR3 A;  4NUE A;  5FH8 A;  4GPJ A;  4GNE A;  5KHM A;  4ZDT A;  4ZW1 A;  2MD7 B;  1WIL A;  2ECW A;  4V3K C;  3N9P A;  4O7F A;  5CPE A;  5E9V A;  5EP7 A;  2KE1 A;  2XB1 A;  5HEM A;  3NXB A;  5KTU A;  2HYE D;  4CCG X;  4GB0 A;  5TDR A;  5D7X A;  2K1J A;  4LRG A;  3C6W A;  3U5J A;  5LKU A;  5CRM A;  5DLZ A;  5HFR A;  5TAB A;  4BW4 A;  4YBT A;  5CS8 A;  3EB6 A;  4XI1 A;  4YYK A;  2KGI A;  3D7C A;  4FK5 A;  2DVQ A;  5E9I A;  2YSM A;  1WEO A;  2DVR A;  4W4U A;  4MEO A;  3ZTG A;  4TU6 A;  4HXK A;  2LN0 A;  4WHW A;  3ZYQ A;  2YQL A;  4WZ2 A;  5FE6 A;  2KRE A;  5A82 A;  2I8N A;  2CSZ A;  2KWN A;  3RTR B;  4BHW A;  2K16 A;  4J0R A;  3NG2 A;  5CUD A;  5G4S A;  3UW9 A;  4LZS A;  5ENC A;  5FE0 A;  3UV5 A;  1F68 A;  4QBM A;  5KO4 A;  4UYE A;  4QC1 A;  2KU3 A;  3HTK C;  3RPG B;  5D3J A;  5G4R A;  4UIT A;  4NRC A;  3Q2E A;  5E9L A;  5EIS A;  5CQT A;  4CUR A;  2G6Q A;  4UI9 B;  2XEU A;  4KV1 A;  4MR4 A;  5I29 A;  5JI8 A;  3C5K A;  4QSW A;  5IGN A;  5I89 A;  5B76 A;  2OO1 A;  4O74 A;  4QSX A;  2DWW A;  4LJN A;  4O77 A;  2KGG A;  5LJ1 A;  5CQ5 A;  5G04 B;  3FKM X;  4LYS A;  5C87 A;  4XUB A;  4NR7 A;  4IOR A;  3MHS A;  5EPS A;  4CUS A;  5CRZ A;  1Z2Q A;  4YYI A;  3LQJ A;  2Y43 A;  5DYX A;  2FUU A;  3LRQ A;  3N9O A;  2VP7 A;  4OGI A;  4UIX A;  5ENH A;  2RSD A;  2PNX A;  5A85 A;  5A5P A;  5B79 A;  1G25 A;  4C9Z A;  2FUI A;  4CFK A;  5C11 A;  3QZV A;  3QZT A;  4AVX A;  2WP2 A;  5CGP A;  5EVA A;  5FFW A;  4YY6 A;  5LVQ A;  3UVD A;  5D25 A;  2YEK A;  3SVH A;  5IBN A;  5HRV A;  2M3H A;  5EWW A;  2MNZ A;  4A9J A;  4A4B A;  4UYD A;  3ZVY A;  3G0J A;  4BJX A;  3L1X A;  5FDZ A;  2L43 A;  1ZBD B;  3MXF A;  2CKL A;  3U5M A;  3UV4 A;  5FEY A;  5DFD A;  2AN6 A;  2JMD A;  3L11 A;  5E3G A;  2HDP A;  4NQN A;  3KV5 A;  1FBV A;  4B86 C;  5FH6 A;  5FER A;  4N3W A;  1CHC A;  2QJ0 A;  5CU8 A;  3S92 A;  1WEN A;  2D9E A;  5G0F A;  5D3R A;  3T7L A;  5DFC A;  2MA5 A;  5DW1 A;  4RVR A;  3P1E A;  4PKL A;  5CFW A;  2KR4 A;  3IHP A;  4IC2 A;  5D1M B;  4NRA A;  4A9M A;  4WA6 A;  4QEU A;  1X4J A;  1FP0 A;  3O70 A;  2LGG A;  4MR6 A;  4GND A;  5KH3 A;  3MB4 A;  2CKL B;  4F3I A;  3U5O A;  2BAY A;  4Z1S A;  2Y1N A;  3SOW A;  2NAA A;  2K17 A;  4CLB A;  4I7B A;  2R10 A;  5D3L A;  5H1T A;  3N9M A;  4YYJ A;  5EPR A;  3LQH A;  4NR4 A;  5AD3 A;  2ECV A;  4QF3 A;  5F5Z A;  4AYC A;  5FG6 A;  3ZPV 1;  5DX4 A;  5A5S A;  5DKA A;  5G05 B;  5I3L A;  4R2Y A;  4NR5 A;  5CUA A;  5EGU A;  3MUK A;  2NXB A;  2F6J A;  3IU5 A;  4YAT A;  5LKX A;  4QF2 A;  5EU1 A;  4NS5 A;  3L1Z B;  4YBM A;  1WGM A;  2LGK A;  3RPG C;  4GNF A;  5FH7 A;  1V87 A;  4KV4 A;  2DVS A;  4QUT A;  5H85 A;  4B7Y C;  1N72 A;  1WE9 A;  3JVJ A;  1ZS5 A;  1JSP B;  1DVP A;  4L7X A;  2MA6 A;  2F6N A;  4TYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...