4R2YA

Crystal structure of apc11 ring domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
ENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Anaphase-promoting complex subunit 11
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r2yA00
3N9NA 1CHCA 2KWJA 1JM7A 4QF2A 4X3GA 5JG6A 2MT5A 5FB0A 3LQJA 4GNEA 2EODA 2ECWA 4ZUXU 3QZVA 5B76A 2BAYA 2C2LA 2VJEB 3HCUA 4FO9A 4LJNA 3I2DA 3ZVYA 2F6NA 3ZPVE 3N9OA 1X4UA 2KWOA 3U5MA 4A49A 2HYED 4FJCA 2DX8A 3SHBA 1WEEA 1WESA 5LKXA 2YW8A 1Z2QA 5C13A 2JMIA 5H1TA 4S3OB 3N9QA 3O37A 5TRBA 3VK6A 2G43A 2MNYA 2KE1A 3LRQA 5B79A 2XB1A 2VP7A 2K1JA 2H0DB 2YURA 3EB6A 1WFKA 1ZBDB 4R2YA 4AUQB 4XI1A 2L43A 4O64A 1FP0A 3DPLR 3PUQA 2VJFB 4YABA 5AIUA 2YSMA 2KU3A 2L0BA 4YAXA 4C9ZA 2M6MA 2D8SA 2L80A 5D1LB 4LK9A 2LQ6A 4ZQLA 2VPEA 5TDWA 1LDKC 2M85A 2L75A 2YQLA 2FUUA 4YC9A 2G45A 1K2FA 4I7DA 2PUYA 1WEUA 5FEYA 2CT2A 2E6SA 2ECVA 4Q6FA 4YATA 3C5KA 1T1HA 5LCWB 3IHPA 2CKLB 2LRIC 4B7YC 4R8PK 4CCGX 2ECGA 4TKPB 4L58A 2NAAA 2VJEA 1MM2A 4V3KC 3MHHA 3L11A 3O70A 2KWNA 3V43A 4BBQA 4I7BA 2YHOA 3RTRB 1WILA 2UZGA 1RMDA 4CA1A 2L5UA 2LGLA 2VPDA 2Y1NA 2C2VS 3M99A 2OXQC 4B86C 2KGIA 2MD8C 2JMDA 4QF3A 4FK5A 4IC3A 4W4UA 1WEQA 2ZETC 5LKUA 4P5OB 2M3HA 4WZ3B 5DINA 1VFYA 4WZ2A 3HCSA 3ZNIA 2MD7B 1G25A 2LGVA 3EB5A 4GNGA 3N9LA 4V3LC 2ECJA 2QIZA 5KH7A 4GNFA 2IDAA 5I3LA 1FBVA 2LN0A 2LXHC 2I50A 3M62A 2YU4A 5C11A 2E6RA 2MA5A 3C6WA 1JOCA 5TABA 3KV6A 2H0DA 2CSYA 4AYCB 3ASLA 2RI7A 2VPGA 4AYCA 4UP0A 3RPGC 5H1UA 1F62A 4I7CA 4ZDTA 3LQHA 2MUMA 1V87A 3PHDA 4WA6A 4A0CD 4YADA 2YYRA 1WEOA 2CKLA 4LADB 3U5NA 1X4JA 3LQIA 4AVXA 2KYUA 1X4IA 2JRJA 2KR4A 5G04B 2JMJA 2RSDA 5FB1A 3FL2A 2VJFA 3DQVR 1LDJB 2LGGA 2YT5A 5B78A 4F52B 2LXPC 2YHNA 3KV5A 4N3WA 2QICA 4NN2A 3ZPV1 2K16A 2MIQA 5LKTA 1BORA 3RPGB 3L1ZB 1WEPA 2K17A 2FUIA 5KH9A 2HDPA 4A4BA 2KFTA 4FIPA 4YBSA 1WENA 1HYIA 1N87A 3N9MA 4GNDA 3T7LA 2YSJA 2CSZA 1JM7B 4R7EA 2YQMA 4L7XA 3N9PA 4WZ0A 3U5OA 2LV9A 2AN6A 3GL6A 5B8DA 4MVTA 2FSAA 5D1KB 3SOUA 4AP4A 2LDRA 3U5PA 2F42A 5EYAF 2G6QA 5B75A 3MHSA 2EA6A 2KIZA 4A4CA 4N4FA 1WEMA 4UI9B 5G0FA 4MSXA 2KREA 5B77A 1IYMA 1U6GB 3O36A 5TDRA 5LKZA 5H1VA 5J3XA 2F6JA 2EGPA 4S3OC 1WE9A 2ECNA 2YUCA 5AITA 3SOWA 4GB0A 1DVPA 2QJ0A 3O33A 3T6RA 2VPBA 4UP5A 2YREA 4LLBA 4LKAA 2Y1MA 3O34A 4IC2A 3PURA 1Z6UA 3KQIA 1WEWA 5G05B 5TBNA 2PNXA 3GV4A 5FERA 1Z60A 3ZTGA 2K4DA 2Y43A 2M1RA 4BHWA 3ZYQA 4YBMA 3O35A 2ECTA 2MA6A 4PTBA 3ZVZB 2KGGA 2XEUA 3M63A 1MM3A 3HCTA 1WGMA 2KWKA 1VYXA 5D1MB 1VD4A 1E4UA 4PPEA 3HTKC 3SOXA 3L1XA 1XWHA 2MNZA 1WIMA 2LGKA 4YBTA 3KNVA 3O7AA 5DKAA 5H9MA 5KH3A 1HYJA 2ECIA 2VNFA 3NG2A 1WEVA
chains in the Genus database with same CATH superfamily
3N9NA 1CHCA 2KWJA 3KDEC 1JM7A 4QF2A 4X3GA 5JG6A 2MT5A 5FB0A 3LQJA 4GNEA 2EODA 2ECWA 4ZUXU 3QZVA 5B76A 2BAYA 2C2LA 2VJEB 3HCUA 4FO9A 4LJNA 3I2DA 1MBMA 3ZVYA 2EXUA 2F6NA 3Q1DA 3ZPVE 3N9OA 1X4UA 2KWOA 3U5MA 4A49A 2HYED 3FEHA 4FJCA 2DX8A 3SHBA 1WEEA 1WESA 5LKXA 2JUNA 2YW8A 1Z2QA 5C13A 2XP0A 3T9KA 1DCQA 2JMIA 3DDTA 5H1TA 4S3OB 3N9QA 3O37A 5SVIB 5TRBA 3VK6A 2G43A 2MNYA 2KE1A 3LRQA 5B79A 2XB1A 2VP7A 2KKXA 2K1JA 2H0DB 2YURA 3EB6A 1WFKA 1ZBDB 4R2YA 4AUQB 4XI1A 2IQJA 2L43A 5K3QA 4O64A 3M7KA 1FP0A 3LVRE 3DPLR 3PUQA 2VJFB 4YABA 5AIUA 2YSMA 2KU3A 2L0BA 4YAXA 3FAOA 4C9ZA 2M6MA 2D8SA 2L80A 5D1LB 4LK9A 2LQ6A 3O47A 4ZQLA 2VPEA 5TDWA 2YVRA 2XOZA 1LDKC 2M85A 2L75A 2YQLA 2FUUA 4YC9A 4F1PA 2G45A 1K2FA 4I7DA 2DSMA 2PUYA 1WEUA 5FEYA 2CT2A 2E6SA 2ECVA 4Q6FA 4YATA 3C5KA 1T1HA 5LCWB 3IHPA 2CKLB 2LRIC 4B7YC 4R8PK 4CCGX 2ECGA 4TKPB 4L58A 2NAAA 2VJEA 1MM2A 2CRWA 2FFWA 4V3KC 3FM8C 2KKYA 3MHHA 3L11A 3O70A 2KWNA 3V43A 4BBQA 4I7BA 2YHOA 3RTRB 1WILA 2UZGA 1RMDA 4CA1A 4H9DA 2L5UA 2LGLA 2VPDA 2P57A 2Y1NA 2C2VS 3M99A 2OXQC 4B86C 2L7PA 2KGIA 2MD8C 2JMDA 4Z0OA 4QF3A 4FK5A 3FANA 4IC3A 2CSVA 4W4UA 1WEQA 2ZETC 5LKUA 2OWAA 3LVQE 3H7HA 4P5OB 2M3HA 4WZ3B 5DINA 1VFYA 4WZ2A 3HCSA 2CONA 3ZNIA 2MD7B 1G25A 2LGVA 3EB5A 2B0OE 2E61A 4GNGA 3N9LA 4V3LC 2ECJA 3LJUX 2QIZA 3MDBC 5KH7A 4GNFA 2IDAA 5SVIA 5I3LA 1FBVA 2LN0A 2MKEA 2LXHC 2I50A 3M62A 2YU4A 5C11A 2E6RA 2MA5A 3C6WA 1JOCA 5TABA 3KV6A 2H0DA 2CSYA 4AYCB 3ASLA 2RI7A 2VPGA 2DJAA 4QQ4A 4AYCA 4UP0A 5SVYA 3RPGC 5H1UA 1F62A 2RR4A 4I7CA 4ZDTA 3LQHA 2MUMA 1V87A 3PHDA 4WA6A 3FJUB 4A0CD 4YADA 2YYRA 1WEOA 2CKLA 4LADB 3U5NA 1X4JA 3LQIA 4AVXA 2KYUA 1X4IA 2JRJA 4OGCA 2KR4A 5G04B 2JMJA 2LAUA 2RSDA 5FB1A 3FL2A 2VJFA 3DQVR 1LDJB 2LGGA 2YT5A 5B78A 4F52B 2LXPC 2YHNA 3KV5A 4N3WA 2QICA 4NN2A 3ZPV1 2K16A 2MIQA 5LKTA 1BORA 3RPGB 3L1ZB 1WEPA 2K17A 2FUIA 2M13A 5KH9A 2FD4A 2HDPA 4A4BA 2KFTA 4FIPA 4YBSA 1WENA 1HYIA 1N87A 3N9MA 4GNDA 3T7LA 2YSJA 2CSZA 1JM7B 4R7EA 3JUEA 3PLWA 2YQMA 4L7XA 3N9PA 4WZ0A 3U5OA 2LV9A 2AN6A 3GL6A 5B8DA 4MVTA 2FSAA 5D1KB 3SOUA 4AP4A 2LDRA 3U5PA 2F42A 5EYAF 2G6QA 4Z0RA 5B75A 3MHSA 4OGEA 2JM3A 2EA6A 2KIZA 4A4CA 4N4FA 2D8UA 2EGMA 1WEMA 4UI9B 5G0FA 4MSXA 2KREA 5B77A 1IYMA 1U6GB 3O36A 2XOYA 3DWDA 5TDRA 5LKZA 5H1VA 5J3XA 2F6JA 2EGPA 4S3OC 1WE9A 2ECNA 2YUCA 5AITA 3SOWA 4GB0A 2CRRA 1DVPA 2QJ0A 3O33A 3T6RA 2VPBA 4UP5A 2YREA 4LLBA 5SVXA 4LKAA 2XOCA 2Y1MA 3O34A 4IC2A 3PURA 1Z6UA 3KQIA 1WEWA 5G05B 5TBNA 2PNXA 3GV4A 5FERA 3LDYA 1Z60A 3ZTGA 2K4DA 2Y43A 2M1RA 3E2DA 4BHWA 3ZYQA 4YBMA 3O35A 2ECTA 2MA6A 4PTBA 3ZVZB 2KGGA 2XEUA 3M63A 1MM3A 3HCTA 1WGMA 2KWKA 1VYXA 5D1MB 1VD4A 1E4UA 4PPEA 3HTKC 3SUBA 3SOXA 3L1XA 1XWHA 2MNZA 1WIMA 2LGKA 4YBTA 3KNVA 3O7AA 5DKAA 5H9MA 5KH3A 1HYJA 2ECIA 4O62A 2VNFA 3NG2A 1WEVA
chains in the Genus database with same CATH topology
3N9NA 1CHCA 2KWJA 1JM7A 4QF2A 4X3GA 5JG6A 2MT5A 5FB0A 3LQJA 4GNEA 2EODA 2ECWA 4ZUXU 3QZVA 5B76A 2BAYA 2C2LA 2VJEB 3HCUA 4FO9A 4LJNA 3I2DA 3ZVYA 2F6NA 3ZPVE 3N9OA 1X4UA 2KWOA 3U5MA 4A49A 2HYED 4FJCA 2DX8A 3SHBA 1WEEA 1WESA 5LKXA 2YW8A 1Z2QA 5C13A 2JMIA 5H1TA 4S3OB 3N9QA 3O37A 5TRBA 3VK6A 2G43A 2MNYA 2KE1A 3LRQA 5B79A 2XB1A 2VP7A 2K1JA 2H0DB 2YURA 3EB6A 1WFKA 1ZBDB 4R2YA 4AUQB 4XI1A 2L43A 4O64A 1FP0A 3DPLR 3PUQA 2VJFB 4YABA 5AIUA 2YSMA 2KU3A 2L0BA 4YAXA 4C9ZA 2M6MA 2D8SA 2L80A 5D1LB 4LK9A 2LQ6A 4ZQLA 2VPEA 5TDWA 1LDKC 2M85A 2L75A 2YQLA 2FUUA 4YC9A 2G45A 1K2FA 4I7DA 2PUYA 1WEUA 5FEYA 2CT2A 2E6SA 2ECVA 4Q6FA 4YATA 3C5KA 1T1HA 5LCWB 3IHPA 2CKLB 2LRIC 4B7YC 4R8PK 4CCGX 2ECGA 4TKPB 4L58A 2NAAA 2VJEA 1MM2A 4V3KC 3MHHA 3L11A 3O70A 2KWNA 3V43A 4BBQA 4I7BA 2YHOA 3RTRB 1WILA 2UZGA 1RMDA 4CA1A 2L5UA 2LGLA 2VPDA 2Y1NA 2C2VS 3M99A 2OXQC 4B86C 2KGIA 2MD8C 2JMDA 4QF3A 4FK5A 4IC3A 4W4UA 1WEQA 2ZETC 5LKUA 4P5OB 2M3HA 4WZ3B 5DINA 1VFYA 4WZ2A 3HCSA 3ZNIA 2MD7B 1G25A 2LGVA 3EB5A 4GNGA 3N9LA 4V3LC 2ECJA 2QIZA 5KH7A 4GNFA 2IDAA 5I3LA 1FBVA 2LN0A 2LXHC 2I50A 3M62A 2YU4A 5C11A 2E6RA 2MA5A 3C6WA 1JOCA 5TABA 3KV6A 2H0DA 2CSYA 4AYCB 3ASLA 2RI7A 2VPGA 4AYCA 4UP0A 3RPGC 5H1UA 1F62A 4I7CA 4ZDTA 3LQHA 2MUMA 1V87A 3PHDA 4WA6A 4A0CD 4YADA 2YYRA 1WEOA 2CKLA 4LADB 3U5NA 1X4JA 3LQIA 4AVXA 2KYUA 1X4IA 2JRJA 2KR4A 5G04B 2JMJA 2RSDA 5FB1A 3FL2A 2VJFA 3DQVR 1LDJB 2LGGA 2YT5A 5B78A 4F52B 2LXPC 2YHNA 3KV5A 4N3WA 2QICA 4NN2A 3ZPV1 2K16A 2MIQA 5LKTA 1BORA 3RPGB 3L1ZB 1WEPA 2K17A 2FUIA 5KH9A 2HDPA 4A4BA 2KFTA 4FIPA 4YBSA 1WENA 1HYIA 1N87A 3N9MA 4GNDA 3T7LA 2YSJA 2CSZA 1JM7B 4R7EA 2YQMA 4L7XA 3N9PA 4WZ0A 3U5OA 2LV9A 2AN6A 3GL6A 5B8DA 4MVTA 2FSAA 5D1KB 3SOUA 4AP4A 2LDRA 3U5PA 2F42A 5EYAF 2G6QA 5B75A 3MHSA 2EA6A 2KIZA 4A4CA 4N4FA 1WEMA 4UI9B 5G0FA 4MSXA 2KREA 5B77A 1IYMA 1U6GB 3O36A 5TDRA 5LKZA 5H1VA 5J3XA 2F6JA 2EGPA 4S3OC 1WE9A 2ECNA 2YUCA 5AITA 3SOWA 4GB0A 1DVPA 2QJ0A 3O33A 3T6RA 2VPBA 4UP5A 2YREA 4LLBA 4LKAA 2Y1MA 3O34A 4IC2A 3PURA 1Z6UA 3KQIA 1WEWA 5G05B 5TBNA 2PNXA 3GV4A 5FERA 1Z60A 3ZTGA 2K4DA 2Y43A 2M1RA 4BHWA 3ZYQA 4YBMA 3O35A 2ECTA 2MA6A 4PTBA 3ZVZB 2KGGA 2XEUA 3M63A 1MM3A 3HCTA 1WGMA 2KWKA 1VYXA 5D1MB 1VD4A 1E4UA 4PPEA 3HTKC 3SOXA 3L1XA 1XWHA 2MNZA 1WIMA 2LGKA 4YBTA 3KNVA 3O7AA 5DKAA 5H9MA 5KH3A 1HYJA 2ECIA 2VNFA 3NG2A 1WEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9N A;  1CHC A;  2KWJ A;  1JM7 A;  4QF2 A;  4X3G A;  5JG6 A;  2MT5 A;  5FB0 A;  3LQJ A;  4GNE A;  2EOD A;  2ECW A;  4ZUX U;  3QZV A;  5B76 A;  2BAY A;  2C2L A;  2VJE B;  3HCU A;  4FO9 A;  4LJN A;  3I2D A;  3ZVY A;  2F6N A;  3ZPV E;  3N9O A;  1X4U A;  2KWO A;  3U5M A;  4A49 A;  2HYE D;  4FJC A;  2DX8 A;  3SHB A;  1WEE A;  1WES A;  5LKX A;  2YW8 A;  1Z2Q A;  5C13 A;  2JMI A;  5H1T A;  4S3O B;  3N9Q A;  3O37 A;  5TRB A;  3VK6 A;  2G43 A;  2MNY A;  2KE1 A;  3LRQ A;  5B79 A;  2XB1 A;  2VP7 A;  2K1J A;  2H0D B;  2YUR A;  3EB6 A;  1WFK A;  1ZBD B;  4R2Y A;  4AUQ B;  4XI1 A;  2L43 A;  4O64 A;  1FP0 A;  3DPL R;  3PUQ A;  2VJF B;  4YAB A;  5AIU A;  2YSM A;  2KU3 A;  2L0B A;  4YAX A;  4C9Z A;  2M6M A;  2D8S A;  2L80 A;  5D1L B;  4LK9 A;  2LQ6 A;  4ZQL A;  2VPE A;  5TDW A;  1LDK C;  2M85 A;  2L75 A;  2YQL A;  2FUU A;  4YC9 A;  2G45 A;  1K2F A;  4I7D A;  2PUY A;  1WEU A;  5FEY A;  2CT2 A;  2E6S A;  2ECV A;  4Q6F A;  4YAT A;  3C5K A;  1T1H A;  5LCW B;  3IHP A;  2CKL B;  2LRI C;  4B7Y C;  4R8P K;  4CCG X;  2ECG A;  4TKP B;  4L58 A;  2NAA A;  2VJE A;  1MM2 A;  4V3K C;  3MHH A;  3L11 A;  3O70 A;  2KWN A;  3V43 A;  4BBQ A;  4I7B A;  2YHO A;  3RTR B;  1WIL A;  2UZG A;  1RMD A;  4CA1 A;  2L5U A;  2LGL A;  2VPD A;  2Y1N A;  2C2V S;  3M99 A;  2OXQ C;  4B86 C;  2KGI A;  2MD8 C;  2JMD A;  4QF3 A;  4FK5 A;  4IC3 A;  4W4U A;  1WEQ A;  2ZET C;  5LKU A;  4P5O B;  2M3H A;  4WZ3 B;  5DIN A;  1VFY A;  4WZ2 A;  3HCS A;  3ZNI A;  2MD7 B;  1G25 A;  2LGV A;  3EB5 A;  4GNG A;  3N9L A;  4V3L C;  2ECJ A;  2QIZ A;  5KH7 A;  4GNF A;  2IDA A;  5I3L A;  1FBV A;  2LN0 A;  2LXH C;  2I50 A;  3M62 A;  2YU4 A;  5C11 A;  2E6R A;  2MA5 A;  3C6W A;  1JOC A;  5TAB A;  3KV6 A;  2H0D A;  2CSY A;  4AYC B;  3ASL A;  2RI7 A;  2VPG A;  4AYC A;  4UP0 A;  3RPG C;  5H1U A;  1F62 A;  4I7C A;  4ZDT A;  3LQH A;  2MUM A;  1V87 A;  3PHD A;  4WA6 A;  4A0C D;  4YAD A;  2YYR A;  1WEO A;  2CKL A;  4LAD B;  3U5N A;  1X4J A;  3LQI A;  4AVX A;  2KYU A;  1X4I A;  2JRJ A;  2KR4 A;  5G04 B;  2JMJ A;  2RSD A;  5FB1 A;  3FL2 A;  2VJF A;  3DQV R;  1LDJ B;  2LGG A;  2YT5 A;  5B78 A;  4F52 B;  2LXP C;  2YHN A;  3KV5 A;  4N3W A;  2QIC A;  4NN2 A;  3ZPV 1;  2K16 A;  2MIQ A;  5LKT A;  1BOR A;  3RPG B;  3L1Z B;  1WEP A;  2K17 A;  2FUI A;  5KH9 A;  2HDP A;  4A4B A;  2KFT A;  4FIP A;  4YBS A;  1WEN A;  1HYI A;  1N87 A;  3N9M A;  4GND A;  3T7L A;  2YSJ A;  2CSZ A;  1JM7 B;  4R7E A;  2YQM A;  4L7X A;  3N9P A;  4WZ0 A;  3U5O A;  2LV9 A;  2AN6 A;  3GL6 A;  5B8D A;  4MVT A;  2FSA A;  5D1K B;  3SOU A;  4AP4 A;  2LDR A;  3U5P A;  2F42 A;  5EYA F;  2G6Q A;  5B75 A;  3MHS A;  2EA6 A;  2KIZ A;  4A4C A;  4N4F A;  1WEM A;  4UI9 B;  5G0F A;  4MSX A;  2KRE A;  5B77 A;  1IYM A;  1U6G B;  3O36 A;  5TDR A;  5LKZ A;  5H1V A;  5J3X A;  2F6J A;  2EGP A;  4S3O C;  1WE9 A;  2ECN A;  2YUC A;  5AIT A;  3SOW A;  4GB0 A;  1DVP A;  2QJ0 A;  3O33 A;  3T6R A;  2VPB A;  4UP5 A;  2YRE A;  4LLB A;  4LKA A;  2Y1M A;  3O34 A;  4IC2 A;  3PUR A;  1Z6U A;  3KQI A;  1WEW A;  5G05 B;  5TBN A;  2PNX A;  3GV4 A;  5FER A;  1Z60 A;  3ZTG A;  2K4D A;  2Y43 A;  2M1R A;  4BHW A;  3ZYQ A;  4YBM A;  3O35 A;  2ECT A;  2MA6 A;  4PTB A;  3ZVZ B;  2KGG A;  2XEU A;  3M63 A;  1MM3 A;  3HCT A;  1WGM A;  2KWK A;  1VYX A;  5D1M B;  1VD4 A;  1E4U A;  4PPE A;  3HTK C;  3SOX A;  3L1X A;  1XWH A;  2MNZ A;  1WIM A;  2LGK A;  4YBT A;  3KNV A;  3O7A A;  5DKA A;  5H9M A;  5KH3 A;  1HYJ A;  2ECI A;  2VNF A;  3NG2 A;  1WEV A; 
#chains in the Genus database with same CATH topology
 3N9N A;  1CHC A;  2KWJ A;  3KDE C;  1JM7 A;  4QF2 A;  4X3G A;  5JG6 A;  2MT5 A;  5FB0 A;  3LQJ A;  4GNE A;  2EOD A;  2ECW A;  4ZUX U;  3QZV A;  5B76 A;  2BAY A;  2C2L A;  2VJE B;  3HCU A;  4FO9 A;  4LJN A;  3I2D A;  1MBM A;  3ZVY A;  2EXU A;  2F6N A;  3Q1D A;  3ZPV E;  3N9O A;  1X4U A;  2KWO A;  3U5M A;  4A49 A;  2HYE D;  3FEH A;  4FJC A;  2DX8 A;  3SHB A;  1WEE A;  1WES A;  5LKX A;  2JUN A;  2YW8 A;  1Z2Q A;  5C13 A;  2XP0 A;  3T9K A;  1DCQ A;  2JMI A;  3DDT A;  5H1T A;  4S3O B;  3N9Q A;  3O37 A;  5SVI B;  5TRB A;  3VK6 A;  2G43 A;  2MNY A;  2KE1 A;  3LRQ A;  5B79 A;  2XB1 A;  2VP7 A;  2KKX A;  2K1J A;  2H0D B;  2YUR A;  3EB6 A;  1WFK A;  1ZBD B;  4R2Y A;  4AUQ B;  4XI1 A;  2IQJ A;  2L43 A;  5K3Q A;  4O64 A;  3M7K A;  1FP0 A;  3LVR E;  3DPL R;  3PUQ A;  2VJF B;  4YAB A;  5AIU A;  2YSM A;  2KU3 A;  2L0B A;  4YAX A;  3FAO A;  4C9Z A;  2M6M A;  2D8S A;  2L80 A;  5D1L B;  4LK9 A;  2LQ6 A;  3O47 A;  4ZQL A;  2VPE A;  5TDW A;  2YVR A;  2XOZ A;  1LDK C;  2M85 A;  2L75 A;  2YQL A;  2FUU A;  4YC9 A;  4F1P A;  2G45 A;  1K2F A;  4I7D A;  2DSM A;  2PUY A;  1WEU A;  5FEY A;  2CT2 A;  2E6S A;  2ECV A;  4Q6F A;  4YAT A;  3C5K A;  1T1H A;  5LCW B;  3IHP A;  2CKL B;  2LRI C;  4B7Y C;  4R8P K;  4CCG X;  2ECG A;  4TKP B;  4L58 A;  2NAA A;  2VJE A;  1MM2 A;  2CRW A;  2FFW A;  4V3K C;  3FM8 C;  2KKY A;  3MHH A;  3L11 A;  3O70 A;  2KWN A;  3V43 A;  4BBQ A;  4I7B A;  2YHO A;  3RTR B;  1WIL A;  2UZG A;  1RMD A;  4CA1 A;  4H9D A;  2L5U A;  2LGL A;  2VPD A;  2P57 A;  2Y1N A;  2C2V S;  3M99 A;  2OXQ C;  4B86 C;  2L7P A;  2KGI A;  2MD8 C;  2JMD A;  4Z0O A;  4QF3 A;  4FK5 A;  3FAN A;  4IC3 A;  2CSV A;  4W4U A;  1WEQ A;  2ZET C;  5LKU A;  2OWA A;  3LVQ E;  3H7H A;  4P5O B;  2M3H A;  4WZ3 B;  5DIN A;  1VFY A;  4WZ2 A;  3HCS A;  2CON A;  3ZNI A;  2MD7 B;  1G25 A;  2LGV A;  3EB5 A;  2B0O E;  2E61 A;  4GNG A;  3N9L A;  4V3L C;  2ECJ A;  3LJU X;  2QIZ A;  3MDB C;  5KH7 A;  4GNF A;  2IDA A;  5SVI A;  5I3L A;  1FBV A;  2LN0 A;  2MKE A;  2LXH C;  2I50 A;  3M62 A;  2YU4 A;  5C11 A;  2E6R A;  2MA5 A;  3C6W A;  1JOC A;  5TAB A;  3KV6 A;  2H0D A;  2CSY A;  4AYC B;  3ASL A;  2RI7 A;  2VPG A;  2DJA A;  4QQ4 A;  4AYC A;  4UP0 A;  5SVY A;  3RPG C;  5H1U A;  1F62 A;  2RR4 A;  4I7C A;  4ZDT A;  3LQH A;  2MUM A;  1V87 A;  3PHD A;  4WA6 A;  3FJU B;  4A0C D;  4YAD A;  2YYR A;  1WEO A;  2CKL A;  4LAD B;  3U5N A;  1X4J A;  3LQI A;  4AVX A;  2KYU A;  1X4I A;  2JRJ A;  4OGC A;  2KR4 A;  5G04 B;  2JMJ A;  2LAU A;  2RSD A;  5FB1 A;  3FL2 A;  2VJF A;  3DQV R;  1LDJ B;  2LGG A;  2YT5 A;  5B78 A;  4F52 B;  2LXP C;  2YHN A;  3KV5 A;  4N3W A;  2QIC A;  4NN2 A;  3ZPV 1;  2K16 A;  2MIQ A;  5LKT A;  1BOR A;  3RPG B;  3L1Z B;  1WEP A;  2K17 A;  2FUI A;  2M13 A;  5KH9 A;  2FD4 A;  2HDP A;  4A4B A;  2KFT A;  4FIP A;  4YBS A;  1WEN A;  1HYI A;  1N87 A;  3N9M A;  4GND A;  3T7L A;  2YSJ A;  2CSZ A;  1JM7 B;  4R7E A;  3JUE A;  3PLW A;  2YQM A;  4L7X A;  3N9P A;  4WZ0 A;  3U5O A;  2LV9 A;  2AN6 A;  3GL6 A;  5B8D A;  4MVT A;  2FSA A;  5D1K B;  3SOU A;  4AP4 A;  2LDR A;  3U5P A;  2F42 A;  5EYA F;  2G6Q A;  4Z0R A;  5B75 A;  3MHS A;  4OGE A;  2JM3 A;  2EA6 A;  2KIZ A;  4A4C A;  4N4F A;  2D8U A;  2EGM A;  1WEM A;  4UI9 B;  5G0F A;  4MSX A;  2KRE A;  5B77 A;  1IYM A;  1U6G B;  3O36 A;  2XOY A;  3DWD A;  5TDR A;  5LKZ A;  5H1V A;  5J3X A;  2F6J A;  2EGP A;  4S3O C;  1WE9 A;  2ECN A;  2YUC A;  5AIT A;  3SOW A;  4GB0 A;  2CRR A;  1DVP A;  2QJ0 A;  3O33 A;  3T6R A;  2VPB A;  4UP5 A;  2YRE A;  4LLB A;  5SVX A;  4LKA A;  2XOC A;  2Y1M A;  3O34 A;  4IC2 A;  3PUR A;  1Z6U A;  3KQI A;  1WEW A;  5G05 B;  5TBN A;  2PNX A;  3GV4 A;  5FER A;  3LDY A;  1Z60 A;  3ZTG A;  2K4D A;  2Y43 A;  2M1R A;  3E2D A;  4BHW A;  3ZYQ A;  4YBM A;  3O35 A;  2ECT A;  2MA6 A;  4PTB A;  3ZVZ B;  2KGG A;  2XEU A;  3M63 A;  1MM3 A;  3HCT A;  1WGM A;  2KWK A;  1VYX A;  5D1M B;  1VD4 A;  1E4U A;  4PPE A;  3HTK C;  3SUB A;  3SOX A;  3L1X A;  1XWH A;  2MNZ A;  1WIM A;  2LGK A;  4YBT A;  3KNV A;  3O7A A;  5DKA A;  5H9M A;  5KH3 A;  1HYJ A;  2ECI A;  4O62 A;  2VNF A;  3NG2 A;  1WEV A; 
#chains in the Genus database with same CATH homology
 3N9N A;  1CHC A;  2KWJ A;  1JM7 A;  4QF2 A;  4X3G A;  5JG6 A;  2MT5 A;  5FB0 A;  3LQJ A;  4GNE A;  2EOD A;  2ECW A;  4ZUX U;  3QZV A;  5B76 A;  2BAY A;  2C2L A;  2VJE B;  3HCU A;  4FO9 A;  4LJN A;  3I2D A;  3ZVY A;  2F6N A;  3ZPV E;  3N9O A;  1X4U A;  2KWO A;  3U5M A;  4A49 A;  2HYE D;  4FJC A;  2DX8 A;  3SHB A;  1WEE A;  1WES A;  5LKX A;  2YW8 A;  1Z2Q A;  5C13 A;  2JMI A;  5H1T A;  4S3O B;  3N9Q A;  3O37 A;  5TRB A;  3VK6 A;  2G43 A;  2MNY A;  2KE1 A;  3LRQ A;  5B79 A;  2XB1 A;  2VP7 A;  2K1J A;  2H0D B;  2YUR A;  3EB6 A;  1WFK A;  1ZBD B;  4R2Y A;  4AUQ B;  4XI1 A;  2L43 A;  4O64 A;  1FP0 A;  3DPL R;  3PUQ A;  2VJF B;  4YAB A;  5AIU A;  2YSM A;  2KU3 A;  2L0B A;  4YAX A;  4C9Z A;  2M6M A;  2D8S A;  2L80 A;  5D1L B;  4LK9 A;  2LQ6 A;  4ZQL A;  2VPE A;  5TDW A;  1LDK C;  2M85 A;  2L75 A;  2YQL A;  2FUU A;  4YC9 A;  2G45 A;  1K2F A;  4I7D A;  2PUY A;  1WEU A;  5FEY A;  2CT2 A;  2E6S A;  2ECV A;  4Q6F A;  4YAT A;  3C5K A;  1T1H A;  5LCW B;  3IHP A;  2CKL B;  2LRI C;  4B7Y C;  4R8P K;  4CCG X;  2ECG A;  4TKP B;  4L58 A;  2NAA A;  2VJE A;  1MM2 A;  4V3K C;  3MHH A;  3L11 A;  3O70 A;  2KWN A;  3V43 A;  4BBQ A;  4I7B A;  2YHO A;  3RTR B;  1WIL A;  2UZG A;  1RMD A;  4CA1 A;  2L5U A;  2LGL A;  2VPD A;  2Y1N A;  2C2V S;  3M99 A;  2OXQ C;  4B86 C;  2KGI A;  2MD8 C;  2JMD A;  4QF3 A;  4FK5 A;  4IC3 A;  4W4U A;  1WEQ A;  2ZET C;  5LKU A;  4P5O B;  2M3H A;  4WZ3 B;  5DIN A;  1VFY A;  4WZ2 A;  3HCS A;  3ZNI A;  2MD7 B;  1G25 A;  2LGV A;  3EB5 A;  4GNG A;  3N9L A;  4V3L C;  2ECJ A;  2QIZ A;  5KH7 A;  4GNF A;  2IDA A;  5I3L A;  1FBV A;  2LN0 A;  2LXH C;  2I50 A;  3M62 A;  2YU4 A;  5C11 A;  2E6R A;  2MA5 A;  3C6W A;  1JOC A;  5TAB A;  3KV6 A;  2H0D A;  2CSY A;  4AYC B;  3ASL A;  2RI7 A;  2VPG A;  4AYC A;  4UP0 A;  3RPG C;  5H1U A;  1F62 A;  4I7C A;  4ZDT A;  3LQH A;  2MUM A;  1V87 A;  3PHD A;  4WA6 A;  4A0C D;  4YAD A;  2YYR A;  1WEO A;  2CKL A;  4LAD B;  3U5N A;  1X4J A;  3LQI A;  4AVX A;  2KYU A;  1X4I A;  2JRJ A;  2KR4 A;  5G04 B;  2JMJ A;  2RSD A;  5FB1 A;  3FL2 A;  2VJF A;  3DQV R;  1LDJ B;  2LGG A;  2YT5 A;  5B78 A;  4F52 B;  2LXP C;  2YHN A;  3KV5 A;  4N3W A;  2QIC A;  4NN2 A;  3ZPV 1;  2K16 A;  2MIQ A;  5LKT A;  1BOR A;  3RPG B;  3L1Z B;  1WEP A;  2K17 A;  2FUI A;  5KH9 A;  2HDP A;  4A4B A;  2KFT A;  4FIP A;  4YBS A;  1WEN A;  1HYI A;  1N87 A;  3N9M A;  4GND A;  3T7L A;  2YSJ A;  2CSZ A;  1JM7 B;  4R7E A;  2YQM A;  4L7X A;  3N9P A;  4WZ0 A;  3U5O A;  2LV9 A;  2AN6 A;  3GL6 A;  5B8D A;  4MVT A;  2FSA A;  5D1K B;  3SOU A;  4AP4 A;  2LDR A;  3U5P A;  2F42 A;  5EYA F;  2G6Q A;  5B75 A;  3MHS A;  2EA6 A;  2KIZ A;  4A4C A;  4N4F A;  1WEM A;  4UI9 B;  5G0F A;  4MSX A;  2KRE A;  5B77 A;  1IYM A;  1U6G B;  3O36 A;  5TDR A;  5LKZ A;  5H1V A;  5J3X A;  2F6J A;  2EGP A;  4S3O C;  1WE9 A;  2ECN A;  2YUC A;  5AIT A;  3SOW A;  4GB0 A;  1DVP A;  2QJ0 A;  3O33 A;  3T6R A;  2VPB A;  4UP5 A;  2YRE A;  4LLB A;  4LKA A;  2Y1M A;  3O34 A;  4IC2 A;  3PUR A;  1Z6U A;  3KQI A;  1WEW A;  5G05 B;  5TBN A;  2PNX A;  3GV4 A;  5FER A;  1Z60 A;  3ZTG A;  2K4D A;  2Y43 A;  2M1R A;  4BHW A;  3ZYQ A;  4YBM A;  3O35 A;  2ECT A;  2MA6 A;  4PTB A;  3ZVZ B;  2KGG A;  2XEU A;  3M63 A;  1MM3 A;  3HCT A;  1WGM A;  2KWK A;  1VYX A;  5D1M B;  1VD4 A;  1E4U A;  4PPE A;  3HTK C;  3SOX A;  3L1X A;  1XWH A;  2MNZ A;  1WIM A;  2LGK A;  4YBT A;  3KNV A;  3O7A A;  5DKA A;  5H9M A;  5KH3 A;  1HYJ A;  2ECI A;  2VNF A;  3NG2 A;  1WEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...