4R2YA

Crystal structure of apc11 ring domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
ENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Anaphase-promoting complex subunit 11
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r2yA00
5TDWA 3ZVZB 4N4FA 2D8SA 2KGIA 5TABA 4L58A 3SOXA 3U5MA 3HCSA 2H0DA 2MIQA 1HYJA 3RPGB 1WGMA 2KWOA 2L0BA 3L1XA 4FO9A 2YHOA 2Y1MA 3EB5A 2ECIA 1WEUA 2AN6A 1IYMA 5TBNA 4AP4A 2VNFA 4FIPA 3N9NA 3C5KA 4BHWA 4TKPB 1FBVA 5FB0A 4ZUXU 2KREA 1WEWA 2G43A 2G45A 2L43A 1VFYA 3IHPA 2KR4A 4I7CA 4LKAA 4YBTA 1Z6UA 1WESA 2L75A 1WILA 3N9LA 2I50A 2CSYA 2MT5A 4YBSA 1F62A 1WE9A 4V3LC 1N87A 2LGLA 1FP0A 1VYXA 2LDRA 2JMJA 2KFTA 4I7BA 1ZBDB 4WZ0A 2L80A 2YYRA 2YHNA 4L7XA 2HYED 3N9OA 5TDRA 5KH3A 2K4DA 5B78A 2LXHC 2UZGA 2VPGA 5G04B 5FB1A 1DVPA 4A4CA 3U5OA 5H1TA 2LGGA 3MHSA 5EYAF 1E4UA 2E6SA 4LJNA 2FSAA 2RI7A 2H0DB 3SOWA 3KV5A 2YU4A 4N3WA 4O64A 4AVXA 5H1VA 4QF2A 3HCUA 4GB0A 2VJEB 5D1KB 2YW8A 4R8PK 5DINA 5I3LA 2DX8A 2YSJA 1LDJB 1WEEA 2FUIA 4YAXA 3LQHA 4GNGA 2CKLB 2XEUA 4C9ZA 2C2LA 2KWJA 2JMDA 5B79A 4YATA 2ECJA 1MM3A 2VJEA 3O70A 4BBQA 2YT5A 1T1HA 4R2YA 4UP0A 2CT2A 2KGGA 3M62A 2KWNA 2CKLA 4FJCA 5LKZA 3GL6A 2IDAA 2M1RA 2CSZA 5LCWB 3KV6A 3M99A 3LRQA 2LXPC 4V3KC 5TRBA 1JOCA 1WEQA 2VPDA 4CCGX 2PUYA 3SOUA 4YBMA 2Y43A 3U5NA 3RTRB 2ECGA 2F6NA 3U5PA 3FL2A 2JRJA 2ECVA 4Q6FA 1WEMA 2EODA 4YADA 3EB6A 3KNVA 5LKTA 3ZNIA 5C13A 5LKXA 4UP5A 3LQIA 2KIZA 3QZVA 4LADB 3DPLR 1V87A 2K1JA 2EGPA 4LK9A 4AYCA 3LQJA 5AIUA 2YSMA 4GNFA 2Y1NA 5B8DA 2QICA 2PNXA 2JMIA 2VJFB 5C11A 2YUCA 1Z60A 2YQLA 4PPEA 3O37A 2VPEA 2BAYA 2QIZA 1WEOA 2ECWA 2M6MA 2OXQC 2MUMA 3ZYQA 5D1LB 2G6QA 2K16A 3I2DA 2VJFA 2MA6A 2VPBA 4ZDTA 2NAAA 2KYUA 1X4JA 4PTBA 3T6RA 1MM2A 5H1UA 2ECTA 3T7LA 2KWKA 1K2FA 2LRIC 2LQ6A 3ZPV1 4YABA 5AITA 2XB1A 1U6GB 3ZTGA 3N9PA 2K17A 3MHHA 4F52B 4MSXA 5G05B 1JM7A 5B76A 4LLBA 4R7EA 4GNEA 2LN0A 1HYIA 4A4BA 1WEVA 4S3OB 5G0FA 5H9MA 2VP7A 4P5OB 4IC2A 2YURA 1WIMA 2LGKA 3HTKC 2M85A 4FK5A 2ECNA 4B7YC 3GV4A 4WA6A 1Z2QA 5DKAA 4IC3A 2YREA 4AUQB 3PHDA 3L1ZB 1LDKC 4WZ2A 4WZ3B 1WEPA 4AYCB 3O7AA 3ZPVE 3PURA 2C2VS 4YC9A 3M63A 5FERA 2MA5A 2KU3A 2LV9A 2MD8C 3L11A 3NG2A 3VK6A 3O36A 4X3GA 3RPGC 1G25A 2RSDA 1WENA 4S3OC 5JG6A 3N9MA 4CA1A 1BORA 2F42A 5B75A 2YQMA 5J3XA 3O33A 2F6JA 4B86C 3O34A 5FEYA 3SHBA 4W4UA 1X4IA 2MD7B 3DQVR 5KH9A 2L5UA 2EA6A 4GNDA 3HCTA 4A0CD 5LKUA 2M3HA 1X4UA 3KQIA 3O35A 2MNYA 3C6WA 3ZVYA 2FUUA 3ASLA 2ZETC 2HDPA 3PUQA 1VD4A 5KH7A 5D1MB 1JM7B 1WFKA 3V43A 1XWHA 1RMDA 4MVTA 4XI1A 4A49A 2MNZA 4NN2A 4I7DA 2LGVA 3N9QA 4UI9B 4ZQLA 2E6RA 4QF3A 2KE1A 1CHCA 2QJ0A 5B77A
chains in the Genus database with same CATH superfamily
5TDWA 3ZVZB 4N4FA 2D8SA 2KGIA 5TABA 4L58A 3SOXA 3U5MA 3HCSA 2H0DA 2MIQA 1HYJA 3RPGB 2KKXA 1WGMA 2KWOA 2L0BA 3L1XA 4FO9A 2YHOA 2Y1MA 3PLWA 1MBMA 3DWDA 3DDTA 3EB5A 2ECIA 2YVRA 2XP0A 1WEUA 2AN6A 1IYMA 5TBNA 3LJUX 4AP4A 2VNFA 4FIPA 3N9NA 2EGMA 3C5KA 4BHWA 4TKPB 1FBVA 3LVRE 5FB0A 4ZUXU 2KREA 1WEWA 2G43A 2G45A 2L43A 3JUEA 1VFYA 3IHPA 2KR4A 4I7CA 4LKAA 4YBTA 1Z6UA 1WESA 2L75A 1WILA 3N9LA 2I50A 2CSYA 2MT5A 2DJAA 4YBSA 1F62A 1WE9A 4V3LC 1N87A 2LGLA 1FP0A 1VYXA 2LDRA 2JMJA 2KFTA 4I7BA 1ZBDB 4WZ0A 2L80A 2YYRA 3LVQE 2YHNA 4L7XA 2HYED 3N9OA 5TDRA 5KH3A 2K4DA 5B78A 2LXHC 2IQJA 3FAOA 2UZGA 2VPGA 5G04B 5FB1A 1DVPA 4A4CA 5SVXA 3U5OA 5H1TA 4OGCA 2LGGA 3MHSA 3O47A 5EYAF 3E2DA 1E4UA 2E6SA 4LJNA 2FSAA 2RI7A 2H0DB 2XOYA 2EXUA 2M13A 3SOWA 3KV5A 2YU4A 4N3WA 3T9KA 3FANA 4O64A 4AVXA 2FFWA 5H1VA 4QF2A 3HCUA 4GB0A 2VJEB 5D1KB 2YW8A 4R8PK 5DINA 2LAUA 5I3LA 2DX8A 2YSJA 1LDJB 1WEEA 2XOZA 2CSVA 2FUIA 4YAXA 3LQHA 4GNGA 2CKLB 2XEUA 2E61A 4C9ZA 2C2LA 2KWJA 2JMDA 5B79A 4YATA 2ECJA 1MM3A 2VJEA 3O70A 4BBQA 2YT5A 2CONA 1T1HA 4R2YA 4UP0A 2CT2A 2KGGA 3M62A 2KWNA 2CKLA 4FJCA 5LKZA 3GL6A 2IDAA 2M1RA 2RR4A 2CSZA 5LCWB 3KV6A 3M99A 3LRQA 2LXPC 4V3KC 5TRBA 1JOCA 1WEQA 4F1PA 2VPDA 4CCGX 2PUYA 3SOUA 4YBMA 2Y43A 3U5NA 2D8UA 3RTRB 2ECGA 2F6NA 3U5PA 3FL2A 2JRJA 2ECVA 4Q6FA 1WEMA 2B0OE 3MDBC 2EODA 2L7PA 3EB6A 4YADA 3FJUB 3KNVA 5LKTA 3ZNIA 5C13A 5LKXA 4UP5A 3LQIA 2KIZA 3QZVA 4LADB 3DPLR 4QQ4A 1V87A 2K1JA 2EGPA 4LK9A 4AYCA 3LQJA 3Q1DA 5AIUA 2YSMA 4GNFA 2Y1NA 3H7HA 5B8DA 2QICA 2PNXA 4Z0RA 2JMIA 2VJFB 5C11A 2YUCA 1Z60A 2YQLA 4PPEA 3O37A 2VPEA 2BAYA 2QIZA 1WEOA 2ECWA 2M6MA 2OXQC 3KDEC 2MUMA 3ZYQA 5D1LB 2G6QA 2K16A 3FM8C 3I2DA 2VJFA 2MA6A 2VPBA 4ZDTA 2NAAA 2KYUA 1X4JA 4PTBA 1MM2A 3T6RA 5H1UA 2ECTA 3T7LA 2KKYA 2KWKA 1K2FA 2LRIC 2LQ6A 3ZPV1 4Z0OA 4YABA 5AITA 2XB1A 1U6GB 5SVYA 3ZTGA 3N9PA 5SVIB 2K17A 3MHHA 4F52B 4MSXA 5G05B 1JM7A 2CRRA 5B76A 4LLBA 4R7EA 4GNEA 2LN0A 1HYIA 4A4BA 1WEVA 4H9DA 4S3OB 5G0FA 5H9MA 2OWAA 2VP7A 4P5OB 4IC2A 2YURA 1WIMA 2LGKA 5SVIA 3HTKC 2M85A 4FK5A 2ECNA 4B7YC 3GV4A 4WA6A 1Z2QA 5DKAA 2JM3A 3SUBA 3FEHA 4IC3A 2YREA 4AUQB 3PHDA 3L1ZB 5K3QA 1LDKC 2XOCA 4WZ2A 4WZ3B 1WEPA 2JUNA 4AYCB 4O62A 3O7AA 3ZPVE 3PURA 2C2VS 4YC9A 3M63A 5FERA 2MA5A 2KU3A 2LV9A 2MD8C 3L11A 3NG2A 3VK6A 3O36A 4X3GA 3RPGC 1G25A 2RSDA 1WENA 4S3OC 5JG6A 3N9MA 4CA1A 2P57A 1BORA 2CRWA 2F42A 5B75A 2YQMA 5J3XA 3O33A 2F6JA 4B86C 3O34A 5FEYA 3SHBA 4W4UA 1X4IA 2MD7B 3DQVR 5KH9A 4OGEA 2L5UA 2EA6A 4GNDA 3HCTA 4A0CD 5LKUA 2M3HA 1X4UA 3LDYA 3KQIA 3O35A 2MNYA 3C6WA 3ZVYA 2FUUA 3ASLA 2ZETC 2HDPA 3PUQA 1VD4A 5KH7A 5D1MB 1JM7B 1WFKA 2MKEA 3V43A 3M7KA 1XWHA 1RMDA 4MVTA 4XI1A 2FD4A 4A49A 2MNZA 4NN2A 4I7DA 2LGVA 3N9QA 4UI9B 2DSMA 4ZQLA 2E6RA 4QF3A 2KE1A 1CHCA 2QJ0A 5B77A 1DCQA
chains in the Genus database with same CATH topology
5TDWA 3ZVZB 4N4FA 2D8SA 2KGIA 5TABA 4L58A 3SOXA 3U5MA 3HCSA 2H0DA 2MIQA 1HYJA 3RPGB 1WGMA 2KWOA 2L0BA 3L1XA 4FO9A 2YHOA 2Y1MA 3EB5A 2ECIA 1WEUA 2AN6A 1IYMA 5TBNA 4AP4A 2VNFA 4FIPA 3N9NA 3C5KA 4BHWA 4TKPB 1FBVA 5FB0A 4ZUXU 2KREA 1WEWA 2G43A 2G45A 2L43A 1VFYA 3IHPA 2KR4A 4I7CA 4LKAA 4YBTA 1Z6UA 1WESA 2L75A 1WILA 3N9LA 2I50A 2CSYA 2MT5A 4YBSA 1F62A 1WE9A 4V3LC 1N87A 2LGLA 1FP0A 1VYXA 2LDRA 2JMJA 2KFTA 4I7BA 1ZBDB 4WZ0A 2L80A 2YYRA 2YHNA 4L7XA 2HYED 3N9OA 5TDRA 5KH3A 2K4DA 5B78A 2LXHC 2UZGA 2VPGA 5G04B 5FB1A 1DVPA 4A4CA 3U5OA 5H1TA 2LGGA 3MHSA 5EYAF 1E4UA 2E6SA 4LJNA 2FSAA 2RI7A 2H0DB 3SOWA 3KV5A 2YU4A 4N3WA 4O64A 4AVXA 5H1VA 4QF2A 3HCUA 4GB0A 2VJEB 5D1KB 2YW8A 4R8PK 5DINA 5I3LA 2DX8A 2YSJA 1LDJB 1WEEA 2FUIA 4YAXA 3LQHA 4GNGA 2CKLB 2XEUA 4C9ZA 2C2LA 2KWJA 2JMDA 5B79A 4YATA 2ECJA 1MM3A 2VJEA 3O70A 4BBQA 2YT5A 1T1HA 4R2YA 4UP0A 2CT2A 2KGGA 3M62A 2KWNA 2CKLA 4FJCA 5LKZA 3GL6A 2IDAA 2M1RA 2CSZA 5LCWB 3KV6A 3M99A 3LRQA 2LXPC 4V3KC 5TRBA 1JOCA 1WEQA 2VPDA 4CCGX 2PUYA 3SOUA 4YBMA 2Y43A 3U5NA 3RTRB 2ECGA 2F6NA 3U5PA 3FL2A 2JRJA 2ECVA 4Q6FA 1WEMA 2EODA 4YADA 3EB6A 3KNVA 5LKTA 3ZNIA 5C13A 5LKXA 4UP5A 3LQIA 2KIZA 3QZVA 4LADB 3DPLR 1V87A 2K1JA 2EGPA 4LK9A 4AYCA 3LQJA 5AIUA 2YSMA 4GNFA 2Y1NA 5B8DA 2QICA 2PNXA 2JMIA 2VJFB 5C11A 2YUCA 1Z60A 2YQLA 4PPEA 3O37A 2VPEA 2BAYA 2QIZA 1WEOA 2ECWA 2M6MA 2OXQC 2MUMA 3ZYQA 5D1LB 2G6QA 2K16A 3I2DA 2VJFA 2MA6A 2VPBA 4ZDTA 2NAAA 2KYUA 1X4JA 4PTBA 3T6RA 1MM2A 5H1UA 2ECTA 3T7LA 2KWKA 1K2FA 2LRIC 2LQ6A 3ZPV1 4YABA 5AITA 2XB1A 1U6GB 3ZTGA 3N9PA 2K17A 3MHHA 4F52B 4MSXA 5G05B 1JM7A 5B76A 4LLBA 4R7EA 4GNEA 2LN0A 1HYIA 4A4BA 1WEVA 4S3OB 5G0FA 5H9MA 2VP7A 4P5OB 4IC2A 2YURA 1WIMA 2LGKA 3HTKC 2M85A 4FK5A 2ECNA 4B7YC 3GV4A 4WA6A 1Z2QA 5DKAA 4IC3A 2YREA 4AUQB 3PHDA 3L1ZB 1LDKC 4WZ2A 4WZ3B 1WEPA 4AYCB 3O7AA 3ZPVE 3PURA 2C2VS 4YC9A 3M63A 5FERA 2MA5A 2KU3A 2LV9A 2MD8C 3L11A 3NG2A 3VK6A 3O36A 4X3GA 3RPGC 1G25A 2RSDA 1WENA 4S3OC 5JG6A 3N9MA 4CA1A 1BORA 2F42A 5B75A 2YQMA 5J3XA 3O33A 2F6JA 4B86C 3O34A 5FEYA 3SHBA 4W4UA 1X4IA 2MD7B 3DQVR 5KH9A 2L5UA 2EA6A 4GNDA 3HCTA 4A0CD 5LKUA 2M3HA 1X4UA 3KQIA 3O35A 2MNYA 3C6WA 3ZVYA 2FUUA 3ASLA 2ZETC 2HDPA 3PUQA 1VD4A 5KH7A 5D1MB 1JM7B 1WFKA 3V43A 1XWHA 1RMDA 4MVTA 4XI1A 4A49A 2MNZA 4NN2A 4I7DA 2LGVA 3N9QA 4UI9B 4ZQLA 2E6RA 4QF3A 2KE1A 1CHCA 2QJ0A 5B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDW A;  3ZVZ B;  4N4F A;  2D8S A;  2KGI A;  5TAB A;  4L58 A;  3SOX A;  3U5M A;  3HCS A;  2H0D A;  2MIQ A;  1HYJ A;  3RPG B;  1WGM A;  2KWO A;  2L0B A;  3L1X A;  4FO9 A;  2YHO A;  2Y1M A;  3EB5 A;  2ECI A;  1WEU A;  2AN6 A;  1IYM A;  5TBN A;  4AP4 A;  2VNF A;  4FIP A;  3N9N A;  3C5K A;  4BHW A;  4TKP B;  1FBV A;  5FB0 A;  4ZUX U;  2KRE A;  1WEW A;  2G43 A;  2G45 A;  2L43 A;  1VFY A;  3IHP A;  2KR4 A;  4I7C A;  4LKA A;  4YBT A;  1Z6U A;  1WES A;  2L75 A;  1WIL A;  3N9L A;  2I50 A;  2CSY A;  2MT5 A;  4YBS A;  1F62 A;  1WE9 A;  4V3L C;  1N87 A;  2LGL A;  1FP0 A;  1VYX A;  2LDR A;  2JMJ A;  2KFT A;  4I7B A;  1ZBD B;  4WZ0 A;  2L80 A;  2YYR A;  2YHN A;  4L7X A;  2HYE D;  3N9O A;  5TDR A;  5KH3 A;  2K4D A;  5B78 A;  2LXH C;  2UZG A;  2VPG A;  5G04 B;  5FB1 A;  1DVP A;  4A4C A;  3U5O A;  5H1T A;  2LGG A;  3MHS A;  5EYA F;  1E4U A;  2E6S A;  4LJN A;  2FSA A;  2RI7 A;  2H0D B;  3SOW A;  3KV5 A;  2YU4 A;  4N3W A;  4O64 A;  4AVX A;  5H1V A;  4QF2 A;  3HCU A;  4GB0 A;  2VJE B;  5D1K B;  2YW8 A;  4R8P K;  5DIN A;  5I3L A;  2DX8 A;  2YSJ A;  1LDJ B;  1WEE A;  2FUI A;  4YAX A;  3LQH A;  4GNG A;  2CKL B;  2XEU A;  4C9Z A;  2C2L A;  2KWJ A;  2JMD A;  5B79 A;  4YAT A;  2ECJ A;  1MM3 A;  2VJE A;  3O70 A;  4BBQ A;  2YT5 A;  1T1H A;  4R2Y A;  4UP0 A;  2CT2 A;  2KGG A;  3M62 A;  2KWN A;  2CKL A;  4FJC A;  5LKZ A;  3GL6 A;  2IDA A;  2M1R A;  2CSZ A;  5LCW B;  3KV6 A;  3M99 A;  3LRQ A;  2LXP C;  4V3K C;  5TRB A;  1JOC A;  1WEQ A;  2VPD A;  4CCG X;  2PUY A;  3SOU A;  4YBM A;  2Y43 A;  3U5N A;  3RTR B;  2ECG A;  2F6N A;  3U5P A;  3FL2 A;  2JRJ A;  2ECV A;  4Q6F A;  1WEM A;  2EOD A;  4YAD A;  3EB6 A;  3KNV A;  5LKT A;  3ZNI A;  5C13 A;  5LKX A;  4UP5 A;  3LQI A;  2KIZ A;  3QZV A;  4LAD B;  3DPL R;  1V87 A;  2K1J A;  2EGP A;  4LK9 A;  4AYC A;  3LQJ A;  5AIU A;  2YSM A;  4GNF A;  2Y1N A;  5B8D A;  2QIC A;  2PNX A;  2JMI A;  2VJF B;  5C11 A;  2YUC A;  1Z60 A;  2YQL A;  4PPE A;  3O37 A;  2VPE A;  2BAY A;  2QIZ A;  1WEO A;  2ECW A;  2M6M A;  2OXQ C;  2MUM A;  3ZYQ A;  5D1L B;  2G6Q A;  2K16 A;  3I2D A;  2VJF A;  2MA6 A;  2VPB A;  4ZDT A;  2NAA A;  2KYU A;  1X4J A;  4PTB A;  3T6R A;  1MM2 A;  5H1U A;  2ECT A;  3T7L A;  2KWK A;  1K2F A;  2LRI C;  2LQ6 A;  3ZPV 1;  4YAB A;  5AIT A;  2XB1 A;  1U6G B;  3ZTG A;  3N9P A;  2K17 A;  3MHH A;  4F52 B;  4MSX A;  5G05 B;  1JM7 A;  5B76 A;  4LLB A;  4R7E A;  4GNE A;  2LN0 A;  1HYI A;  4A4B A;  1WEV A;  4S3O B;  5G0F A;  5H9M A;  2VP7 A;  4P5O B;  4IC2 A;  2YUR A;  1WIM A;  2LGK A;  3HTK C;  2M85 A;  4FK5 A;  2ECN A;  4B7Y C;  3GV4 A;  4WA6 A;  1Z2Q A;  5DKA A;  4IC3 A;  2YRE A;  4AUQ B;  3PHD A;  3L1Z B;  1LDK C;  4WZ2 A;  4WZ3 B;  1WEP A;  4AYC B;  3O7A A;  3ZPV E;  3PUR A;  2C2V S;  4YC9 A;  3M63 A;  5FER A;  2MA5 A;  2KU3 A;  2LV9 A;  2MD8 C;  3L11 A;  3NG2 A;  3VK6 A;  3O36 A;  4X3G A;  3RPG C;  1G25 A;  2RSD A;  1WEN A;  4S3O C;  5JG6 A;  3N9M A;  4CA1 A;  1BOR A;  2F42 A;  5B75 A;  2YQM A;  5J3X A;  3O33 A;  2F6J A;  4B86 C;  3O34 A;  5FEY A;  3SHB A;  4W4U A;  1X4I A;  2MD7 B;  3DQV R;  5KH9 A;  2L5U A;  2EA6 A;  4GND A;  3HCT A;  4A0C D;  5LKU A;  2M3H A;  1X4U A;  3KQI A;  3O35 A;  2MNY A;  3C6W A;  3ZVY A;  2FUU A;  3ASL A;  2ZET C;  2HDP A;  3PUQ A;  1VD4 A;  5KH7 A;  5D1M B;  1JM7 B;  1WFK A;  3V43 A;  1XWH A;  1RMD A;  4MVT A;  4XI1 A;  4A49 A;  2MNZ A;  4NN2 A;  4I7D A;  2LGV A;  3N9Q A;  4UI9 B;  4ZQL A;  2E6R A;  4QF3 A;  2KE1 A;  1CHC A;  2QJ0 A;  5B77 A; 
#chains in the Genus database with same CATH topology
 5TDW A;  3ZVZ B;  4N4F A;  2D8S A;  2KGI A;  5TAB A;  4L58 A;  3SOX A;  3U5M A;  3HCS A;  2H0D A;  2MIQ A;  1HYJ A;  3RPG B;  2KKX A;  1WGM A;  2KWO A;  2L0B A;  3L1X A;  4FO9 A;  2YHO A;  2Y1M A;  3PLW A;  1MBM A;  3DWD A;  3DDT A;  3EB5 A;  2ECI A;  2YVR A;  2XP0 A;  1WEU A;  2AN6 A;  1IYM A;  5TBN A;  3LJU X;  4AP4 A;  2VNF A;  4FIP A;  3N9N A;  2EGM A;  3C5K A;  4BHW A;  4TKP B;  1FBV A;  3LVR E;  5FB0 A;  4ZUX U;  2KRE A;  1WEW A;  2G43 A;  2G45 A;  2L43 A;  3JUE A;  1VFY A;  3IHP A;  2KR4 A;  4I7C A;  4LKA A;  4YBT A;  1Z6U A;  1WES A;  2L75 A;  1WIL A;  3N9L A;  2I50 A;  2CSY A;  2MT5 A;  2DJA A;  4YBS A;  1F62 A;  1WE9 A;  4V3L C;  1N87 A;  2LGL A;  1FP0 A;  1VYX A;  2LDR A;  2JMJ A;  2KFT A;  4I7B A;  1ZBD B;  4WZ0 A;  2L80 A;  2YYR A;  3LVQ E;  2YHN A;  4L7X A;  2HYE D;  3N9O A;  5TDR A;  5KH3 A;  2K4D A;  5B78 A;  2LXH C;  2IQJ A;  3FAO A;  2UZG A;  2VPG A;  5G04 B;  5FB1 A;  1DVP A;  4A4C A;  5SVX A;  3U5O A;  5H1T A;  4OGC A;  2LGG A;  3MHS A;  3O47 A;  5EYA F;  3E2D A;  1E4U A;  2E6S A;  4LJN A;  2FSA A;  2RI7 A;  2H0D B;  2XOY A;  2EXU A;  2M13 A;  3SOW A;  3KV5 A;  2YU4 A;  4N3W A;  3T9K A;  3FAN A;  4O64 A;  4AVX A;  2FFW A;  5H1V A;  4QF2 A;  3HCU A;  4GB0 A;  2VJE B;  5D1K B;  2YW8 A;  4R8P K;  5DIN A;  2LAU A;  5I3L A;  2DX8 A;  2YSJ A;  1LDJ B;  1WEE A;  2XOZ A;  2CSV A;  2FUI A;  4YAX A;  3LQH A;  4GNG A;  2CKL B;  2XEU A;  2E61 A;  4C9Z A;  2C2L A;  2KWJ A;  2JMD A;  5B79 A;  4YAT A;  2ECJ A;  1MM3 A;  2VJE A;  3O70 A;  4BBQ A;  2YT5 A;  2CON A;  1T1H A;  4R2Y A;  4UP0 A;  2CT2 A;  2KGG A;  3M62 A;  2KWN A;  2CKL A;  4FJC A;  5LKZ A;  3GL6 A;  2IDA A;  2M1R A;  2RR4 A;  2CSZ A;  5LCW B;  3KV6 A;  3M99 A;  3LRQ A;  2LXP C;  4V3K C;  5TRB A;  1JOC A;  1WEQ A;  4F1P A;  2VPD A;  4CCG X;  2PUY A;  3SOU A;  4YBM A;  2Y43 A;  3U5N A;  2D8U A;  3RTR B;  2ECG A;  2F6N A;  3U5P A;  3FL2 A;  2JRJ A;  2ECV A;  4Q6F A;  1WEM A;  2B0O E;  3MDB C;  2EOD A;  2L7P A;  3EB6 A;  4YAD A;  3FJU B;  3KNV A;  5LKT A;  3ZNI A;  5C13 A;  5LKX A;  4UP5 A;  3LQI A;  2KIZ A;  3QZV A;  4LAD B;  3DPL R;  4QQ4 A;  1V87 A;  2K1J A;  2EGP A;  4LK9 A;  4AYC A;  3LQJ A;  3Q1D A;  5AIU A;  2YSM A;  4GNF A;  2Y1N A;  3H7H A;  5B8D A;  2QIC A;  2PNX A;  4Z0R A;  2JMI A;  2VJF B;  5C11 A;  2YUC A;  1Z60 A;  2YQL A;  4PPE A;  3O37 A;  2VPE A;  2BAY A;  2QIZ A;  1WEO A;  2ECW A;  2M6M A;  2OXQ C;  3KDE C;  2MUM A;  3ZYQ A;  5D1L B;  2G6Q A;  2K16 A;  3FM8 C;  3I2D A;  2VJF A;  2MA6 A;  2VPB A;  4ZDT A;  2NAA A;  2KYU A;  1X4J A;  4PTB A;  1MM2 A;  3T6R A;  5H1U A;  2ECT A;  3T7L A;  2KKY A;  2KWK A;  1K2F A;  2LRI C;  2LQ6 A;  3ZPV 1;  4Z0O A;  4YAB A;  5AIT A;  2XB1 A;  1U6G B;  5SVY A;  3ZTG A;  3N9P A;  5SVI B;  2K17 A;  3MHH A;  4F52 B;  4MSX A;  5G05 B;  1JM7 A;  2CRR A;  5B76 A;  4LLB A;  4R7E A;  4GNE A;  2LN0 A;  1HYI A;  4A4B A;  1WEV A;  4H9D A;  4S3O B;  5G0F A;  5H9M A;  2OWA A;  2VP7 A;  4P5O B;  4IC2 A;  2YUR A;  1WIM A;  2LGK A;  5SVI A;  3HTK C;  2M85 A;  4FK5 A;  2ECN A;  4B7Y C;  3GV4 A;  4WA6 A;  1Z2Q A;  5DKA A;  2JM3 A;  3SUB A;  3FEH A;  4IC3 A;  2YRE A;  4AUQ B;  3PHD A;  3L1Z B;  5K3Q A;  1LDK C;  2XOC A;  4WZ2 A;  4WZ3 B;  1WEP A;  2JUN A;  4AYC B;  4O62 A;  3O7A A;  3ZPV E;  3PUR A;  2C2V S;  4YC9 A;  3M63 A;  5FER A;  2MA5 A;  2KU3 A;  2LV9 A;  2MD8 C;  3L11 A;  3NG2 A;  3VK6 A;  3O36 A;  4X3G A;  3RPG C;  1G25 A;  2RSD A;  1WEN A;  4S3O C;  5JG6 A;  3N9M A;  4CA1 A;  2P57 A;  1BOR A;  2CRW A;  2F42 A;  5B75 A;  2YQM A;  5J3X A;  3O33 A;  2F6J A;  4B86 C;  3O34 A;  5FEY A;  3SHB A;  4W4U A;  1X4I A;  2MD7 B;  3DQV R;  5KH9 A;  4OGE A;  2L5U A;  2EA6 A;  4GND A;  3HCT A;  4A0C D;  5LKU A;  2M3H A;  1X4U A;  3LDY A;  3KQI A;  3O35 A;  2MNY A;  3C6W A;  3ZVY A;  2FUU A;  3ASL A;  2ZET C;  2HDP A;  3PUQ A;  1VD4 A;  5KH7 A;  5D1M B;  1JM7 B;  1WFK A;  2MKE A;  3V43 A;  3M7K A;  1XWH A;  1RMD A;  4MVT A;  4XI1 A;  2FD4 A;  4A49 A;  2MNZ A;  4NN2 A;  4I7D A;  2LGV A;  3N9Q A;  4UI9 B;  2DSM A;  4ZQL A;  2E6R A;  4QF3 A;  2KE1 A;  1CHC A;  2QJ0 A;  5B77 A;  1DCQ A; 
#chains in the Genus database with same CATH homology
 5TDW A;  3ZVZ B;  4N4F A;  2D8S A;  2KGI A;  5TAB A;  4L58 A;  3SOX A;  3U5M A;  3HCS A;  2H0D A;  2MIQ A;  1HYJ A;  3RPG B;  1WGM A;  2KWO A;  2L0B A;  3L1X A;  4FO9 A;  2YHO A;  2Y1M A;  3EB5 A;  2ECI A;  1WEU A;  2AN6 A;  1IYM A;  5TBN A;  4AP4 A;  2VNF A;  4FIP A;  3N9N A;  3C5K A;  4BHW A;  4TKP B;  1FBV A;  5FB0 A;  4ZUX U;  2KRE A;  1WEW A;  2G43 A;  2G45 A;  2L43 A;  1VFY A;  3IHP A;  2KR4 A;  4I7C A;  4LKA A;  4YBT A;  1Z6U A;  1WES A;  2L75 A;  1WIL A;  3N9L A;  2I50 A;  2CSY A;  2MT5 A;  4YBS A;  1F62 A;  1WE9 A;  4V3L C;  1N87 A;  2LGL A;  1FP0 A;  1VYX A;  2LDR A;  2JMJ A;  2KFT A;  4I7B A;  1ZBD B;  4WZ0 A;  2L80 A;  2YYR A;  2YHN A;  4L7X A;  2HYE D;  3N9O A;  5TDR A;  5KH3 A;  2K4D A;  5B78 A;  2LXH C;  2UZG A;  2VPG A;  5G04 B;  5FB1 A;  1DVP A;  4A4C A;  3U5O A;  5H1T A;  2LGG A;  3MHS A;  5EYA F;  1E4U A;  2E6S A;  4LJN A;  2FSA A;  2RI7 A;  2H0D B;  3SOW A;  3KV5 A;  2YU4 A;  4N3W A;  4O64 A;  4AVX A;  5H1V A;  4QF2 A;  3HCU A;  4GB0 A;  2VJE B;  5D1K B;  2YW8 A;  4R8P K;  5DIN A;  5I3L A;  2DX8 A;  2YSJ A;  1LDJ B;  1WEE A;  2FUI A;  4YAX A;  3LQH A;  4GNG A;  2CKL B;  2XEU A;  4C9Z A;  2C2L A;  2KWJ A;  2JMD A;  5B79 A;  4YAT A;  2ECJ A;  1MM3 A;  2VJE A;  3O70 A;  4BBQ A;  2YT5 A;  1T1H A;  4R2Y A;  4UP0 A;  2CT2 A;  2KGG A;  3M62 A;  2KWN A;  2CKL A;  4FJC A;  5LKZ A;  3GL6 A;  2IDA A;  2M1R A;  2CSZ A;  5LCW B;  3KV6 A;  3M99 A;  3LRQ A;  2LXP C;  4V3K C;  5TRB A;  1JOC A;  1WEQ A;  2VPD A;  4CCG X;  2PUY A;  3SOU A;  4YBM A;  2Y43 A;  3U5N A;  3RTR B;  2ECG A;  2F6N A;  3U5P A;  3FL2 A;  2JRJ A;  2ECV A;  4Q6F A;  1WEM A;  2EOD A;  4YAD A;  3EB6 A;  3KNV A;  5LKT A;  3ZNI A;  5C13 A;  5LKX A;  4UP5 A;  3LQI A;  2KIZ A;  3QZV A;  4LAD B;  3DPL R;  1V87 A;  2K1J A;  2EGP A;  4LK9 A;  4AYC A;  3LQJ A;  5AIU A;  2YSM A;  4GNF A;  2Y1N A;  5B8D A;  2QIC A;  2PNX A;  2JMI A;  2VJF B;  5C11 A;  2YUC A;  1Z60 A;  2YQL A;  4PPE A;  3O37 A;  2VPE A;  2BAY A;  2QIZ A;  1WEO A;  2ECW A;  2M6M A;  2OXQ C;  2MUM A;  3ZYQ A;  5D1L B;  2G6Q A;  2K16 A;  3I2D A;  2VJF A;  2MA6 A;  2VPB A;  4ZDT A;  2NAA A;  2KYU A;  1X4J A;  4PTB A;  3T6R A;  1MM2 A;  5H1U A;  2ECT A;  3T7L A;  2KWK A;  1K2F A;  2LRI C;  2LQ6 A;  3ZPV 1;  4YAB A;  5AIT A;  2XB1 A;  1U6G B;  3ZTG A;  3N9P A;  2K17 A;  3MHH A;  4F52 B;  4MSX A;  5G05 B;  1JM7 A;  5B76 A;  4LLB A;  4R7E A;  4GNE A;  2LN0 A;  1HYI A;  4A4B A;  1WEV A;  4S3O B;  5G0F A;  5H9M A;  2VP7 A;  4P5O B;  4IC2 A;  2YUR A;  1WIM A;  2LGK A;  3HTK C;  2M85 A;  4FK5 A;  2ECN A;  4B7Y C;  3GV4 A;  4WA6 A;  1Z2Q A;  5DKA A;  4IC3 A;  2YRE A;  4AUQ B;  3PHD A;  3L1Z B;  1LDK C;  4WZ2 A;  4WZ3 B;  1WEP A;  4AYC B;  3O7A A;  3ZPV E;  3PUR A;  2C2V S;  4YC9 A;  3M63 A;  5FER A;  2MA5 A;  2KU3 A;  2LV9 A;  2MD8 C;  3L11 A;  3NG2 A;  3VK6 A;  3O36 A;  4X3G A;  3RPG C;  1G25 A;  2RSD A;  1WEN A;  4S3O C;  5JG6 A;  3N9M A;  4CA1 A;  1BOR A;  2F42 A;  5B75 A;  2YQM A;  5J3X A;  3O33 A;  2F6J A;  4B86 C;  3O34 A;  5FEY A;  3SHB A;  4W4U A;  1X4I A;  2MD7 B;  3DQV R;  5KH9 A;  2L5U A;  2EA6 A;  4GND A;  3HCT A;  4A0C D;  5LKU A;  2M3H A;  1X4U A;  3KQI A;  3O35 A;  2MNY A;  3C6W A;  3ZVY A;  2FUU A;  3ASL A;  2ZET C;  2HDP A;  3PUQ A;  1VD4 A;  5KH7 A;  5D1M B;  1JM7 B;  1WFK A;  3V43 A;  1XWH A;  1RMD A;  4MVT A;  4XI1 A;  4A49 A;  2MNZ A;  4NN2 A;  4I7D A;  2LGV A;  3N9Q A;  4UI9 B;  4ZQL A;  2E6R A;  4QF3 A;  2KE1 A;  1CHC A;  2QJ0 A;  5B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...