2MT5A

Isolated ring domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'GSVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 11
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mt5A00
1VYXA 2LGVA 2XB1A 4IC2A 1VD4A 5LKUA 2LGKA 4I7DA 2Y1MA 2KGGA 2C2VS 2MD8C 5DKAA 2VJFA 3ASLA 2L75A 2E6RA 3O7AA 2M3HA 2JMIA 4LKAA 5AIUA 3O35A 3LQHA 2YHNA 4YBMA 1Z2QA 4V3LC 2VPBA 5H1VA 4Q6FA 5C11A 2ECIA 4NN2A 1WE9A 2ECNA 2ECTA 4GNDA 4QF3A 1WEOA 2E6SA 3T6RA 4B86C 3U5MA 2YYRA 4AYCB 4FIPA 4LK9A 1FP0A 2RSDA 1WGMA 4A4CA 1WEQA 1WFKA 2MA6A 4FK5A 2LGLA 4YAXA 2PNXA 2MNYA 4GB0A 3L1XA 4AP4A 2L0BA 4CCGX 5AITA 3U5NA 1U6GB 2EGPA 3LQJA 2YUCA 3RTRB 2NAAA 2YT5A 3ZYQA 2L5UA 2KWNA 2MNZA 2G43A 3SOUA 3KQIA 3ZPV1 4UI9B 2MIQA 3ZVZB 3KV5A 2YU4A 3PURA 2QICA 2LQ6A 3C6WA 1WILA 1HYJA 2FUUA 2K1JA 2YQLA 2ZETC 1WESA 5KH7A 2OXQC 3IHPA 4YBTA 2AN6A 4LJNA 4R2YA 2K4DA 1F62A 4L58A 1MM3A 2CKLB 2YURA 4LLBA 2VNFA 4TKPB 5FEYA 5G0FA 2YSJA 5EYAF 2H0DB 2YSMA 5C13A 5FERA 4WA6A 5G05B 4ZDTA 4WZ2A 2LDRA 3N9LA 5D1KB 3LRQA 4AYCA 4F52B 3L1ZB 4N4FA 1N87A 4I7CA 5B76A 4R8PK 1XWHA 5KH9A 1WEUA 3VK6A 4C9ZA 5D1LB 4O64A 4MVTA 1JOCA 3O37A 4WZ3B 5B78A 5LKZA 1JM7A 3QZVA 2LRIC 4BBQA 2MD7B 3N9PA 3V43A 2FSAA 3N9QA 2LXPC 4L7XA 4P5OB 3DQVR 2VPEA 1HYIA 2F42A 3EB6A 1WEMA 5TDRA 4PPEA 1WEEA 4ZUXU 2PUYA 2FUIA 3SOXA 1X4UA 4YC9A 2JRJA 2D8SA 2K16A 2RI7A 2VJFB 2HDPA 1Z60A 2JMJA 5I3LA 2KR4A 4A49A 4GNFA 3I2DA 2KREA 2MUMA 3ZTGA 3MHHA 5TBNA 3M63A 3U5OA 5B79A 5TABA 4IC3A 1LDKC 5H1UA 4A0CD 1MM2A 3GV4A 1IYMA 2MT5A 2KWKA 2KFTA 2M1RA 2M6MA 2YQMA 3PUQA 5JG6A 1LDJB 3KV6A 4R7EA 3ZVYA 1ZBDB 3KNVA 4CA1A 1WIMA 3N9OA 3U5PA 4ZQLA 5TRBA 1FBVA 4UP0A 4LADB 4W4UA 5J3XA 3ZNIA 1DVPA 1CHCA 4B7YC 4X3GA 3HTKC 2VPDA 1G25A 4FJCA 2MA5A 3LQIA 4BHWA 1T1HA 3HCSA 2YHOA 4PTBA 4MSXA 4V3KC 5B8DA 2KE1A 1WEWA 2LXHC 1E4UA 4S3OC 5D1MB 5KH3A 2KU3A 2VJEB 5G04B 2HYED 5LKTA 2KYUA 2M85A 2LN0A 4WZ0A 5B77A 3L11A 2KIZA 1WEVA 2CT2A 2L43A 3N9MA 4GNEA 3PHDA 5LCWB 4YADA 2LGGA 2XEUA 4GNGA 4I7BA 1Z6UA 2UZGA 3HCTA 2ECGA 1X4JA 2Y1NA 4AVXA 2YW8A 3RPGB 4QF2A 4UP5A 5FB0A 4YATA 5H1TA 1VFYA 2CKLA 4FO9A 2C2LA 1WENA 2H0DA 3M62A 3EB5A 2KWOA 2BAYA 3T7LA 2YREA 4XI1A 2CSZA 3O33A 3NG2A 2L80A 4AUQB 5LKXA 5TDWA 1BORA 2QJ0A 5H9MA 5DINA 2QIZA 3FL2A 3GL6A 2F6JA 3O70A 3RPGC 2I50A 3M99A 2EODA 3HCUA 3MHSA 3C5KA 3ZPVE 2LV9A 5FB1A 2Y43A 4A4BA 2CSYA 3N9NA 4YBSA 1JM7B 2VPGA 2ECJA 2KGIA 2DX8A 2IDAA 3SOWA 3O34A 1WEPA 1RMDA 2G6QA 1V87A 2VP7A 2KWJA 2ECWA 2VJEA 3DPLR 4YABA 2EA6A 2ECVA 3O36A 2F6NA 2K17A 2G45A 1K2FA 5B75A 4S3OB 2JMDA 4N3WA 1X4IA 3SHBA
chains in the Genus database with same CATH superfamily
1VYXA 2LGVA 2XB1A 4IC2A 1VD4A 5LKUA 2LGKA 4I7DA 2Y1MA 2KGGA 2C2VS 2LAUA 2MD8C 5DKAA 2VJFA 3ASLA 2L75A 2E6RA 3O7AA 2M3HA 2JMIA 4LKAA 5AIUA 3O35A 3LQHA 2YHNA 4YBMA 1Z2QA 3JUEA 4V3LC 2VPBA 5H1VA 3E2DA 4Q6FA 5C11A 2ECIA 4NN2A 1WE9A 2CSVA 2ECNA 2ECTA 4GNDA 4QF3A 1WEOA 2E6SA 3T6RA 4B86C 3U5MA 2YYRA 4AYCB 4FIPA 4LK9A 1FP0A 2RSDA 1WGMA 4A4CA 1WEQA 1WFKA 2MA6A 2KKYA 2JM3A 4FK5A 2LGLA 4YAXA 4QQ4A 2PNXA 2MNYA 4GB0A 3L1XA 2RR4A 2XOZA 3PLWA 4AP4A 2L0BA 4CCGX 5AITA 3U5NA 5SVIB 1U6GB 2EGPA 3LQJA 3LDYA 2YUCA 3RTRB 2NAAA 2YT5A 3ZYQA 2L5UA 2KWNA 2MNZA 2G43A 4H9DA 3SOUA 3KQIA 3ZPV1 4UI9B 2MIQA 3FM8C 3ZVZB 2DJAA 3KV5A 2YU4A 3PURA 5SVXA 2QICA 3DDTA 2LQ6A 3M7KA 3C6WA 1WILA 1HYJA 2FUUA 2K1JA 2YQLA 2ZETC 3H7HA 1WESA 5KH7A 2OXQC 3IHPA 4YBTA 2AN6A 2CRWA 4LJNA 4OGEA 4R2YA 3FANA 2K4DA 1F62A 4L58A 1MM3A 2CKLB 2YURA 4LLBA 2VNFA 4TKPB 5FEYA 2MKEA 2YSJA 5G0FA 5EYAF 2H0DB 2YSMA 5C13A 2M13A 5FERA 4WA6A 3FJUB 5G05B 4ZDTA 4WZ2A 2LDRA 3N9LA 5D1KB 3LRQA 4AYCA 4F52B 3L1ZB 4N4FA 5K3QA 1N87A 4I7CA 4Z0RA 5B76A 4R8PK 1XWHA 5KH9A 2CRRA 1WEUA 3VK6A 4C9ZA 5D1LB 4O64A 4MVTA 1JOCA 3O37A 4WZ3B 5SVYA 5B78A 2DSMA 5LKZA 3LVRE 1JM7A 3QZVA 2EGMA 2LRIC 4BBQA 2MD7B 3FEHA 3N9PA 3V43A 2OWAA 2FSAA 3N9QA 2LXPC 4L7XA 4P5OB 3DQVR 3DWDA 2VPEA 1HYIA 2F42A 3EB6A 1WEMA 5TDRA 3O47A 4O62A 4PPEA 1WEEA 4ZUXU 2PUYA 2EXUA 2KKXA 2FUIA 3SOXA 1X4UA 4YC9A 2JRJA 2D8SA 2XOCA 2K16A 2RI7A 2VJFB 2HDPA 1Z60A 2JMJA 5I3LA 2KR4A 4A49A 4GNFA 3I2DA 2KREA 2MUMA 3MDBC 3ZTGA 4OGCA 2XOYA 3MHHA 5TBNA 3SUBA 3M63A 3U5OA 5B79A 5TABA 4IC3A 1LDKC 5H1UA 4A0CD 1MM2A 3GV4A 1IYMA 2MT5A 2KWKA 2KFTA 2B0OE 2M1RA 2M6MA 2XP0A 2YQMA 3PUQA 5JG6A 1LDJB 3KV6A 4R7EA 3ZVYA 1ZBDB 3KNVA 4CA1A 1WIMA 3N9OA 3U5PA 4ZQLA 5TRBA 1FBVA 4UP0A 3T9KA 4LADB 4W4UA 2FFWA 5J3XA 2D8UA 3LVQE 3ZNIA 1DVPA 1CHCA 4B7YC 4X3GA 2JUNA 3HTKC 2VPDA 3LJUX 1G25A 4FJCA 2MA5A 2E61A 3LQIA 2L7PA 4BHWA 1T1HA 3HCSA 2YHOA 4PTBA 5SVIA 4MSXA 4Z0OA 4V3KC 5B8DA 2KE1A 1WEWA 2LXHC 1E4UA 4S3OC 5D1MB 5KH3A 2KU3A 2VJEB 5G04B 2HYED 5LKTA 2KYUA 2M85A 2LN0A 2P57A 4WZ0A 5B77A 3L11A 2KIZA 1WEVA 2CT2A 2L43A 3N9MA 4GNEA 3PHDA 5LCWB 4YADA 2LGGA 2XEUA 4GNGA 3KDEC 4I7BA 2YVRA 1Z6UA 1MBMA 2UZGA 3HCTA 2ECGA 1X4JA 2Y1NA 4AVXA 2YW8A 3FAOA 3RPGB 4QF2A 4UP5A 5FB0A 4YATA 5H1TA 1VFYA 2CKLA 4FO9A 2CONA 2C2LA 1WENA 2H0DA 3M62A 3EB5A 2KWOA 2BAYA 3T7LA 2YREA 4XI1A 2CSZA 3O33A 3NG2A 2L80A 4AUQB 5LKXA 5TDWA 1DCQA 1BORA 2QJ0A 5H9MA 5DINA 2QIZA 3FL2A 3GL6A 2F6JA 3O70A 3RPGC 2I50A 3M99A 2EODA 3HCUA 3MHSA 3C5KA 3ZPVE 2LV9A 5FB1A 2Y43A 4A4BA 2CSYA 3N9NA 4YBSA 1JM7B 2VPGA 2ECJA 2KGIA 2DX8A 2IDAA 3SOWA 3O34A 1WEPA 1RMDA 2G6QA 1V87A 2VP7A 2KWJA 2ECWA 2VJEA 3DPLR 4YABA 4F1PA 2EA6A 2ECVA 3O36A 2F6NA 2K17A 2G45A 3Q1DA 1K2FA 2IQJA 5B75A 4S3OB 2JMDA 4N3WA 1X4IA 2FD4A 3SHBA
chains in the Genus database with same CATH topology
1VYXA 2LGVA 2XB1A 4IC2A 1VD4A 5LKUA 2LGKA 4I7DA 2Y1MA 2KGGA 2C2VS 2MD8C 5DKAA 2VJFA 3ASLA 2L75A 2E6RA 3O7AA 2M3HA 2JMIA 4LKAA 5AIUA 3O35A 3LQHA 2YHNA 4YBMA 1Z2QA 4V3LC 2VPBA 5H1VA 4Q6FA 5C11A 2ECIA 4NN2A 1WE9A 2ECNA 2ECTA 4GNDA 4QF3A 1WEOA 2E6SA 3T6RA 4B86C 3U5MA 2YYRA 4AYCB 4FIPA 4LK9A 1FP0A 2RSDA 1WGMA 4A4CA 1WEQA 1WFKA 2MA6A 4FK5A 2LGLA 4YAXA 2PNXA 2MNYA 4GB0A 3L1XA 4AP4A 2L0BA 4CCGX 5AITA 3U5NA 1U6GB 2EGPA 3LQJA 2YUCA 3RTRB 2NAAA 2YT5A 3ZYQA 2L5UA 2KWNA 2MNZA 2G43A 3SOUA 3KQIA 3ZPV1 4UI9B 2MIQA 3ZVZB 3KV5A 2YU4A 3PURA 2QICA 2LQ6A 3C6WA 1WILA 1HYJA 2FUUA 2K1JA 2YQLA 2ZETC 1WESA 5KH7A 2OXQC 3IHPA 4YBTA 2AN6A 4LJNA 4R2YA 2K4DA 1F62A 4L58A 1MM3A 2CKLB 2YURA 4LLBA 2VNFA 4TKPB 5FEYA 5G0FA 2YSJA 5EYAF 2H0DB 2YSMA 5C13A 5FERA 4WA6A 5G05B 4ZDTA 4WZ2A 2LDRA 3N9LA 5D1KB 3LRQA 4AYCA 4F52B 3L1ZB 4N4FA 1N87A 4I7CA 5B76A 4R8PK 1XWHA 5KH9A 1WEUA 3VK6A 4C9ZA 5D1LB 4O64A 4MVTA 1JOCA 3O37A 4WZ3B 5B78A 5LKZA 1JM7A 3QZVA 2LRIC 4BBQA 2MD7B 3N9PA 3V43A 2FSAA 3N9QA 2LXPC 4L7XA 4P5OB 3DQVR 2VPEA 1HYIA 2F42A 3EB6A 1WEMA 5TDRA 4PPEA 1WEEA 4ZUXU 2PUYA 2FUIA 3SOXA 1X4UA 4YC9A 2JRJA 2D8SA 2K16A 2RI7A 2VJFB 2HDPA 1Z60A 2JMJA 5I3LA 2KR4A 4A49A 4GNFA 3I2DA 2KREA 2MUMA 3ZTGA 3MHHA 5TBNA 3M63A 3U5OA 5B79A 5TABA 4IC3A 1LDKC 5H1UA 4A0CD 1MM2A 3GV4A 1IYMA 2MT5A 2KWKA 2KFTA 2M1RA 2M6MA 2YQMA 3PUQA 5JG6A 1LDJB 3KV6A 4R7EA 3ZVYA 1ZBDB 3KNVA 4CA1A 1WIMA 3N9OA 3U5PA 4ZQLA 5TRBA 1FBVA 4UP0A 4LADB 4W4UA 5J3XA 3ZNIA 1DVPA 1CHCA 4B7YC 4X3GA 3HTKC 2VPDA 1G25A 4FJCA 2MA5A 3LQIA 4BHWA 1T1HA 3HCSA 2YHOA 4PTBA 4MSXA 4V3KC 5B8DA 2KE1A 1WEWA 2LXHC 1E4UA 4S3OC 5D1MB 5KH3A 2KU3A 2VJEB 5G04B 2HYED 5LKTA 2KYUA 2M85A 2LN0A 4WZ0A 5B77A 3L11A 2KIZA 1WEVA 2CT2A 2L43A 3N9MA 4GNEA 3PHDA 5LCWB 4YADA 2LGGA 2XEUA 4GNGA 4I7BA 1Z6UA 2UZGA 3HCTA 2ECGA 1X4JA 2Y1NA 4AVXA 2YW8A 3RPGB 4QF2A 4UP5A 5FB0A 4YATA 5H1TA 1VFYA 2CKLA 4FO9A 2C2LA 1WENA 2H0DA 3M62A 3EB5A 2KWOA 2BAYA 3T7LA 2YREA 4XI1A 2CSZA 3O33A 3NG2A 2L80A 4AUQB 5LKXA 5TDWA 1BORA 2QJ0A 5H9MA 5DINA 2QIZA 3FL2A 3GL6A 2F6JA 3O70A 3RPGC 2I50A 3M99A 2EODA 3HCUA 3MHSA 3C5KA 3ZPVE 2LV9A 5FB1A 2Y43A 4A4BA 2CSYA 3N9NA 4YBSA 1JM7B 2VPGA 2ECJA 2KGIA 2DX8A 2IDAA 3SOWA 3O34A 1WEPA 1RMDA 2G6QA 1V87A 2VP7A 2KWJA 2ECWA 2VJEA 3DPLR 4YABA 2EA6A 2ECVA 3O36A 2F6NA 2K17A 2G45A 1K2FA 5B75A 4S3OB 2JMDA 4N3WA 1X4IA 3SHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYX A;  2LGV A;  2XB1 A;  4IC2 A;  1VD4 A;  5LKU A;  2LGK A;  4I7D A;  2Y1M A;  2KGG A;  2C2V S;  2MD8 C;  5DKA A;  2VJF A;  3ASL A;  2L75 A;  2E6R A;  3O7A A;  2M3H A;  2JMI A;  4LKA A;  5AIU A;  3O35 A;  3LQH A;  2YHN A;  4YBM A;  1Z2Q A;  4V3L C;  2VPB A;  5H1V A;  4Q6F A;  5C11 A;  2ECI A;  4NN2 A;  1WE9 A;  2ECN A;  2ECT A;  4GND A;  4QF3 A;  1WEO A;  2E6S A;  3T6R A;  4B86 C;  3U5M A;  2YYR A;  4AYC B;  4FIP A;  4LK9 A;  1FP0 A;  2RSD A;  1WGM A;  4A4C A;  1WEQ A;  1WFK A;  2MA6 A;  4FK5 A;  2LGL A;  4YAX A;  2PNX A;  2MNY A;  4GB0 A;  3L1X A;  4AP4 A;  2L0B A;  4CCG X;  5AIT A;  3U5N A;  1U6G B;  2EGP A;  3LQJ A;  2YUC A;  3RTR B;  2NAA A;  2YT5 A;  3ZYQ A;  2L5U A;  2KWN A;  2MNZ A;  2G43 A;  3SOU A;  3KQI A;  3ZPV 1;  4UI9 B;  2MIQ A;  3ZVZ B;  3KV5 A;  2YU4 A;  3PUR A;  2QIC A;  2LQ6 A;  3C6W A;  1WIL A;  1HYJ A;  2FUU A;  2K1J A;  2YQL A;  2ZET C;  1WES A;  5KH7 A;  2OXQ C;  3IHP A;  4YBT A;  2AN6 A;  4LJN A;  4R2Y A;  2K4D A;  1F62 A;  4L58 A;  1MM3 A;  2CKL B;  2YUR A;  4LLB A;  2VNF A;  4TKP B;  5FEY A;  5G0F A;  2YSJ A;  5EYA F;  2H0D B;  2YSM A;  5C13 A;  5FER A;  4WA6 A;  5G05 B;  4ZDT A;  4WZ2 A;  2LDR A;  3N9L A;  5D1K B;  3LRQ A;  4AYC A;  4F52 B;  3L1Z B;  4N4F A;  1N87 A;  4I7C A;  5B76 A;  4R8P K;  1XWH A;  5KH9 A;  1WEU A;  3VK6 A;  4C9Z A;  5D1L B;  4O64 A;  4MVT A;  1JOC A;  3O37 A;  4WZ3 B;  5B78 A;  5LKZ A;  1JM7 A;  3QZV A;  2LRI C;  4BBQ A;  2MD7 B;  3N9P A;  3V43 A;  2FSA A;  3N9Q A;  2LXP C;  4L7X A;  4P5O B;  3DQV R;  2VPE A;  1HYI A;  2F42 A;  3EB6 A;  1WEM A;  5TDR A;  4PPE A;  1WEE A;  4ZUX U;  2PUY A;  2FUI A;  3SOX A;  1X4U A;  4YC9 A;  2JRJ A;  2D8S A;  2K16 A;  2RI7 A;  2VJF B;  2HDP A;  1Z60 A;  2JMJ A;  5I3L A;  2KR4 A;  4A49 A;  4GNF A;  3I2D A;  2KRE A;  2MUM A;  3ZTG A;  3MHH A;  5TBN A;  3M63 A;  3U5O A;  5B79 A;  5TAB A;  4IC3 A;  1LDK C;  5H1U A;  4A0C D;  1MM2 A;  3GV4 A;  1IYM A;  2MT5 A;  2KWK A;  2KFT A;  2M1R A;  2M6M A;  2YQM A;  3PUQ A;  5JG6 A;  1LDJ B;  3KV6 A;  4R7E A;  3ZVY A;  1ZBD B;  3KNV A;  4CA1 A;  1WIM A;  3N9O A;  3U5P A;  4ZQL A;  5TRB A;  1FBV A;  4UP0 A;  4LAD B;  4W4U A;  5J3X A;  3ZNI A;  1DVP A;  1CHC A;  4B7Y C;  4X3G A;  3HTK C;  2VPD A;  1G25 A;  4FJC A;  2MA5 A;  3LQI A;  4BHW A;  1T1H A;  3HCS A;  2YHO A;  4PTB A;  4MSX A;  4V3K C;  5B8D A;  2KE1 A;  1WEW A;  2LXH C;  1E4U A;  4S3O C;  5D1M B;  5KH3 A;  2KU3 A;  2VJE B;  5G04 B;  2HYE D;  5LKT A;  2KYU A;  2M85 A;  2LN0 A;  4WZ0 A;  5B77 A;  3L11 A;  2KIZ A;  1WEV A;  2CT2 A;  2L43 A;  3N9M A;  4GNE A;  3PHD A;  5LCW B;  4YAD A;  2LGG A;  2XEU A;  4GNG A;  4I7B A;  1Z6U A;  2UZG A;  3HCT A;  2ECG A;  1X4J A;  2Y1N A;  4AVX A;  2YW8 A;  3RPG B;  4QF2 A;  4UP5 A;  5FB0 A;  4YAT A;  5H1T A;  1VFY A;  2CKL A;  4FO9 A;  2C2L A;  1WEN A;  2H0D A;  3M62 A;  3EB5 A;  2KWO A;  2BAY A;  3T7L A;  2YRE A;  4XI1 A;  2CSZ A;  3O33 A;  3NG2 A;  2L80 A;  4AUQ B;  5LKX A;  5TDW A;  1BOR A;  2QJ0 A;  5H9M A;  5DIN A;  2QIZ A;  3FL2 A;  3GL6 A;  2F6J A;  3O70 A;  3RPG C;  2I50 A;  3M99 A;  2EOD A;  3HCU A;  3MHS A;  3C5K A;  3ZPV E;  2LV9 A;  5FB1 A;  2Y43 A;  4A4B A;  2CSY A;  3N9N A;  4YBS A;  1JM7 B;  2VPG A;  2ECJ A;  2KGI A;  2DX8 A;  2IDA A;  3SOW A;  3O34 A;  1WEP A;  1RMD A;  2G6Q A;  1V87 A;  2VP7 A;  2KWJ A;  2ECW A;  2VJE A;  3DPL R;  4YAB A;  2EA6 A;  2ECV A;  3O36 A;  2F6N A;  2K17 A;  2G45 A;  1K2F A;  5B75 A;  4S3O B;  2JMD A;  4N3W A;  1X4I A;  3SHB A; 
#chains in the Genus database with same CATH topology
 1VYX A;  2LGV A;  2XB1 A;  4IC2 A;  1VD4 A;  5LKU A;  2LGK A;  4I7D A;  2Y1M A;  2KGG A;  2C2V S;  2LAU A;  2MD8 C;  5DKA A;  2VJF A;  3ASL A;  2L75 A;  2E6R A;  3O7A A;  2M3H A;  2JMI A;  4LKA A;  5AIU A;  3O35 A;  3LQH A;  2YHN A;  4YBM A;  1Z2Q A;  3JUE A;  4V3L C;  2VPB A;  5H1V A;  3E2D A;  4Q6F A;  5C11 A;  2ECI A;  4NN2 A;  1WE9 A;  2CSV A;  2ECN A;  2ECT A;  4GND A;  4QF3 A;  1WEO A;  2E6S A;  3T6R A;  4B86 C;  3U5M A;  2YYR A;  4AYC B;  4FIP A;  4LK9 A;  1FP0 A;  2RSD A;  1WGM A;  4A4C A;  1WEQ A;  1WFK A;  2MA6 A;  2KKY A;  2JM3 A;  4FK5 A;  2LGL A;  4YAX A;  4QQ4 A;  2PNX A;  2MNY A;  4GB0 A;  3L1X A;  2RR4 A;  2XOZ A;  3PLW A;  4AP4 A;  2L0B A;  4CCG X;  5AIT A;  3U5N A;  5SVI B;  1U6G B;  2EGP A;  3LQJ A;  3LDY A;  2YUC A;  3RTR B;  2NAA A;  2YT5 A;  3ZYQ A;  2L5U A;  2KWN A;  2MNZ A;  2G43 A;  4H9D A;  3SOU A;  3KQI A;  3ZPV 1;  4UI9 B;  2MIQ A;  3FM8 C;  3ZVZ B;  2DJA A;  3KV5 A;  2YU4 A;  3PUR A;  5SVX A;  2QIC A;  3DDT A;  2LQ6 A;  3M7K A;  3C6W A;  1WIL A;  1HYJ A;  2FUU A;  2K1J A;  2YQL A;  2ZET C;  3H7H A;  1WES A;  5KH7 A;  2OXQ C;  3IHP A;  4YBT A;  2AN6 A;  2CRW A;  4LJN A;  4OGE A;  4R2Y A;  3FAN A;  2K4D A;  1F62 A;  4L58 A;  1MM3 A;  2CKL B;  2YUR A;  4LLB A;  2VNF A;  4TKP B;  5FEY A;  2MKE A;  2YSJ A;  5G0F A;  5EYA F;  2H0D B;  2YSM A;  5C13 A;  2M13 A;  5FER A;  4WA6 A;  3FJU B;  5G05 B;  4ZDT A;  4WZ2 A;  2LDR A;  3N9L A;  5D1K B;  3LRQ A;  4AYC A;  4F52 B;  3L1Z B;  4N4F A;  5K3Q A;  1N87 A;  4I7C A;  4Z0R A;  5B76 A;  4R8P K;  1XWH A;  5KH9 A;  2CRR A;  1WEU A;  3VK6 A;  4C9Z A;  5D1L B;  4O64 A;  4MVT A;  1JOC A;  3O37 A;  4WZ3 B;  5SVY A;  5B78 A;  2DSM A;  5LKZ A;  3LVR E;  1JM7 A;  3QZV A;  2EGM A;  2LRI C;  4BBQ A;  2MD7 B;  3FEH A;  3N9P A;  3V43 A;  2OWA A;  2FSA A;  3N9Q A;  2LXP C;  4L7X A;  4P5O B;  3DQV R;  3DWD A;  2VPE A;  1HYI A;  2F42 A;  3EB6 A;  1WEM A;  5TDR A;  3O47 A;  4O62 A;  4PPE A;  1WEE A;  4ZUX U;  2PUY A;  2EXU A;  2KKX A;  2FUI A;  3SOX A;  1X4U A;  4YC9 A;  2JRJ A;  2D8S A;  2XOC A;  2K16 A;  2RI7 A;  2VJF B;  2HDP A;  1Z60 A;  2JMJ A;  5I3L A;  2KR4 A;  4A49 A;  4GNF A;  3I2D A;  2KRE A;  2MUM A;  3MDB C;  3ZTG A;  4OGC A;  2XOY A;  3MHH A;  5TBN A;  3SUB A;  3M63 A;  3U5O A;  5B79 A;  5TAB A;  4IC3 A;  1LDK C;  5H1U A;  4A0C D;  1MM2 A;  3GV4 A;  1IYM A;  2MT5 A;  2KWK A;  2KFT A;  2B0O E;  2M1R A;  2M6M A;  2XP0 A;  2YQM A;  3PUQ A;  5JG6 A;  1LDJ B;  3KV6 A;  4R7E A;  3ZVY A;  1ZBD B;  3KNV A;  4CA1 A;  1WIM A;  3N9O A;  3U5P A;  4ZQL A;  5TRB A;  1FBV A;  4UP0 A;  3T9K A;  4LAD B;  4W4U A;  2FFW A;  5J3X A;  2D8U A;  3LVQ E;  3ZNI A;  1DVP A;  1CHC A;  4B7Y C;  4X3G A;  2JUN A;  3HTK C;  2VPD A;  3LJU X;  1G25 A;  4FJC A;  2MA5 A;  2E61 A;  3LQI A;  2L7P A;  4BHW A;  1T1H A;  3HCS A;  2YHO A;  4PTB A;  5SVI A;  4MSX A;  4Z0O A;  4V3K C;  5B8D A;  2KE1 A;  1WEW A;  2LXH C;  1E4U A;  4S3O C;  5D1M B;  5KH3 A;  2KU3 A;  2VJE B;  5G04 B;  2HYE D;  5LKT A;  2KYU A;  2M85 A;  2LN0 A;  2P57 A;  4WZ0 A;  5B77 A;  3L11 A;  2KIZ A;  1WEV A;  2CT2 A;  2L43 A;  3N9M A;  4GNE A;  3PHD A;  5LCW B;  4YAD A;  2LGG A;  2XEU A;  4GNG A;  3KDE C;  4I7B A;  2YVR A;  1Z6U A;  1MBM A;  2UZG A;  3HCT A;  2ECG A;  1X4J A;  2Y1N A;  4AVX A;  2YW8 A;  3FAO A;  3RPG B;  4QF2 A;  4UP5 A;  5FB0 A;  4YAT A;  5H1T A;  1VFY A;  2CKL A;  4FO9 A;  2CON A;  2C2L A;  1WEN A;  2H0D A;  3M62 A;  3EB5 A;  2KWO A;  2BAY A;  3T7L A;  2YRE A;  4XI1 A;  2CSZ A;  3O33 A;  3NG2 A;  2L80 A;  4AUQ B;  5LKX A;  5TDW A;  1DCQ A;  1BOR A;  2QJ0 A;  5H9M A;  5DIN A;  2QIZ A;  3FL2 A;  3GL6 A;  2F6J A;  3O70 A;  3RPG C;  2I50 A;  3M99 A;  2EOD A;  3HCU A;  3MHS A;  3C5K A;  3ZPV E;  2LV9 A;  5FB1 A;  2Y43 A;  4A4B A;  2CSY A;  3N9N A;  4YBS A;  1JM7 B;  2VPG A;  2ECJ A;  2KGI A;  2DX8 A;  2IDA A;  3SOW A;  3O34 A;  1WEP A;  1RMD A;  2G6Q A;  1V87 A;  2VP7 A;  2KWJ A;  2ECW A;  2VJE A;  3DPL R;  4YAB A;  4F1P A;  2EA6 A;  2ECV A;  3O36 A;  2F6N A;  2K17 A;  2G45 A;  3Q1D A;  1K2F A;  2IQJ A;  5B75 A;  4S3O B;  2JMD A;  4N3W A;  1X4I A;  2FD4 A;  3SHB A; 
#chains in the Genus database with same CATH homology
 1VYX A;  2LGV A;  2XB1 A;  4IC2 A;  1VD4 A;  5LKU A;  2LGK A;  4I7D A;  2Y1M A;  2KGG A;  2C2V S;  2MD8 C;  5DKA A;  2VJF A;  3ASL A;  2L75 A;  2E6R A;  3O7A A;  2M3H A;  2JMI A;  4LKA A;  5AIU A;  3O35 A;  3LQH A;  2YHN A;  4YBM A;  1Z2Q A;  4V3L C;  2VPB A;  5H1V A;  4Q6F A;  5C11 A;  2ECI A;  4NN2 A;  1WE9 A;  2ECN A;  2ECT A;  4GND A;  4QF3 A;  1WEO A;  2E6S A;  3T6R A;  4B86 C;  3U5M A;  2YYR A;  4AYC B;  4FIP A;  4LK9 A;  1FP0 A;  2RSD A;  1WGM A;  4A4C A;  1WEQ A;  1WFK A;  2MA6 A;  4FK5 A;  2LGL A;  4YAX A;  2PNX A;  2MNY A;  4GB0 A;  3L1X A;  4AP4 A;  2L0B A;  4CCG X;  5AIT A;  3U5N A;  1U6G B;  2EGP A;  3LQJ A;  2YUC A;  3RTR B;  2NAA A;  2YT5 A;  3ZYQ A;  2L5U A;  2KWN A;  2MNZ A;  2G43 A;  3SOU A;  3KQI A;  3ZPV 1;  4UI9 B;  2MIQ A;  3ZVZ B;  3KV5 A;  2YU4 A;  3PUR A;  2QIC A;  2LQ6 A;  3C6W A;  1WIL A;  1HYJ A;  2FUU A;  2K1J A;  2YQL A;  2ZET C;  1WES A;  5KH7 A;  2OXQ C;  3IHP A;  4YBT A;  2AN6 A;  4LJN A;  4R2Y A;  2K4D A;  1F62 A;  4L58 A;  1MM3 A;  2CKL B;  2YUR A;  4LLB A;  2VNF A;  4TKP B;  5FEY A;  5G0F A;  2YSJ A;  5EYA F;  2H0D B;  2YSM A;  5C13 A;  5FER A;  4WA6 A;  5G05 B;  4ZDT A;  4WZ2 A;  2LDR A;  3N9L A;  5D1K B;  3LRQ A;  4AYC A;  4F52 B;  3L1Z B;  4N4F A;  1N87 A;  4I7C A;  5B76 A;  4R8P K;  1XWH A;  5KH9 A;  1WEU A;  3VK6 A;  4C9Z A;  5D1L B;  4O64 A;  4MVT A;  1JOC A;  3O37 A;  4WZ3 B;  5B78 A;  5LKZ A;  1JM7 A;  3QZV A;  2LRI C;  4BBQ A;  2MD7 B;  3N9P A;  3V43 A;  2FSA A;  3N9Q A;  2LXP C;  4L7X A;  4P5O B;  3DQV R;  2VPE A;  1HYI A;  2F42 A;  3EB6 A;  1WEM A;  5TDR A;  4PPE A;  1WEE A;  4ZUX U;  2PUY A;  2FUI A;  3SOX A;  1X4U A;  4YC9 A;  2JRJ A;  2D8S A;  2K16 A;  2RI7 A;  2VJF B;  2HDP A;  1Z60 A;  2JMJ A;  5I3L A;  2KR4 A;  4A49 A;  4GNF A;  3I2D A;  2KRE A;  2MUM A;  3ZTG A;  3MHH A;  5TBN A;  3M63 A;  3U5O A;  5B79 A;  5TAB A;  4IC3 A;  1LDK C;  5H1U A;  4A0C D;  1MM2 A;  3GV4 A;  1IYM A;  2MT5 A;  2KWK A;  2KFT A;  2M1R A;  2M6M A;  2YQM A;  3PUQ A;  5JG6 A;  1LDJ B;  3KV6 A;  4R7E A;  3ZVY A;  1ZBD B;  3KNV A;  4CA1 A;  1WIM A;  3N9O A;  3U5P A;  4ZQL A;  5TRB A;  1FBV A;  4UP0 A;  4LAD B;  4W4U A;  5J3X A;  3ZNI A;  1DVP A;  1CHC A;  4B7Y C;  4X3G A;  3HTK C;  2VPD A;  1G25 A;  4FJC A;  2MA5 A;  3LQI A;  4BHW A;  1T1H A;  3HCS A;  2YHO A;  4PTB A;  4MSX A;  4V3K C;  5B8D A;  2KE1 A;  1WEW A;  2LXH C;  1E4U A;  4S3O C;  5D1M B;  5KH3 A;  2KU3 A;  2VJE B;  5G04 B;  2HYE D;  5LKT A;  2KYU A;  2M85 A;  2LN0 A;  4WZ0 A;  5B77 A;  3L11 A;  2KIZ A;  1WEV A;  2CT2 A;  2L43 A;  3N9M A;  4GNE A;  3PHD A;  5LCW B;  4YAD A;  2LGG A;  2XEU A;  4GNG A;  4I7B A;  1Z6U A;  2UZG A;  3HCT A;  2ECG A;  1X4J A;  2Y1N A;  4AVX A;  2YW8 A;  3RPG B;  4QF2 A;  4UP5 A;  5FB0 A;  4YAT A;  5H1T A;  1VFY A;  2CKL A;  4FO9 A;  2C2L A;  1WEN A;  2H0D A;  3M62 A;  3EB5 A;  2KWO A;  2BAY A;  3T7L A;  2YRE A;  4XI1 A;  2CSZ A;  3O33 A;  3NG2 A;  2L80 A;  4AUQ B;  5LKX A;  5TDW A;  1BOR A;  2QJ0 A;  5H9M A;  5DIN A;  2QIZ A;  3FL2 A;  3GL6 A;  2F6J A;  3O70 A;  3RPG C;  2I50 A;  3M99 A;  2EOD A;  3HCU A;  3MHS A;  3C5K A;  3ZPV E;  2LV9 A;  5FB1 A;  2Y43 A;  4A4B A;  2CSY A;  3N9N A;  4YBS A;  1JM7 B;  2VPG A;  2ECJ A;  2KGI A;  2DX8 A;  2IDA A;  3SOW A;  3O34 A;  1WEP A;  1RMD A;  2G6Q A;  1V87 A;  2VP7 A;  2KWJ A;  2ECW A;  2VJE A;  3DPL R;  4YAB A;  2EA6 A;  2ECV A;  3O36 A;  2F6N A;  2K17 A;  2G45 A;  1K2F A;  5B75 A;  4S3O B;  2JMD A;  4N3W A;  1X4I A;  3SHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...