2MT5A

Isolated ring domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Anaphase-promoting complex subunit 11
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mt5A00
4AYCB 2LGVA 3LQHA 2L80A 3LQIA 2MA6A 3ZTGA 4WZ3B 4P5OB 5C13A 1FBVA 1WEOA 4S3OC 5KH3A 3HTKC 2M3HA 3N9PA 3GL6A 3M99A 5H1VA 4YABA 2KE1A 2LRIC 2MT5A 5AIUA 3KNVA 5AITA 2QJ0A 3L1ZB 5KH7A 5B8DA 2IDAA 2MA5A 3HCSA 1HYJA 2H0DB 2JMIA 2LDRA 2KREA 3M62A 2C2LA 2ECTA 2ECGA 4B86C 5D1KB 2KWJA 2YHNA 3O33A 4V3KC 2VJFA 1VYXA 2UZGA 4WZ0A 3O35A 3VK6A 2LN0A 5TDWA 5FB0A 2L0BA 2QICA 4GNDA 3U5PA 2Y1NA 1HYIA 1WEEA 3RTRB 1WENA 3L1XA 1E4UA 3U5NA 2G43A 2F6NA 1G25A 3U5OA 3GV4A 4CCGX 2YYRA 5J3XA 2E6RA 3U5MA 2KWKA 2KIZA 4V3LC 2MIQA 2FUUA 5H1TA 1T1HA 1K2FA 2NAAA 5B78A 3N9QA 1WE9A 4R2YA 4F52B 3N9OA 2LXHC 2MNZA 4N4FA 5TDRA 1WFKA 4WA6A 2YHOA 4ZQLA 1Z2QA 4A0CD 1LDJB 3QZVA 1WGMA 5TRBA 2C2VS 5B79A 2HDPA 2XEUA 2VPDA 2L43A 3RPGC 1VFYA 4A4CA 5C11A 4BHWA 2CT2A 1N87A 5LKZA 2F6JA 3O70A 5B75A 5B76A 2YQMA 5LKTA 5H1UA 2LXPC 1BORA 3EB5A 2VPBA 4LADB 3C5KA 2K1JA 3T6RA 2D8SA 2PUYA 4ZDTA 4AP4A 2H0DA 2VNFA 3N9NA 3HCUA 2L5UA 2E6SA 1Z6UA 4GB0A 3T7LA 3M63A 4W4UA 2I50A 2ECWA 4Q6FA 5LKUA 3LRQA 4YBSA 2RSDA 4QF2A 2DX8A 2KYUA 4O64A 3ASLA 4X3GA 3O36A 5B77A 2BAYA 4A4BA 3LQJA 5G04B 4IC2A 1X4IA 3L11A 4AYCA 1JM7B 2VPGA 5TABA 1VD4A 4GNEA 3KQIA 4QF3A 2KU3A 3DQVR 2LGGA 1Z60A 4YATA 2YW8A 1WEVA 3N9MA 3PHDA 5DKAA 4S3OB 4A49A 2CKLA 2LGLA 3KV5A 4N3WA 4YC9A 1CHCA 3IHPA 2LQ6A 3C6WA 4LK9A 1JM7A 3SOXA 4PPEA 2ECNA 5FEYA 3HCTA 1U6GB 2KFTA 4YBTA 2KGIA 4LJNA 2KGGA 3EB6A 1IYMA 2FSAA 2QIZA 2OXQC 3O37A 2MD8C 2JRJA 3N9LA 1V87A 5H9MA 2XB1A 3O7AA 1RMDA 2MD7B 2ECVA 1F62A 2ECJA 5JG6A 5I3LA 4FK5A 2KWOA 3PURA 2YUCA 1DVPA 3MHHA 2CSZA 4FIPA 3FL2A 2ECIA 3SOWA 2YURA 1X4UA 2K4DA 3PUQA 4I7CA 1WEWA 4L58A 2F42A 2LGKA 5TBNA 2YSJA 4MVTA 4YBMA 4BBQA 3O34A 1JOCA 2YREA 2MUMA 2YT5A 3ZNIA 2YSMA 2ZETC 4TKPB 5FERA 4FJCA 2G6QA 2HYED 2LV9A 2JMDA 1WEMA 4YADA 4LKAA 1XWHA 2G45A 1WEUA 2Y43A 4WZ2A 1MM3A 5KH9A 2VPEA 2YQLA 1LDKC 4B7YC 2JMJA 2RI7A 3SOUA 4GNFA 4C9ZA 1WEPA 4ZUXU 5G0FA 4IC3A 2KWNA 2M85A 3V43A 2CKLB 4AUQB 5FB1A 2VJFB 4I7BA 2MNYA 5D1LB 4AVXA 2KR4A 2CSYA 3ZPV1 4R7EA 4PTBA 4LLBA 3I2DA 1WIMA 1WESA 2PNXA 2K16A 3ZPVE 4CA1A 2FUIA 4NN2A 1X4JA 2EGPA 2Y1MA 1ZBDB 4UP0A 3ZYQA 3RPGB 3MHSA 4XI1A 4R8PK 1MM2A 4UI9B 4MSXA 5DINA 1WEQA 4UP5A 3NG2A 2VJEA 2K17A 2YU4A 5LKXA 3ZVYA 2M1RA 5G05B 1WILA 2EODA 4FO9A 2L75A 4YAXA 3SHBA 4I7DA 3ZVZB 5D1MB 5LCWB 3DPLR 2M6MA 5EYAF 2EA6A 4L7XA 2VP7A 1FP0A 4GNGA 2VJEB 3KV6A 2AN6A
chains in the Genus database with same CATH superfamily
4AYCB 2LGVA 3LQHA 2L80A 3LQIA 3FJUB 2MA6A 3ZTGA 4WZ3B 4P5OB 5C13A 1FBVA 3MDBC 1WEOA 4S3OC 5KH3A 3HTKC 2M3HA 3N9PA 3GL6A 3M99A 5H1VA 4YABA 2KE1A 2LRIC 2MT5A 2MKEA 2IQJA 5AIUA 3KNVA 5AITA 2QJ0A 2JM3A 3L1ZB 5KH7A 4Z0RA 5B8DA 2IDAA 1MBMA 2MA5A 3HCSA 3LJUX 1HYJA 2OWAA 2H0DB 2JMIA 2LDRA 2KREA 3M62A 2C2LA 2ECTA 2ECGA 4B86C 5D1KB 2KWJA 2YHNA 3O33A 4V3KC 2VJFA 1VYXA 2UZGA 4WZ0A 3O35A 3VK6A 2LN0A 5TDWA 5FB0A 2L0BA 2QICA 4GNDA 3U5PA 2Y1NA 1HYIA 1WEEA 1WENA 3L1XA 3RTRB 1E4UA 3U5NA 2G43A 2F6NA 1G25A 3U5OA 3GV4A 4F1PA 4CCGX 2YYRA 4QQ4A 3FAOA 5J3XA 2E6RA 3U5MA 2KWKA 2KIZA 4V3LC 3FANA 2MIQA 2FUUA 5H1TA 1T1HA 3DWDA 1K2FA 2NAAA 5B78A 3N9QA 1WE9A 4R2YA 4F52B 3N9OA 2LXHC 2MNZA 4N4FA 5TDRA 1WFKA 4WA6A 2YHOA 5SVIB 4ZQLA 1Z2QA 4A0CD 5K3QA 1LDJB 3QZVA 1WGMA 3PLWA 5TRBA 2C2VS 5B79A 2HDPA 2XEUA 2CRWA 2VPDA 2L43A 3RPGC 1VFYA 4A4CA 5C11A 4BHWA 2CT2A 1N87A 5LKZA 2F6JA 3O70A 3LDYA 5B75A 5B76A 2KKXA 2YQMA 2YVRA 5LKTA 5H1UA 2LXPC 1BORA 3T9KA 3EB5A 2VPBA 4LADB 2LAUA 3C5KA 2K1JA 3T6RA 2D8SA 2PUYA 4ZDTA 4AP4A 2P57A 2FFWA 2H0DA 2VNFA 4H9DA 3N9NA 3HCUA 2L5UA 3E2DA 2E6SA 1Z6UA 2B0OE 3KDEC 3LVRE 4GB0A 3T7LA 3M63A 4W4UA 2I50A 2ECWA 1DCQA 4Q6FA 5LKUA 3LRQA 4YBSA 2RSDA 4QF2A 2DX8A 2KYUA 4O64A 3ASLA 2XP0A 4X3GA 3O36A 5B77A 2BAYA 4A4BA 3LQJA 5G04B 4IC2A 1X4IA 3L11A 4AYCA 1JM7B 2VPGA 3FEHA 5TABA 1VD4A 4GNEA 3O47A 3KQIA 4QF3A 4O62A 2KU3A 3DQVR 2LGGA 1Z60A 4YATA 2YW8A 1WEVA 3N9MA 3PHDA 5DKAA 4OGCA 4S3OB 4A49A 2CKLA 2LGLA 3KV5A 4N3WA 4YC9A 5SVYA 1CHCA 3IHPA 2LQ6A 3C6WA 4LK9A 1JM7A 3SOXA 4PPEA 2ECNA 5FEYA 3HCTA 1U6GB 2KFTA 4YBTA 2KGIA 3JUEA 4LJNA 2KGGA 2M13A 3EB6A 1IYMA 2FSAA 2QIZA 2OXQC 3O37A 2MD8C 2JRJA 3N9LA 1V87A 5H9MA 2XB1A 3O7AA 1RMDA 2MD7B 2ECVA 1F62A 2ECJA 5JG6A 5I3LA 4FK5A 2KWOA 3PURA 2YUCA 1DVPA 2D8UA 3MHHA 2CSZA 2EXUA 2CSVA 3LVQE 4FIPA 3FL2A 2ECIA 3SOWA 2YURA 1X4UA 2K4DA 3PUQA 4I7CA 1WEWA 4L58A 2F42A 2LGKA 5TBNA 2YSJA 4MVTA 4YBMA 4BBQA 3O34A 1JOCA 2E61A 2YREA 2MUMA 2YT5A 3ZNIA 2YSMA 2ZETC 4TKPB 5FERA 4FJCA 2XOCA 2G6QA 2HYED 2LV9A 3FM8C 2JMDA 1WEMA 4YADA 4LKAA 1XWHA 2G45A 2XOZA 1WEUA 2Y43A 2CONA 4WZ2A 4OGEA 1MM3A 2DSMA 5KH9A 2VPEA 2YQLA 2KKYA 1LDKC 3SUBA 2JMJA 2RI7A 4B7YC 2JUNA 5SVIA 3SOUA 4GNFA 4C9ZA 1WEPA 4ZUXU 5G0FA 3H7HA 4IC3A 2KWNA 2M85A 3V43A 2CKLB 4AUQB 5FB1A 2VJFB 2CRRA 2EGMA 4I7BA 2L7PA 3Q1DA 2FD4A 2MNYA 5D1LB 2XOYA 4AVXA 2KR4A 3M7KA 2CSYA 3ZPV1 3DDTA 4R7EA 4PTBA 4LLBA 3I2DA 1WIMA 1WESA 2PNXA 2K16A 3ZPVE 4CA1A 5SVXA 2DJAA 2FUIA 4NN2A 1X4JA 2EGPA 2Y1MA 1ZBDB 4UP0A 3ZYQA 3RPGB 3MHSA 4XI1A 4R8PK 1MM2A 4UI9B 4MSXA 5DINA 1WEQA 4UP5A 3NG2A 2VJEA 2K17A 2YU4A 5LKXA 3ZVYA 2M1RA 5G05B 1WILA 2EODA 4FO9A 2L75A 4YAXA 3SHBA 4I7DA 2RR4A 3ZVZB 5D1MB 5LCWB 3DPLR 2M6MA 5EYAF 2EA6A 4L7XA 2VP7A 1FP0A 4Z0OA 4GNGA 2VJEB 3KV6A 2AN6A
chains in the Genus database with same CATH topology
4AYCB 2LGVA 3LQHA 2L80A 3LQIA 2MA6A 3ZTGA 4WZ3B 4P5OB 5C13A 1FBVA 1WEOA 4S3OC 5KH3A 3HTKC 2M3HA 3N9PA 3GL6A 3M99A 5H1VA 4YABA 2KE1A 2LRIC 2MT5A 5AIUA 3KNVA 5AITA 2QJ0A 3L1ZB 5KH7A 5B8DA 2IDAA 2MA5A 3HCSA 1HYJA 2H0DB 2JMIA 2LDRA 2KREA 3M62A 2C2LA 2ECTA 2ECGA 4B86C 5D1KB 2KWJA 2YHNA 3O33A 4V3KC 2VJFA 1VYXA 2UZGA 4WZ0A 3O35A 3VK6A 2LN0A 5TDWA 5FB0A 2L0BA 2QICA 4GNDA 3U5PA 2Y1NA 1HYIA 1WEEA 3RTRB 1WENA 3L1XA 1E4UA 3U5NA 2G43A 2F6NA 1G25A 3U5OA 3GV4A 4CCGX 2YYRA 5J3XA 2E6RA 3U5MA 2KWKA 2KIZA 4V3LC 2MIQA 2FUUA 5H1TA 1T1HA 1K2FA 2NAAA 5B78A 3N9QA 1WE9A 4R2YA 4F52B 3N9OA 2LXHC 2MNZA 4N4FA 5TDRA 1WFKA 4WA6A 2YHOA 4ZQLA 1Z2QA 4A0CD 1LDJB 3QZVA 1WGMA 5TRBA 2C2VS 5B79A 2HDPA 2XEUA 2VPDA 2L43A 3RPGC 1VFYA 4A4CA 5C11A 4BHWA 2CT2A 1N87A 5LKZA 2F6JA 3O70A 5B75A 5B76A 2YQMA 5LKTA 5H1UA 2LXPC 1BORA 3EB5A 2VPBA 4LADB 3C5KA 2K1JA 3T6RA 2D8SA 2PUYA 4ZDTA 4AP4A 2H0DA 2VNFA 3N9NA 3HCUA 2L5UA 2E6SA 1Z6UA 4GB0A 3T7LA 3M63A 4W4UA 2I50A 2ECWA 4Q6FA 5LKUA 3LRQA 4YBSA 2RSDA 4QF2A 2DX8A 2KYUA 4O64A 3ASLA 4X3GA 3O36A 5B77A 2BAYA 4A4BA 3LQJA 5G04B 4IC2A 1X4IA 3L11A 4AYCA 1JM7B 2VPGA 5TABA 1VD4A 4GNEA 3KQIA 4QF3A 2KU3A 3DQVR 2LGGA 1Z60A 4YATA 2YW8A 1WEVA 3N9MA 3PHDA 5DKAA 4S3OB 4A49A 2CKLA 2LGLA 3KV5A 4N3WA 4YC9A 1CHCA 3IHPA 2LQ6A 3C6WA 4LK9A 1JM7A 3SOXA 4PPEA 2ECNA 5FEYA 3HCTA 1U6GB 2KFTA 4YBTA 2KGIA 4LJNA 2KGGA 3EB6A 1IYMA 2FSAA 2QIZA 2OXQC 3O37A 2MD8C 2JRJA 3N9LA 1V87A 5H9MA 2XB1A 3O7AA 1RMDA 2MD7B 2ECVA 1F62A 2ECJA 5JG6A 5I3LA 4FK5A 2KWOA 3PURA 2YUCA 1DVPA 3MHHA 2CSZA 4FIPA 3FL2A 2ECIA 3SOWA 2YURA 1X4UA 2K4DA 3PUQA 4I7CA 1WEWA 4L58A 2F42A 2LGKA 5TBNA 2YSJA 4MVTA 4YBMA 4BBQA 3O34A 1JOCA 2YREA 2MUMA 2YT5A 3ZNIA 2YSMA 2ZETC 4TKPB 5FERA 4FJCA 2G6QA 2HYED 2LV9A 2JMDA 1WEMA 4YADA 4LKAA 1XWHA 2G45A 1WEUA 2Y43A 4WZ2A 1MM3A 5KH9A 2VPEA 2YQLA 1LDKC 4B7YC 2JMJA 2RI7A 3SOUA 4GNFA 4C9ZA 1WEPA 4ZUXU 5G0FA 4IC3A 2KWNA 2M85A 3V43A 2CKLB 4AUQB 5FB1A 2VJFB 4I7BA 2MNYA 5D1LB 4AVXA 2KR4A 2CSYA 3ZPV1 4R7EA 4PTBA 4LLBA 3I2DA 1WIMA 1WESA 2PNXA 2K16A 3ZPVE 4CA1A 2FUIA 4NN2A 1X4JA 2EGPA 2Y1MA 1ZBDB 4UP0A 3ZYQA 3RPGB 3MHSA 4XI1A 4R8PK 1MM2A 4UI9B 4MSXA 5DINA 1WEQA 4UP5A 3NG2A 2VJEA 2K17A 2YU4A 5LKXA 3ZVYA 2M1RA 5G05B 1WILA 2EODA 4FO9A 2L75A 4YAXA 3SHBA 4I7DA 3ZVZB 5D1MB 5LCWB 3DPLR 2M6MA 5EYAF 2EA6A 4L7XA 2VP7A 1FP0A 4GNGA 2VJEB 3KV6A 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYC B;  2LGV A;  3LQH A;  2L80 A;  3LQI A;  2MA6 A;  3ZTG A;  4WZ3 B;  4P5O B;  5C13 A;  1FBV A;  1WEO A;  4S3O C;  5KH3 A;  3HTK C;  2M3H A;  3N9P A;  3GL6 A;  3M99 A;  5H1V A;  4YAB A;  2KE1 A;  2LRI C;  2MT5 A;  5AIU A;  3KNV A;  5AIT A;  2QJ0 A;  3L1Z B;  5KH7 A;  5B8D A;  2IDA A;  2MA5 A;  3HCS A;  1HYJ A;  2H0D B;  2JMI A;  2LDR A;  2KRE A;  3M62 A;  2C2L A;  2ECT A;  2ECG A;  4B86 C;  5D1K B;  2KWJ A;  2YHN A;  3O33 A;  4V3K C;  2VJF A;  1VYX A;  2UZG A;  4WZ0 A;  3O35 A;  3VK6 A;  2LN0 A;  5TDW A;  5FB0 A;  2L0B A;  2QIC A;  4GND A;  3U5P A;  2Y1N A;  1HYI A;  1WEE A;  3RTR B;  1WEN A;  3L1X A;  1E4U A;  3U5N A;  2G43 A;  2F6N A;  1G25 A;  3U5O A;  3GV4 A;  4CCG X;  2YYR A;  5J3X A;  2E6R A;  3U5M A;  2KWK A;  2KIZ A;  4V3L C;  2MIQ A;  2FUU A;  5H1T A;  1T1H A;  1K2F A;  2NAA A;  5B78 A;  3N9Q A;  1WE9 A;  4R2Y A;  4F52 B;  3N9O A;  2LXH C;  2MNZ A;  4N4F A;  5TDR A;  1WFK A;  4WA6 A;  2YHO A;  4ZQL A;  1Z2Q A;  4A0C D;  1LDJ B;  3QZV A;  1WGM A;  5TRB A;  2C2V S;  5B79 A;  2HDP A;  2XEU A;  2VPD A;  2L43 A;  3RPG C;  1VFY A;  4A4C A;  5C11 A;  4BHW A;  2CT2 A;  1N87 A;  5LKZ A;  2F6J A;  3O70 A;  5B75 A;  5B76 A;  2YQM A;  5LKT A;  5H1U A;  2LXP C;  1BOR A;  3EB5 A;  2VPB A;  4LAD B;  3C5K A;  2K1J A;  3T6R A;  2D8S A;  2PUY A;  4ZDT A;  4AP4 A;  2H0D A;  2VNF A;  3N9N A;  3HCU A;  2L5U A;  2E6S A;  1Z6U A;  4GB0 A;  3T7L A;  3M63 A;  4W4U A;  2I50 A;  2ECW A;  4Q6F A;  5LKU A;  3LRQ A;  4YBS A;  2RSD A;  4QF2 A;  2DX8 A;  2KYU A;  4O64 A;  3ASL A;  4X3G A;  3O36 A;  5B77 A;  2BAY A;  4A4B A;  3LQJ A;  5G04 B;  4IC2 A;  1X4I A;  3L11 A;  4AYC A;  1JM7 B;  2VPG A;  5TAB A;  1VD4 A;  4GNE A;  3KQI A;  4QF3 A;  2KU3 A;  3DQV R;  2LGG A;  1Z60 A;  4YAT A;  2YW8 A;  1WEV A;  3N9M A;  3PHD A;  5DKA A;  4S3O B;  4A49 A;  2CKL A;  2LGL A;  3KV5 A;  4N3W A;  4YC9 A;  1CHC A;  3IHP A;  2LQ6 A;  3C6W A;  4LK9 A;  1JM7 A;  3SOX A;  4PPE A;  2ECN A;  5FEY A;  3HCT A;  1U6G B;  2KFT A;  4YBT A;  2KGI A;  4LJN A;  2KGG A;  3EB6 A;  1IYM A;  2FSA A;  2QIZ A;  2OXQ C;  3O37 A;  2MD8 C;  2JRJ A;  3N9L A;  1V87 A;  5H9M A;  2XB1 A;  3O7A A;  1RMD A;  2MD7 B;  2ECV A;  1F62 A;  2ECJ A;  5JG6 A;  5I3L A;  4FK5 A;  2KWO A;  3PUR A;  2YUC A;  1DVP A;  3MHH A;  2CSZ A;  4FIP A;  3FL2 A;  2ECI A;  3SOW A;  2YUR A;  1X4U A;  2K4D A;  3PUQ A;  4I7C A;  1WEW A;  4L58 A;  2F42 A;  2LGK A;  5TBN A;  2YSJ A;  4MVT A;  4YBM A;  4BBQ A;  3O34 A;  1JOC A;  2YRE A;  2MUM A;  2YT5 A;  3ZNI A;  2YSM A;  2ZET C;  4TKP B;  5FER A;  4FJC A;  2G6Q A;  2HYE D;  2LV9 A;  2JMD A;  1WEM A;  4YAD A;  4LKA A;  1XWH A;  2G45 A;  1WEU A;  2Y43 A;  4WZ2 A;  1MM3 A;  5KH9 A;  2VPE A;  2YQL A;  1LDK C;  4B7Y C;  2JMJ A;  2RI7 A;  3SOU A;  4GNF A;  4C9Z A;  1WEP A;  4ZUX U;  5G0F A;  4IC3 A;  2KWN A;  2M85 A;  3V43 A;  2CKL B;  4AUQ B;  5FB1 A;  2VJF B;  4I7B A;  2MNY A;  5D1L B;  4AVX A;  2KR4 A;  2CSY A;  3ZPV 1;  4R7E A;  4PTB A;  4LLB A;  3I2D A;  1WIM A;  1WES A;  2PNX A;  2K16 A;  3ZPV E;  4CA1 A;  2FUI A;  4NN2 A;  1X4J A;  2EGP A;  2Y1M A;  1ZBD B;  4UP0 A;  3ZYQ A;  3RPG B;  3MHS A;  4XI1 A;  4R8P K;  1MM2 A;  4UI9 B;  4MSX A;  5DIN A;  1WEQ A;  4UP5 A;  3NG2 A;  2VJE A;  2K17 A;  2YU4 A;  5LKX A;  3ZVY A;  2M1R A;  5G05 B;  1WIL A;  2EOD A;  4FO9 A;  2L75 A;  4YAX A;  3SHB A;  4I7D A;  3ZVZ B;  5D1M B;  5LCW B;  3DPL R;  2M6M A;  5EYA F;  2EA6 A;  4L7X A;  2VP7 A;  1FP0 A;  4GNG A;  2VJE B;  3KV6 A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 4AYC B;  2LGV A;  3LQH A;  2L80 A;  3LQI A;  3FJU B;  2MA6 A;  3ZTG A;  4WZ3 B;  4P5O B;  5C13 A;  1FBV A;  3MDB C;  1WEO A;  4S3O C;  5KH3 A;  3HTK C;  2M3H A;  3N9P A;  3GL6 A;  3M99 A;  5H1V A;  4YAB A;  2KE1 A;  2LRI C;  2MT5 A;  2MKE A;  2IQJ A;  5AIU A;  3KNV A;  5AIT A;  2QJ0 A;  2JM3 A;  3L1Z B;  5KH7 A;  4Z0R A;  5B8D A;  2IDA A;  1MBM A;  2MA5 A;  3HCS A;  3LJU X;  1HYJ A;  2OWA A;  2H0D B;  2JMI A;  2LDR A;  2KRE A;  3M62 A;  2C2L A;  2ECT A;  2ECG A;  4B86 C;  5D1K B;  2KWJ A;  2YHN A;  3O33 A;  4V3K C;  2VJF A;  1VYX A;  2UZG A;  4WZ0 A;  3O35 A;  3VK6 A;  2LN0 A;  5TDW A;  5FB0 A;  2L0B A;  2QIC A;  4GND A;  3U5P A;  2Y1N A;  1HYI A;  1WEE A;  1WEN A;  3L1X A;  3RTR B;  1E4U A;  3U5N A;  2G43 A;  2F6N A;  1G25 A;  3U5O A;  3GV4 A;  4F1P A;  4CCG X;  2YYR A;  4QQ4 A;  3FAO A;  5J3X A;  2E6R A;  3U5M A;  2KWK A;  2KIZ A;  4V3L C;  3FAN A;  2MIQ A;  2FUU A;  5H1T A;  1T1H A;  3DWD A;  1K2F A;  2NAA A;  5B78 A;  3N9Q A;  1WE9 A;  4R2Y A;  4F52 B;  3N9O A;  2LXH C;  2MNZ A;  4N4F A;  5TDR A;  1WFK A;  4WA6 A;  2YHO A;  5SVI B;  4ZQL A;  1Z2Q A;  4A0C D;  5K3Q A;  1LDJ B;  3QZV A;  1WGM A;  3PLW A;  5TRB A;  2C2V S;  5B79 A;  2HDP A;  2XEU A;  2CRW A;  2VPD A;  2L43 A;  3RPG C;  1VFY A;  4A4C A;  5C11 A;  4BHW A;  2CT2 A;  1N87 A;  5LKZ A;  2F6J A;  3O70 A;  3LDY A;  5B75 A;  5B76 A;  2KKX A;  2YQM A;  2YVR A;  5LKT A;  5H1U A;  2LXP C;  1BOR A;  3T9K A;  3EB5 A;  2VPB A;  4LAD B;  2LAU A;  3C5K A;  2K1J A;  3T6R A;  2D8S A;  2PUY A;  4ZDT A;  4AP4 A;  2P57 A;  2FFW A;  2H0D A;  2VNF A;  4H9D A;  3N9N A;  3HCU A;  2L5U A;  3E2D A;  2E6S A;  1Z6U A;  2B0O E;  3KDE C;  3LVR E;  4GB0 A;  3T7L A;  3M63 A;  4W4U A;  2I50 A;  2ECW A;  1DCQ A;  4Q6F A;  5LKU A;  3LRQ A;  4YBS A;  2RSD A;  4QF2 A;  2DX8 A;  2KYU A;  4O64 A;  3ASL A;  2XP0 A;  4X3G A;  3O36 A;  5B77 A;  2BAY A;  4A4B A;  3LQJ A;  5G04 B;  4IC2 A;  1X4I A;  3L11 A;  4AYC A;  1JM7 B;  2VPG A;  3FEH A;  5TAB A;  1VD4 A;  4GNE A;  3O47 A;  3KQI A;  4QF3 A;  4O62 A;  2KU3 A;  3DQV R;  2LGG A;  1Z60 A;  4YAT A;  2YW8 A;  1WEV A;  3N9M A;  3PHD A;  5DKA A;  4OGC A;  4S3O B;  4A49 A;  2CKL A;  2LGL A;  3KV5 A;  4N3W A;  4YC9 A;  5SVY A;  1CHC A;  3IHP A;  2LQ6 A;  3C6W A;  4LK9 A;  1JM7 A;  3SOX A;  4PPE A;  2ECN A;  5FEY A;  3HCT A;  1U6G B;  2KFT A;  4YBT A;  2KGI A;  3JUE A;  4LJN A;  2KGG A;  2M13 A;  3EB6 A;  1IYM A;  2FSA A;  2QIZ A;  2OXQ C;  3O37 A;  2MD8 C;  2JRJ A;  3N9L A;  1V87 A;  5H9M A;  2XB1 A;  3O7A A;  1RMD A;  2MD7 B;  2ECV A;  1F62 A;  2ECJ A;  5JG6 A;  5I3L A;  4FK5 A;  2KWO A;  3PUR A;  2YUC A;  1DVP A;  2D8U A;  3MHH A;  2CSZ A;  2EXU A;  2CSV A;  3LVQ E;  4FIP A;  3FL2 A;  2ECI A;  3SOW A;  2YUR A;  1X4U A;  2K4D A;  3PUQ A;  4I7C A;  1WEW A;  4L58 A;  2F42 A;  2LGK A;  5TBN A;  2YSJ A;  4MVT A;  4YBM A;  4BBQ A;  3O34 A;  1JOC A;  2E61 A;  2YRE A;  2MUM A;  2YT5 A;  3ZNI A;  2YSM A;  2ZET C;  4TKP B;  5FER A;  4FJC A;  2XOC A;  2G6Q A;  2HYE D;  2LV9 A;  3FM8 C;  2JMD A;  1WEM A;  4YAD A;  4LKA A;  1XWH A;  2G45 A;  2XOZ A;  1WEU A;  2Y43 A;  2CON A;  4WZ2 A;  4OGE A;  1MM3 A;  2DSM A;  5KH9 A;  2VPE A;  2YQL A;  2KKY A;  1LDK C;  3SUB A;  2JMJ A;  2RI7 A;  4B7Y C;  2JUN A;  5SVI A;  3SOU A;  4GNF A;  4C9Z A;  1WEP A;  4ZUX U;  5G0F A;  3H7H A;  4IC3 A;  2KWN A;  2M85 A;  3V43 A;  2CKL B;  4AUQ B;  5FB1 A;  2VJF B;  2CRR A;  2EGM A;  4I7B A;  2L7P A;  3Q1D A;  2FD4 A;  2MNY A;  5D1L B;  2XOY A;  4AVX A;  2KR4 A;  3M7K A;  2CSY A;  3ZPV 1;  3DDT A;  4R7E A;  4PTB A;  4LLB A;  3I2D A;  1WIM A;  1WES A;  2PNX A;  2K16 A;  3ZPV E;  4CA1 A;  5SVX A;  2DJA A;  2FUI A;  4NN2 A;  1X4J A;  2EGP A;  2Y1M A;  1ZBD B;  4UP0 A;  3ZYQ A;  3RPG B;  3MHS A;  4XI1 A;  4R8P K;  1MM2 A;  4UI9 B;  4MSX A;  5DIN A;  1WEQ A;  4UP5 A;  3NG2 A;  2VJE A;  2K17 A;  2YU4 A;  5LKX A;  3ZVY A;  2M1R A;  5G05 B;  1WIL A;  2EOD A;  4FO9 A;  2L75 A;  4YAX A;  3SHB A;  4I7D A;  2RR4 A;  3ZVZ B;  5D1M B;  5LCW B;  3DPL R;  2M6M A;  5EYA F;  2EA6 A;  4L7X A;  2VP7 A;  1FP0 A;  4Z0O A;  4GNG A;  2VJE B;  3KV6 A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 4AYC B;  2LGV A;  3LQH A;  2L80 A;  3LQI A;  2MA6 A;  3ZTG A;  4WZ3 B;  4P5O B;  5C13 A;  1FBV A;  1WEO A;  4S3O C;  5KH3 A;  3HTK C;  2M3H A;  3N9P A;  3GL6 A;  3M99 A;  5H1V A;  4YAB A;  2KE1 A;  2LRI C;  2MT5 A;  5AIU A;  3KNV A;  5AIT A;  2QJ0 A;  3L1Z B;  5KH7 A;  5B8D A;  2IDA A;  2MA5 A;  3HCS A;  1HYJ A;  2H0D B;  2JMI A;  2LDR A;  2KRE A;  3M62 A;  2C2L A;  2ECT A;  2ECG A;  4B86 C;  5D1K B;  2KWJ A;  2YHN A;  3O33 A;  4V3K C;  2VJF A;  1VYX A;  2UZG A;  4WZ0 A;  3O35 A;  3VK6 A;  2LN0 A;  5TDW A;  5FB0 A;  2L0B A;  2QIC A;  4GND A;  3U5P A;  2Y1N A;  1HYI A;  1WEE A;  3RTR B;  1WEN A;  3L1X A;  1E4U A;  3U5N A;  2G43 A;  2F6N A;  1G25 A;  3U5O A;  3GV4 A;  4CCG X;  2YYR A;  5J3X A;  2E6R A;  3U5M A;  2KWK A;  2KIZ A;  4V3L C;  2MIQ A;  2FUU A;  5H1T A;  1T1H A;  1K2F A;  2NAA A;  5B78 A;  3N9Q A;  1WE9 A;  4R2Y A;  4F52 B;  3N9O A;  2LXH C;  2MNZ A;  4N4F A;  5TDR A;  1WFK A;  4WA6 A;  2YHO A;  4ZQL A;  1Z2Q A;  4A0C D;  1LDJ B;  3QZV A;  1WGM A;  5TRB A;  2C2V S;  5B79 A;  2HDP A;  2XEU A;  2VPD A;  2L43 A;  3RPG C;  1VFY A;  4A4C A;  5C11 A;  4BHW A;  2CT2 A;  1N87 A;  5LKZ A;  2F6J A;  3O70 A;  5B75 A;  5B76 A;  2YQM A;  5LKT A;  5H1U A;  2LXP C;  1BOR A;  3EB5 A;  2VPB A;  4LAD B;  3C5K A;  2K1J A;  3T6R A;  2D8S A;  2PUY A;  4ZDT A;  4AP4 A;  2H0D A;  2VNF A;  3N9N A;  3HCU A;  2L5U A;  2E6S A;  1Z6U A;  4GB0 A;  3T7L A;  3M63 A;  4W4U A;  2I50 A;  2ECW A;  4Q6F A;  5LKU A;  3LRQ A;  4YBS A;  2RSD A;  4QF2 A;  2DX8 A;  2KYU A;  4O64 A;  3ASL A;  4X3G A;  3O36 A;  5B77 A;  2BAY A;  4A4B A;  3LQJ A;  5G04 B;  4IC2 A;  1X4I A;  3L11 A;  4AYC A;  1JM7 B;  2VPG A;  5TAB A;  1VD4 A;  4GNE A;  3KQI A;  4QF3 A;  2KU3 A;  3DQV R;  2LGG A;  1Z60 A;  4YAT A;  2YW8 A;  1WEV A;  3N9M A;  3PHD A;  5DKA A;  4S3O B;  4A49 A;  2CKL A;  2LGL A;  3KV5 A;  4N3W A;  4YC9 A;  1CHC A;  3IHP A;  2LQ6 A;  3C6W A;  4LK9 A;  1JM7 A;  3SOX A;  4PPE A;  2ECN A;  5FEY A;  3HCT A;  1U6G B;  2KFT A;  4YBT A;  2KGI A;  4LJN A;  2KGG A;  3EB6 A;  1IYM A;  2FSA A;  2QIZ A;  2OXQ C;  3O37 A;  2MD8 C;  2JRJ A;  3N9L A;  1V87 A;  5H9M A;  2XB1 A;  3O7A A;  1RMD A;  2MD7 B;  2ECV A;  1F62 A;  2ECJ A;  5JG6 A;  5I3L A;  4FK5 A;  2KWO A;  3PUR A;  2YUC A;  1DVP A;  3MHH A;  2CSZ A;  4FIP A;  3FL2 A;  2ECI A;  3SOW A;  2YUR A;  1X4U A;  2K4D A;  3PUQ A;  4I7C A;  1WEW A;  4L58 A;  2F42 A;  2LGK A;  5TBN A;  2YSJ A;  4MVT A;  4YBM A;  4BBQ A;  3O34 A;  1JOC A;  2YRE A;  2MUM A;  2YT5 A;  3ZNI A;  2YSM A;  2ZET C;  4TKP B;  5FER A;  4FJC A;  2G6Q A;  2HYE D;  2LV9 A;  2JMD A;  1WEM A;  4YAD A;  4LKA A;  1XWH A;  2G45 A;  1WEU A;  2Y43 A;  4WZ2 A;  1MM3 A;  5KH9 A;  2VPE A;  2YQL A;  1LDK C;  4B7Y C;  2JMJ A;  2RI7 A;  3SOU A;  4GNF A;  4C9Z A;  1WEP A;  4ZUX U;  5G0F A;  4IC3 A;  2KWN A;  2M85 A;  3V43 A;  2CKL B;  4AUQ B;  5FB1 A;  2VJF B;  4I7B A;  2MNY A;  5D1L B;  4AVX A;  2KR4 A;  2CSY A;  3ZPV 1;  4R7E A;  4PTB A;  4LLB A;  3I2D A;  1WIM A;  1WES A;  2PNX A;  2K16 A;  3ZPV E;  4CA1 A;  2FUI A;  4NN2 A;  1X4J A;  2EGP A;  2Y1M A;  1ZBD B;  4UP0 A;  3ZYQ A;  3RPG B;  3MHS A;  4XI1 A;  4R8P K;  1MM2 A;  4UI9 B;  4MSX A;  5DIN A;  1WEQ A;  4UP5 A;  3NG2 A;  2VJE A;  2K17 A;  2YU4 A;  5LKX A;  3ZVY A;  2M1R A;  5G05 B;  1WIL A;  2EOD A;  4FO9 A;  2L75 A;  4YAX A;  3SHB A;  4I7D A;  3ZVZ B;  5D1M B;  5LCW B;  3DPL R;  2M6M A;  5EYA F;  2EA6 A;  4L7X A;  2VP7 A;  1FP0 A;  4GNG A;  2VJE B;  3KV6 A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...