2DJAA

Solution structure of the b-box domain of the human midline-2 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GSSGSSGVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Midline-2
publication title Solution structure of the B-box domain of the human Midline-2 protein
rcsb
source organism Homo sapiens
total genus 7
structure length 84
sequence length 84
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2djaA00
2D8UA 2EGMA 2DJAA 3DDTA 2CSVA 5K3QA 2YVRA 2JUNA 3Q1DA
chains in the Genus database with same CATH superfamily
5D1LB 2KFTA 2E61A 2VPGA 1X4JA 5C13A 2YU4A 3ASLA 2CKLA 4N4FA 4A4CA 4I7CA 1MM2A 3U5PA 1N87A 5B76A 2BAYA 3SOXA 4P5OB 2H0DB 2LQ6A 1DVPA 1FP0A 4Z0OA 2HYED 3HTKC 4W4UA 4YBSA 5DINA 4C9ZA 1VYXA 2KWNA 2XP0A 1X4IA 3I2DA 1WEOA 2YHNA 4Z0RA 5TRBA 3DPLR 2HDPA 2K4DA 2L5UA 1X4UA 2K16A 2F6NA 2PNXA 4YC9A 1Z2QA 2VPDA 3N9LA 2EODA 1WEUA 5C11A 2CONA 2IQJA 3U5NA 4LLBA 3L1XA 1DCQA 2JMIA 2C2VS 2Y1NA 5DKAA 1JM7A 2ECIA 3KV5A 2VJFB 4IC3A 1WESA 1VD4A 3LQHA 1MBMA 3LRQA 5B8DA 5H1TA 2E6RA 2MD7B 2RR4A 2LGLA 3M7KA 2UZGA 4S3OC 4BHWA 5TBNA 3GV4A 4AYCB 2EGPA 2P57A 3LDYA 2ECVA 1G25A 2M13A 2LGGA 4O62A 2NAAA 3O7AA 3RPGB 4UP5A 1WENA 4WZ2A 3DWDA 5FB0A 3VK6A 2JM3A 4L7XA 2VPBA 1WEQA 2L43A 3FANA 4F52B 4GNFA 2CKLB 2CRRA 2FD4A 4R2YA 3C6WA 4QF3A 2MKEA 4GNEA 3ZYQA 5TDRA 2E6SA 2YURA 1WEVA 3O34A 5H1VA 2DX8A 5SVYA 4YBMA 4B7YC 3ZVYA 4LK9A 1JOCA 3LQIA 4GB0A 1WIMA 3ZVZB 3MHSA 3SHBA 3V43A 2JUNA 2MT5A 4CCGX 1WEMA 1K2FA 1T1HA 5LKTA 2EXUA 3O35A 4ZDTA 3FM8C 1HYIA 2JMJA 2L0BA 1V87A 2ZETC 2KYUA 4OGEA 2KWOA 3M63A 3LVQE 5KH3A 4MVTA 2OXQC 4V3LC 2D8UA 2EGMA 2JRJA 2FSAA 3FAOA 3T7LA 3C5KA 4I7DA 1WEEA 2VP7A 1JM7B 5K3QA 3JUEA 2L7PA 4O64A 5LKZA 4QF2A 3T6RA 5LKUA 2DJAA 2YUCA 3N9NA 2MIQA 3ZNIA 2KE1A 2FUUA 4I7BA 5B78A 2CSVA 2XB1A 3EB6A 4ZUXU 2AN6A 4YADA 5D1MB 2LGVA 3PLWA 5D1KB 2M3HA 5LCWB 1WE9A 2L80A 4R8PK 3HCTA 2B0OE 4A4BA 3O47A 1LDKC 4AUQB 4UI9B 2YW8A 3LJUX 4GNDA 4AP4A 2M6MA 2VNFA 2PUYA 4F1PA 2ECGA 5J3XA 3FJUB 3ZTGA 2JMDA 2KKXA 5G0FA 4FO9A 2YVRA 2KU3A 5G04B 4LADB 3KQIA 2YHOA 4QQ4A 3PHDA 2OWAA 4WZ0A 2RSDA 3EB5A 2XOYA 2XOZA 2K17A 1LDJB 2KIZA 2K1JA 2YT5A 2QIZA 3RTRB 4H9DA 3FEHA 2LXHC 4YATA 3N9PA 5AITA 3H7HA 2KGGA 3U5OA 3DDTA 4A49A 3O33A 5H1UA 3LVRE 5SVXA 1WEPA 3LQJA 1CHCA 1WEWA 5KH9A 2EA6A 5I3LA 3L1ZB 3KDEC 1XWHA 4NN2A 1MM3A 2VJEA 4IC2A 2MD8C 2KREA 4FK5A 2MA5A 2LV9A 3RPGC 2QJ0A 4YABA 4XI1A 3KV6A 5SVIA 2RI7A 5G05B 3PUQA 2MNZA 2MA6A 2YQLA 4FJCA 2LGKA 1U6GB 5TABA 3T9KA 2YSJA 2LN0A 3SOUA 3GL6A 3NG2A 2XOCA 2I50A 2F42A 2ECJA 5LKXA 4FIPA 5FERA 2LRIC 4X3GA 2KWKA 4YBTA 4WA6A 2FFWA 3SUBA 4BBQA 2YQMA 2VPEA 4OGCA 2KR4A 3ZPV1 4PTBA 2LXPC 4R7EA 5AIUA 2ECTA 1FBVA 2MNYA 2YYRA 1Z6UA 4S3OB 2LAUA 3IHPA 3O36A 3MDBC 2L75A 1Z60A 4N3WA 5H9MA 3O70A 4PPEA 2D8SA 1RMDA 1IYMA 5TDWA 4L58A 2H0DA 2ECWA 2C2LA 1WILA 4YAXA 4TKPB 2G6QA 2CRWA 3Q1DA 2CSZA 3U5MA 3E2DA 3O37A 4AVXA 1ZBDB 4ZQLA 3KNVA 2LDRA 2KKYA 2FUIA 1BORA 4A0CD 2Y1MA 2M85A 3M99A 2VJEB 1F62A 2KWJA 5B77A 3HCSA 5KH7A 2YREA 3N9MA 5FEYA 4MSXA 5EYAF 4V3KC 5SVIB 4B86C 1VFYA 4Q6FA 1HYJA 5B75A 3FL2A 2YSMA 3L11A 1WGMA 2MUMA 2XEUA 2CSYA 3N9QA 3ZPVE 2VJFA 4LKAA 3PURA 2QICA 2ECNA 4CA1A 3MHHA 1WFKA 3HCUA 1E4UA 2IDAA 3SOWA 2G45A 2KGIA 3QZVA 3DQVR 4AYCA 3N9OA 2G43A 2F6JA 2DSMA 2CT2A 5FB1A 3M62A 4LJNA 5JG6A 4GNGA 4UP0A 2Y43A 5B79A 2M1RA 4WZ3B
chains in the Genus database with same CATH topology
2D8UA 2EGMA 3DWDA 3FEHA 3PLWA 2YREA 2E61A 2CONA 2IQJA 2JM3A 2JUNA 2XOCA 2YVRA 2CRWA 3H7HA 3Q1DA 1DCQA 3E2DA 2CRRA 3DDTA 2FD4A 2XP0A 5SVIB 5K3QA 2B0OE 3JUEA 3M7KA 4QQ4A 2L7PA 2P57A 2EXUA 3O47A 4Z0RA 3LDYA 3LVRE 2OWAA 2MKEA 2KKYA 3FM8C 5SVIA 5SVXA 2LAUA 2M13A 2DJAA 3LJUX 3MDBC 4O62A 4F1PA 2XOYA 2FFWA 2XOZA 3FJUB 3SUBA 5SVYA 4OGEA 2CSVA 4OGCA 4Z0OA 3KDEC 2RR4A 3LVQE 4H9DA 3T9KA 2KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8U A;  2EGM A;  2DJA A;  3DDT A;  2CSV A;  5K3Q A;  2YVR A;  2JUN A;  3Q1D A; 
#chains in the Genus database with same CATH topology
 5D1L B;  2KFT A;  2E61 A;  2VPG A;  1X4J A;  5C13 A;  2YU4 A;  3ASL A;  2CKL A;  4N4F A;  4A4C A;  4I7C A;  1MM2 A;  3U5P A;  1N87 A;  5B76 A;  2BAY A;  3SOX A;  4P5O B;  2H0D B;  2LQ6 A;  1DVP A;  1FP0 A;  4Z0O A;  2HYE D;  3HTK C;  4W4U A;  4YBS A;  5DIN A;  4C9Z A;  1VYX A;  2KWN A;  2XP0 A;  1X4I A;  3I2D A;  1WEO A;  2YHN A;  4Z0R A;  5TRB A;  3DPL R;  2HDP A;  2K4D A;  2L5U A;  1X4U A;  2K16 A;  2F6N A;  2PNX A;  4YC9 A;  1Z2Q A;  2VPD A;  3N9L A;  2EOD A;  1WEU A;  5C11 A;  2CON A;  2IQJ A;  3U5N A;  4LLB A;  3L1X A;  1DCQ A;  2JMI A;  2C2V S;  2Y1N A;  5DKA A;  1JM7 A;  2ECI A;  3KV5 A;  2VJF B;  4IC3 A;  1WES A;  1VD4 A;  3LQH A;  1MBM A;  3LRQ A;  5B8D A;  5H1T A;  2E6R A;  2MD7 B;  2RR4 A;  2LGL A;  3M7K A;  2UZG A;  4S3O C;  4BHW A;  5TBN A;  3GV4 A;  4AYC B;  2EGP A;  2P57 A;  3LDY A;  2ECV A;  1G25 A;  2M13 A;  2LGG A;  4O62 A;  2NAA A;  3O7A A;  3RPG B;  4UP5 A;  1WEN A;  4WZ2 A;  3DWD A;  5FB0 A;  3VK6 A;  2JM3 A;  4L7X A;  2VPB A;  1WEQ A;  2L43 A;  3FAN A;  4F52 B;  4GNF A;  2CKL B;  2CRR A;  2FD4 A;  4R2Y A;  3C6W A;  4QF3 A;  2MKE A;  4GNE A;  3ZYQ A;  5TDR A;  2E6S A;  2YUR A;  1WEV A;  3O34 A;  5H1V A;  2DX8 A;  5SVY A;  4YBM A;  4B7Y C;  3ZVY A;  4LK9 A;  1JOC A;  3LQI A;  4GB0 A;  1WIM A;  3ZVZ B;  3MHS A;  3SHB A;  3V43 A;  2JUN A;  2MT5 A;  4CCG X;  1WEM A;  1K2F A;  1T1H A;  5LKT A;  2EXU A;  3O35 A;  4ZDT A;  3FM8 C;  1HYI A;  2JMJ A;  2L0B A;  1V87 A;  2ZET C;  2KYU A;  4OGE A;  2KWO A;  3M63 A;  3LVQ E;  5KH3 A;  4MVT A;  2OXQ C;  4V3L C;  2D8U A;  2EGM A;  2JRJ A;  2FSA A;  3FAO A;  3T7L A;  3C5K A;  4I7D A;  1WEE A;  2VP7 A;  1JM7 B;  5K3Q A;  3JUE A;  2L7P A;  4O64 A;  5LKZ A;  4QF2 A;  3T6R A;  5LKU A;  2DJA A;  2YUC A;  3N9N A;  2MIQ A;  3ZNI A;  2KE1 A;  2FUU A;  4I7B A;  5B78 A;  2CSV A;  2XB1 A;  3EB6 A;  4ZUX U;  2AN6 A;  4YAD A;  5D1M B;  2LGV A;  3PLW A;  5D1K B;  2M3H A;  5LCW B;  1WE9 A;  2L80 A;  4R8P K;  3HCT A;  2B0O E;  4A4B A;  3O47 A;  1LDK C;  4AUQ B;  4UI9 B;  2YW8 A;  3LJU X;  4GND A;  4AP4 A;  2M6M A;  2VNF A;  2PUY A;  4F1P A;  2ECG A;  5J3X A;  3FJU B;  3ZTG A;  2JMD A;  2KKX A;  5G0F A;  4FO9 A;  2YVR A;  2KU3 A;  5G04 B;  4LAD B;  3KQI A;  2YHO A;  4QQ4 A;  3PHD A;  2OWA A;  4WZ0 A;  2RSD A;  3EB5 A;  2XOY A;  2XOZ A;  2K17 A;  1LDJ B;  2KIZ A;  2K1J A;  2YT5 A;  2QIZ A;  3RTR B;  4H9D A;  3FEH A;  2LXH C;  4YAT A;  3N9P A;  5AIT A;  3H7H A;  2KGG A;  3U5O A;  3DDT A;  4A49 A;  3O33 A;  5H1U A;  3LVR E;  5SVX A;  1WEP A;  3LQJ A;  1CHC A;  1WEW A;  5KH9 A;  2EA6 A;  5I3L A;  3L1Z B;  3KDE C;  1XWH A;  4NN2 A;  1MM3 A;  2VJE A;  4IC2 A;  2MD8 C;  2KRE A;  4FK5 A;  2MA5 A;  2LV9 A;  3RPG C;  2QJ0 A;  4YAB A;  4XI1 A;  3KV6 A;  5SVI A;  2RI7 A;  5G05 B;  3PUQ A;  2MNZ A;  2MA6 A;  2YQL A;  4FJC A;  2LGK A;  1U6G B;  5TAB A;  3T9K A;  2YSJ A;  2LN0 A;  3SOU A;  3GL6 A;  3NG2 A;  2XOC A;  2I50 A;  2F42 A;  2ECJ A;  5LKX A;  4FIP A;  5FER A;  2LRI C;  4X3G A;  2KWK A;  4YBT A;  4WA6 A;  2FFW A;  3SUB A;  4BBQ A;  2YQM A;  2VPE A;  4OGC A;  2KR4 A;  3ZPV 1;  4PTB A;  2LXP C;  4R7E A;  5AIU A;  2ECT A;  1FBV A;  2MNY A;  2YYR A;  1Z6U A;  4S3O B;  2LAU A;  3IHP A;  3O36 A;  3MDB C;  2L75 A;  1Z60 A;  4N3W A;  5H9M A;  3O70 A;  4PPE A;  2D8S A;  1RMD A;  1IYM A;  5TDW A;  4L58 A;  2H0D A;  2ECW A;  2C2L A;  1WIL A;  4YAX A;  4TKP B;  2G6Q A;  2CRW A;  3Q1D A;  2CSZ A;  3U5M A;  3E2D A;  3O37 A;  4AVX A;  1ZBD B;  4ZQL A;  3KNV A;  2LDR A;  2KKY A;  2FUI A;  1BOR A;  4A0C D;  2Y1M A;  2M85 A;  3M99 A;  2VJE B;  1F62 A;  2KWJ A;  5B77 A;  3HCS A;  5KH7 A;  2YRE A;  3N9M A;  5FEY A;  4MSX A;  5EYA F;  4V3K C;  5SVI B;  4B86 C;  1VFY A;  4Q6F A;  1HYJ A;  5B75 A;  3FL2 A;  2YSM A;  3L11 A;  1WGM A;  2MUM A;  2XEU A;  2CSY A;  3N9Q A;  3ZPV E;  2VJF A;  4LKA A;  3PUR A;  2QIC A;  2ECN A;  4CA1 A;  3MHH A;  1WFK A;  3HCU A;  1E4U A;  2IDA A;  3SOW A;  2G45 A;  2KGI A;  3QZV A;  3DQV R;  4AYC A;  3N9O A;  2G43 A;  2F6J A;  2DSM A;  2CT2 A;  5FB1 A;  3M62 A;  4LJN A;  5JG6 A;  4GNG A;  4UP0 A;  2Y43 A;  5B79 A;  2M1R A;  4WZ3 B; 
#chains in the Genus database with same CATH homology
 2D8U A;  2EGM A;  3DWD A;  3FEH A;  3PLW A;  2YRE A;  2E61 A;  2CON A;  2IQJ A;  2JM3 A;  2JUN A;  2XOC A;  2YVR A;  2CRW A;  3H7H A;  3Q1D A;  1DCQ A;  3E2D A;  2CRR A;  3DDT A;  2FD4 A;  2XP0 A;  5SVI B;  5K3Q A;  2B0O E;  3JUE A;  3M7K A;  4QQ4 A;  2L7P A;  2P57 A;  2EXU A;  3O47 A;  4Z0R A;  3LDY A;  3LVR E;  2OWA A;  2MKE A;  2KKY A;  3FM8 C;  5SVI A;  5SVX A;  2LAU A;  2M13 A;  2DJA A;  3LJU X;  3MDB C;  4O62 A;  4F1P A;  2XOY A;  2FFW A;  2XOZ A;  3FJU B;  3SUB A;  5SVY A;  4OGE A;  2CSV A;  4OGC A;  4Z0O A;  3KDE C;  2RR4 A;  3LVQ E;  4H9D A;  3T9K A;  2KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...