2MT5A

Isolated ring domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Anaphase-promoting complex subunit 11
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mt5A00
4LK9A 2FUIA 4L7XA 2KFTA 2YSJA 5H1VA 4S3OC 5G05B 2VPGA 4V3KC 1VFYA 1BORA 1IYMA 4FK5A 2H0DB 2MT5A 1MM3A 3O7AA 5TDRA 2L75A 4GNDA 2I50A 2QJ0A 1DVPA 1WEOA 3L1XA 2VPBA 5G04B 2CT2A 5LCWB 2CSZA 3C6WA 3SHBA 4S3OB 2JRJA 3KV6A 2FSAA 5B77A 2M6MA 1ZBDB 2OXQC 2G43A 1N87A 2YUCA 1V87A 4I7BA 2RSDA 3ASLA 5AIUA 2VNFA 3NG2A 2K17A 2LXPC 2KIZA 2ECIA 2C2VS 2JMJA 3DQVR 3PHDA 4UP0A 3DPLR 1FP0A 2G6QA 2EODA 4P5OB 2LV9A 4X3GA 3ZPV1 2ECTA 2PUYA 4FJCA 1WILA 3U5NA 4NN2A 4FIPA 4N4FA 4UI9B 1K2FA 2F6NA 2ECWA 4A49A 2L43A 3KQIA 2NAAA 2VJFB 2LGKA 5DKAA 2FUUA 4PPEA 3L1ZB 1MM2A 4WA6A 1E4UA 5H1TA 3M63A 5DINA 4IC2A 1WESA 2VJEB 2KGIA 1LDJB 2M3HA 2BAYA 1F62A 4WZ0A 2YHOA 3FL2A 4ZUXU 5LKTA 3KV5A 3N9LA 1VD4A 3LQJA 3O35A 3M99A 5D1LB 5G0FA 3RTRB 4FO9A 2KYUA 4LADB 4GNFA 2MA5A 3O37A 4AYCA 4N3WA 5B78A 1WEEA 2LN0A 4YATA 3N9OA 1JM7A 2YQLA 5TDWA 2KU3A 1X4IA 2DX8A 5B75A 3SOWA 4GNGA 1FBVA 2UZGA 4LJNA 1T1HA 4A4CA 4I7CA 1WGMA 1X4JA 4YBSA 4MSXA 3T7LA 2MUMA 1JOCA 3LRQA 3L11A 4GNEA 2EGPA 2IDAA 2YSMA 3EB5A 3ZVZB 5H1UA 1Z2QA 2L0BA 3N9NA 3LQIA 2F6JA 2ECVA 1XWHA 2MD7B 2JMIA 2F42A 4B7YC 5B8DA 2CSYA 1WEWA 2JMDA 2VPDA 5J3XA 2VJFA 4QF3A 4LLBA 2LGVA 5C13A 2AN6A 3EB6A 5H9MA 5KH9A 5LKXA 4AP4A 5FEYA 3VK6A 2VP7A 4IC3A 3U5OA 1HYIA 4C9ZA 3N9PA 2PNXA 4WZ3B 5TABA 1HYJA 2YHNA 3MHSA 2MD8C 2LGGA 1WE9A 4O64A 1U6GB 2K16A 4LKAA 4GB0A 2MIQA 5EYAF 2MA6A 2YREA 4ZQLA 3O34A 1JM7B 4YBMA 1WIMA 3U5PA 3HTKC 4W4UA 3U5MA 4XI1A 2K4DA 3ZNIA 3GV4A 2M1RA 1CHCA 1WFKA 5FB0A 4B86C 3ZVYA 5B79A 4L58A 3KNVA 2KWOA 2ZETC 3PURA 5AITA 3HCTA 3HCUA 3ZTGA 2KWNA 5FB1A 2VPEA 2LDRA 5KH3A 2YURA 3N9MA 4YBTA 4CCGX 3PUQA 2CKLA 4AVXA 2XB1A 2K1JA 4Q6FA 1Z6UA 3ZPVE 1VYXA 1RMDA 2KWJA 1WENA 2MNYA 4BHWA 2E6RA 3MHHA 1X4UA 5B76A 2HDPA 3ZYQA 3SOUA 2YQMA 3LQHA 2G45A 3O36A 2KR4A 2LQ6A 4YADA 4CA1A 4MVTA 2D8SA 4WZ2A 2M85A 4R7EA 2Y1MA 5LKZA 1WEVA 1WEQA 4PTBA 2ECNA 5TBNA 2ECGA 2LGLA 1WEUA 2LXHC 4QF2A 2H0DA 4V3LC 3IHPA 3QZVA 4AUQB 5KH7A 1WEMA 5LKUA 2YW8A 4YC9A 2Y1NA 3V43A 5I3LA 4BBQA 4R2YA 4UP5A 4ZDTA 2EA6A 4YABA 2L5UA 3N9QA 3M62A 2KREA 1Z60A 3O70A 2C2LA 2MNZA 2VJEA 2E6SA 4I7DA 5D1MB 5JG6A 2XEUA 4A0CD 3O33A 2CKLB 4A4BA 2QICA 2HYED 2LRIC 1WEPA 3RPGB 2YU4A 3T6RA 4AYCB 5C11A 2YT5A 2KE1A 4F52B 2KGGA 5FERA 2ECJA 3C5KA 2YYRA 5D1KB 4YAXA 2RI7A 3GL6A 4TKPB 3RPGC 1LDKC 2KWKA 4R8PK 1G25A 2QIZA 2Y43A 2L80A 3I2DA 5TRBA 3HCSA 3SOXA
chains in the Genus database with same CATH superfamily
4LK9A 2FUIA 4L7XA 2DJAA 2KFTA 2YSJA 5H1VA 4S3OC 5G05B 3DWDA 1MBMA 2VPGA 3FANA 4F1PA 4V3KC 1VFYA 1BORA 1IYMA 4FK5A 2H0DB 2EXUA 2MT5A 1MM3A 3O7AA 5TDRA 2L75A 4GNDA 2KKYA 2I50A 2QJ0A 2P57A 2CSVA 1DVPA 1WEOA 3L1XA 2VPBA 5G04B 2CT2A 5LCWB 2CSZA 3C6WA 3SHBA 4S3OB 2JRJA 3KV6A 2FSAA 5B77A 2M6MA 1ZBDB 2OXQC 2CRWA 2G43A 1N87A 2YUCA 1V87A 4O62A 4I7BA 2RSDA 3ASLA 5AIUA 2VNFA 3NG2A 2K17A 2LXPC 2KIZA 2ECIA 3JUEA 2C2VS 2JMJA 2RR4A 3DQVR 3PHDA 4UP0A 3DPLR 1FP0A 2G6QA 2EODA 5SVIA 4P5OB 2LV9A 3LJUX 4X3GA 3ZPV1 2ECTA 2PUYA 4FJCA 1WILA 3U5NA 4NN2A 4FIPA 4N4FA 4UI9B 2F6NA 1K2FA 2ECWA 4A49A 2L43A 3KQIA 2NAAA 2VJFB 5SVXA 2LGKA 5DKAA 3FAOA 2FUUA 4PPEA 3L1ZB 1MM2A 2OWAA 4WA6A 1E4UA 2CONA 5H1TA 3M63A 5DINA 4IC2A 1WESA 2VJEB 2KGIA 1LDJB 2DSMA 2IQJA 2M3HA 2BAYA 1F62A 4WZ0A 2YHOA 3FL2A 4ZUXU 5LKTA 3KV5A 3N9LA 1VD4A 3LQJA 3O35A 3M99A 5D1LB 5G0FA 3RTRB 4FO9A 2KYUA 4LADB 4Z0RA 4GNFA 2LAUA 2MA5A 3O37A 4AYCA 4N3WA 5B78A 1WEEA 2LN0A 4YATA 3N9OA 1JM7A 2YQLA 5TDWA 2KU3A 1X4IA 2DX8A 5B75A 3SOWA 4GNGA 1FBVA 2UZGA 4LJNA 1T1HA 4A4CA 4I7CA 1WGMA 1X4JA 4YBSA 3FJUB 4MSXA 3H7HA 3T7LA 2MUMA 1JOCA 3O47A 3LRQA 3Q1DA 3L11A 4GNEA 2D8UA 2EGPA 2IDAA 2YSMA 3EB5A 3ZVZB 5H1UA 1Z2QA 2L0BA 3N9NA 3LQIA 2F6JA 2ECVA 2YVRA 1XWHA 2MD7B 2JMIA 2F42A 4B7YC 5B8DA 2CSYA 1WEWA 2JMDA 2FD4A 2MKEA 2VPDA 5J3XA 2VJFA 4QF3A 2L7PA 4LLBA 2LGVA 5C13A 2AN6A 3EB6A 3FM8C 5H9MA 5KH9A 5LKXA 3DDTA 4AP4A 5FEYA 3T9KA 3VK6A 2VP7A 4IC3A 3U5OA 1HYIA 4C9ZA 3N9PA 2JM3A 2PNXA 4WZ3B 5TABA 1HYJA 4Z0OA 2YHNA 3MHSA 2MD8C 2LGGA 1WE9A 4O64A 4H9DA 1U6GB 2K16A 4LKAA 4GB0A 2MIQA 3MDBC 5EYAF 3KDEC 2MA6A 2YREA 4ZQLA 3O34A 1JM7B 5SVIB 4YBMA 1WIMA 3U5PA 3HTKC 2CRRA 4W4UA 3U5MA 4XI1A 2K4DA 3ZNIA 2B0OE 3GV4A 2M1RA 1CHCA 3M7KA 1WFKA 5FB0A 4B86C 3ZVYA 5B79A 4L58A 3KNVA 2KWOA 2ZETC 3PURA 5AITA 3HCTA 3HCUA 3ZTGA 2KWNA 4OGEA 5FB1A 2VPEA 2LDRA 5KH3A 2YURA 3N9MA 4YBTA 4CCGX 3PUQA 2CKLA 4AVXA 2XB1A 2K1JA 4Q6FA 1Z6UA 3ZPVE 1VYXA 3LDYA 1RMDA 2KWJA 1WENA 2MNYA 4BHWA 2E6RA 3MHHA 3FEHA 1X4UA 5B76A 2HDPA 3ZYQA 2XOZA 3SOUA 2YQMA 2JUNA 3LQHA 2FFWA 2G45A 3O36A 2KR4A 2LQ6A 4YADA 4CA1A 4MVTA 2D8SA 4WZ2A 2M85A 4R7EA 2Y1MA 5LKZA 1WEVA 1WEQA 4PTBA 2ECNA 5TBNA 2ECGA 2LGLA 1WEUA 3LVRE 2EGMA 2LXHC 4QF2A 2H0DA 4V3LC 3IHPA 3QZVA 4AUQB 2KKXA 2E61A 5KH7A 1WEMA 5LKUA 2YW8A 4YC9A 2Y1NA 3V43A 5I3LA 4BBQA 3PLWA 2XOCA 4R2YA 4ZDTA 4UP5A 2EA6A 4YABA 2L5UA 3N9QA 3M62A 4OGCA 2KREA 1Z60A 3O70A 3E2DA 5SVYA 2C2LA 2MNZA 2VJEA 2E6SA 3SUBA 4I7DA 5D1MB 5JG6A 2XEUA 4A0CD 3O33A 2CKLB 4A4BA 2QICA 2HYED 1DCQA 2LRIC 1WEPA 2M13A 3LVQE 2XOYA 3RPGB 2YU4A 3T6RA 4AYCB 5C11A 2YT5A 2KE1A 4F52B 2KGGA 5FERA 4QQ4A 2ECJA 3C5KA 2YYRA 5D1KB 4YAXA 2RI7A 3GL6A 4TKPB 3RPGC 1LDKC 2KWKA 4R8PK 2XP0A 1G25A 2QIZA 2Y43A 5K3QA 2L80A 3I2DA 5TRBA 3HCSA 3SOXA
chains in the Genus database with same CATH topology
4LK9A 2FUIA 4L7XA 2KFTA 2YSJA 5H1VA 4S3OC 5G05B 2VPGA 4V3KC 1VFYA 1BORA 1IYMA 4FK5A 2H0DB 2MT5A 1MM3A 3O7AA 5TDRA 2L75A 4GNDA 2I50A 2QJ0A 1DVPA 1WEOA 3L1XA 2VPBA 5G04B 2CT2A 5LCWB 2CSZA 3C6WA 3SHBA 4S3OB 2JRJA 3KV6A 2FSAA 5B77A 2M6MA 1ZBDB 2OXQC 2G43A 1N87A 2YUCA 1V87A 4I7BA 2RSDA 3ASLA 5AIUA 2VNFA 3NG2A 2K17A 2LXPC 2KIZA 2ECIA 2C2VS 2JMJA 3DQVR 3PHDA 4UP0A 3DPLR 1FP0A 2G6QA 2EODA 4P5OB 2LV9A 4X3GA 3ZPV1 2ECTA 2PUYA 4FJCA 1WILA 3U5NA 4NN2A 4FIPA 4N4FA 4UI9B 1K2FA 2F6NA 2ECWA 4A49A 2L43A 3KQIA 2NAAA 2VJFB 2LGKA 5DKAA 2FUUA 4PPEA 3L1ZB 1MM2A 4WA6A 1E4UA 5H1TA 3M63A 5DINA 4IC2A 1WESA 2VJEB 2KGIA 1LDJB 2M3HA 2BAYA 1F62A 4WZ0A 2YHOA 3FL2A 4ZUXU 5LKTA 3KV5A 3N9LA 1VD4A 3LQJA 3O35A 3M99A 5D1LB 5G0FA 3RTRB 4FO9A 2KYUA 4LADB 4GNFA 2MA5A 3O37A 4AYCA 4N3WA 5B78A 1WEEA 2LN0A 4YATA 3N9OA 1JM7A 2YQLA 5TDWA 2KU3A 1X4IA 2DX8A 5B75A 3SOWA 4GNGA 1FBVA 2UZGA 4LJNA 1T1HA 4A4CA 4I7CA 1WGMA 1X4JA 4YBSA 4MSXA 3T7LA 2MUMA 1JOCA 3LRQA 3L11A 4GNEA 2EGPA 2IDAA 2YSMA 3EB5A 3ZVZB 5H1UA 1Z2QA 2L0BA 3N9NA 3LQIA 2F6JA 2ECVA 1XWHA 2MD7B 2JMIA 2F42A 4B7YC 5B8DA 2CSYA 1WEWA 2JMDA 2VPDA 5J3XA 2VJFA 4QF3A 4LLBA 2LGVA 5C13A 2AN6A 3EB6A 5H9MA 5KH9A 5LKXA 4AP4A 5FEYA 3VK6A 2VP7A 4IC3A 3U5OA 1HYIA 4C9ZA 3N9PA 2PNXA 4WZ3B 5TABA 1HYJA 2YHNA 3MHSA 2MD8C 2LGGA 1WE9A 4O64A 1U6GB 2K16A 4LKAA 4GB0A 2MIQA 5EYAF 2MA6A 2YREA 4ZQLA 3O34A 1JM7B 4YBMA 1WIMA 3U5PA 3HTKC 4W4UA 3U5MA 4XI1A 2K4DA 3ZNIA 3GV4A 2M1RA 1CHCA 1WFKA 5FB0A 4B86C 3ZVYA 5B79A 4L58A 3KNVA 2KWOA 2ZETC 3PURA 5AITA 3HCTA 3HCUA 3ZTGA 2KWNA 5FB1A 2VPEA 2LDRA 5KH3A 2YURA 3N9MA 4YBTA 4CCGX 3PUQA 2CKLA 4AVXA 2XB1A 2K1JA 4Q6FA 1Z6UA 3ZPVE 1VYXA 1RMDA 2KWJA 1WENA 2MNYA 4BHWA 2E6RA 3MHHA 1X4UA 5B76A 2HDPA 3ZYQA 3SOUA 2YQMA 3LQHA 2G45A 3O36A 2KR4A 2LQ6A 4YADA 4CA1A 4MVTA 2D8SA 4WZ2A 2M85A 4R7EA 2Y1MA 5LKZA 1WEVA 1WEQA 4PTBA 2ECNA 5TBNA 2ECGA 2LGLA 1WEUA 2LXHC 4QF2A 2H0DA 4V3LC 3IHPA 3QZVA 4AUQB 5KH7A 1WEMA 5LKUA 2YW8A 4YC9A 2Y1NA 3V43A 5I3LA 4BBQA 4R2YA 4UP5A 4ZDTA 2EA6A 4YABA 2L5UA 3N9QA 3M62A 2KREA 1Z60A 3O70A 2C2LA 2MNZA 2VJEA 2E6SA 4I7DA 5D1MB 5JG6A 2XEUA 4A0CD 3O33A 2CKLB 4A4BA 2QICA 2HYED 2LRIC 1WEPA 3RPGB 2YU4A 3T6RA 4AYCB 5C11A 2YT5A 2KE1A 4F52B 2KGGA 5FERA 2ECJA 3C5KA 2YYRA 5D1KB 4YAXA 2RI7A 3GL6A 4TKPB 3RPGC 1LDKC 2KWKA 4R8PK 1G25A 2QIZA 2Y43A 2L80A 3I2DA 5TRBA 3HCSA 3SOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK9 A;  2FUI A;  4L7X A;  2KFT A;  2YSJ A;  5H1V A;  4S3O C;  5G05 B;  2VPG A;  4V3K C;  1VFY A;  1BOR A;  1IYM A;  4FK5 A;  2H0D B;  2MT5 A;  1MM3 A;  3O7A A;  5TDR A;  2L75 A;  4GND A;  2I50 A;  2QJ0 A;  1DVP A;  1WEO A;  3L1X A;  2VPB A;  5G04 B;  2CT2 A;  5LCW B;  2CSZ A;  3C6W A;  3SHB A;  4S3O B;  2JRJ A;  3KV6 A;  2FSA A;  5B77 A;  2M6M A;  1ZBD B;  2OXQ C;  2G43 A;  1N87 A;  2YUC A;  1V87 A;  4I7B A;  2RSD A;  3ASL A;  5AIU A;  2VNF A;  3NG2 A;  2K17 A;  2LXP C;  2KIZ A;  2ECI A;  2C2V S;  2JMJ A;  3DQV R;  3PHD A;  4UP0 A;  3DPL R;  1FP0 A;  2G6Q A;  2EOD A;  4P5O B;  2LV9 A;  4X3G A;  3ZPV 1;  2ECT A;  2PUY A;  4FJC A;  1WIL A;  3U5N A;  4NN2 A;  4FIP A;  4N4F A;  4UI9 B;  1K2F A;  2F6N A;  2ECW A;  4A49 A;  2L43 A;  3KQI A;  2NAA A;  2VJF B;  2LGK A;  5DKA A;  2FUU A;  4PPE A;  3L1Z B;  1MM2 A;  4WA6 A;  1E4U A;  5H1T A;  3M63 A;  5DIN A;  4IC2 A;  1WES A;  2VJE B;  2KGI A;  1LDJ B;  2M3H A;  2BAY A;  1F62 A;  4WZ0 A;  2YHO A;  3FL2 A;  4ZUX U;  5LKT A;  3KV5 A;  3N9L A;  1VD4 A;  3LQJ A;  3O35 A;  3M99 A;  5D1L B;  5G0F A;  3RTR B;  4FO9 A;  2KYU A;  4LAD B;  4GNF A;  2MA5 A;  3O37 A;  4AYC A;  4N3W A;  5B78 A;  1WEE A;  2LN0 A;  4YAT A;  3N9O A;  1JM7 A;  2YQL A;  5TDW A;  2KU3 A;  1X4I A;  2DX8 A;  5B75 A;  3SOW A;  4GNG A;  1FBV A;  2UZG A;  4LJN A;  1T1H A;  4A4C A;  4I7C A;  1WGM A;  1X4J A;  4YBS A;  4MSX A;  3T7L A;  2MUM A;  1JOC A;  3LRQ A;  3L11 A;  4GNE A;  2EGP A;  2IDA A;  2YSM A;  3EB5 A;  3ZVZ B;  5H1U A;  1Z2Q A;  2L0B A;  3N9N A;  3LQI A;  2F6J A;  2ECV A;  1XWH A;  2MD7 B;  2JMI A;  2F42 A;  4B7Y C;  5B8D A;  2CSY A;  1WEW A;  2JMD A;  2VPD A;  5J3X A;  2VJF A;  4QF3 A;  4LLB A;  2LGV A;  5C13 A;  2AN6 A;  3EB6 A;  5H9M A;  5KH9 A;  5LKX A;  4AP4 A;  5FEY A;  3VK6 A;  2VP7 A;  4IC3 A;  3U5O A;  1HYI A;  4C9Z A;  3N9P A;  2PNX A;  4WZ3 B;  5TAB A;  1HYJ A;  2YHN A;  3MHS A;  2MD8 C;  2LGG A;  1WE9 A;  4O64 A;  1U6G B;  2K16 A;  4LKA A;  4GB0 A;  2MIQ A;  5EYA F;  2MA6 A;  2YRE A;  4ZQL A;  3O34 A;  1JM7 B;  4YBM A;  1WIM A;  3U5P A;  3HTK C;  4W4U A;  3U5M A;  4XI1 A;  2K4D A;  3ZNI A;  3GV4 A;  2M1R A;  1CHC A;  1WFK A;  5FB0 A;  4B86 C;  3ZVY A;  5B79 A;  4L58 A;  3KNV A;  2KWO A;  2ZET C;  3PUR A;  5AIT A;  3HCT A;  3HCU A;  3ZTG A;  2KWN A;  5FB1 A;  2VPE A;  2LDR A;  5KH3 A;  2YUR A;  3N9M A;  4YBT A;  4CCG X;  3PUQ A;  2CKL A;  4AVX A;  2XB1 A;  2K1J A;  4Q6F A;  1Z6U A;  3ZPV E;  1VYX A;  1RMD A;  2KWJ A;  1WEN A;  2MNY A;  4BHW A;  2E6R A;  3MHH A;  1X4U A;  5B76 A;  2HDP A;  3ZYQ A;  3SOU A;  2YQM A;  3LQH A;  2G45 A;  3O36 A;  2KR4 A;  2LQ6 A;  4YAD A;  4CA1 A;  4MVT A;  2D8S A;  4WZ2 A;  2M85 A;  4R7E A;  2Y1M A;  5LKZ A;  1WEV A;  1WEQ A;  4PTB A;  2ECN A;  5TBN A;  2ECG A;  2LGL A;  1WEU A;  2LXH C;  4QF2 A;  2H0D A;  4V3L C;  3IHP A;  3QZV A;  4AUQ B;  5KH7 A;  1WEM A;  5LKU A;  2YW8 A;  4YC9 A;  2Y1N A;  3V43 A;  5I3L A;  4BBQ A;  4R2Y A;  4UP5 A;  4ZDT A;  2EA6 A;  4YAB A;  2L5U A;  3N9Q A;  3M62 A;  2KRE A;  1Z60 A;  3O70 A;  2C2L A;  2MNZ A;  2VJE A;  2E6S A;  4I7D A;  5D1M B;  5JG6 A;  2XEU A;  4A0C D;  3O33 A;  2CKL B;  4A4B A;  2QIC A;  2HYE D;  2LRI C;  1WEP A;  3RPG B;  2YU4 A;  3T6R A;  4AYC B;  5C11 A;  2YT5 A;  2KE1 A;  4F52 B;  2KGG A;  5FER A;  2ECJ A;  3C5K A;  2YYR A;  5D1K B;  4YAX A;  2RI7 A;  3GL6 A;  4TKP B;  3RPG C;  1LDK C;  2KWK A;  4R8P K;  1G25 A;  2QIZ A;  2Y43 A;  2L80 A;  3I2D A;  5TRB A;  3HCS A;  3SOX A; 
#chains in the Genus database with same CATH topology
 4LK9 A;  2FUI A;  4L7X A;  2DJA A;  2KFT A;  2YSJ A;  5H1V A;  4S3O C;  5G05 B;  3DWD A;  1MBM A;  2VPG A;  3FAN A;  4F1P A;  4V3K C;  1VFY A;  1BOR A;  1IYM A;  4FK5 A;  2H0D B;  2EXU A;  2MT5 A;  1MM3 A;  3O7A A;  5TDR A;  2L75 A;  4GND A;  2KKY A;  2I50 A;  2QJ0 A;  2P57 A;  2CSV A;  1DVP A;  1WEO A;  3L1X A;  2VPB A;  5G04 B;  2CT2 A;  5LCW B;  2CSZ A;  3C6W A;  3SHB A;  4S3O B;  2JRJ A;  3KV6 A;  2FSA A;  5B77 A;  2M6M A;  1ZBD B;  2OXQ C;  2CRW A;  2G43 A;  1N87 A;  2YUC A;  1V87 A;  4O62 A;  4I7B A;  2RSD A;  3ASL A;  5AIU A;  2VNF A;  3NG2 A;  2K17 A;  2LXP C;  2KIZ A;  2ECI A;  3JUE A;  2C2V S;  2JMJ A;  2RR4 A;  3DQV R;  3PHD A;  4UP0 A;  3DPL R;  1FP0 A;  2G6Q A;  2EOD A;  5SVI A;  4P5O B;  2LV9 A;  3LJU X;  4X3G A;  3ZPV 1;  2ECT A;  2PUY A;  4FJC A;  1WIL A;  3U5N A;  4NN2 A;  4FIP A;  4N4F A;  4UI9 B;  2F6N A;  1K2F A;  2ECW A;  4A49 A;  2L43 A;  3KQI A;  2NAA A;  2VJF B;  5SVX A;  2LGK A;  5DKA A;  3FAO A;  2FUU A;  4PPE A;  3L1Z B;  1MM2 A;  2OWA A;  4WA6 A;  1E4U A;  2CON A;  5H1T A;  3M63 A;  5DIN A;  4IC2 A;  1WES A;  2VJE B;  2KGI A;  1LDJ B;  2DSM A;  2IQJ A;  2M3H A;  2BAY A;  1F62 A;  4WZ0 A;  2YHO A;  3FL2 A;  4ZUX U;  5LKT A;  3KV5 A;  3N9L A;  1VD4 A;  3LQJ A;  3O35 A;  3M99 A;  5D1L B;  5G0F A;  3RTR B;  4FO9 A;  2KYU A;  4LAD B;  4Z0R A;  4GNF A;  2LAU A;  2MA5 A;  3O37 A;  4AYC A;  4N3W A;  5B78 A;  1WEE A;  2LN0 A;  4YAT A;  3N9O A;  1JM7 A;  2YQL A;  5TDW A;  2KU3 A;  1X4I A;  2DX8 A;  5B75 A;  3SOW A;  4GNG A;  1FBV A;  2UZG A;  4LJN A;  1T1H A;  4A4C A;  4I7C A;  1WGM A;  1X4J A;  4YBS A;  3FJU B;  4MSX A;  3H7H A;  3T7L A;  2MUM A;  1JOC A;  3O47 A;  3LRQ A;  3Q1D A;  3L11 A;  4GNE A;  2D8U A;  2EGP A;  2IDA A;  2YSM A;  3EB5 A;  3ZVZ B;  5H1U A;  1Z2Q A;  2L0B A;  3N9N A;  3LQI A;  2F6J A;  2ECV A;  2YVR A;  1XWH A;  2MD7 B;  2JMI A;  2F42 A;  4B7Y C;  5B8D A;  2CSY A;  1WEW A;  2JMD A;  2FD4 A;  2MKE A;  2VPD A;  5J3X A;  2VJF A;  4QF3 A;  2L7P A;  4LLB A;  2LGV A;  5C13 A;  2AN6 A;  3EB6 A;  3FM8 C;  5H9M A;  5KH9 A;  5LKX A;  3DDT A;  4AP4 A;  5FEY A;  3T9K A;  3VK6 A;  2VP7 A;  4IC3 A;  3U5O A;  1HYI A;  4C9Z A;  3N9P A;  2JM3 A;  2PNX A;  4WZ3 B;  5TAB A;  1HYJ A;  4Z0O A;  2YHN A;  3MHS A;  2MD8 C;  2LGG A;  1WE9 A;  4O64 A;  4H9D A;  1U6G B;  2K16 A;  4LKA A;  4GB0 A;  2MIQ A;  3MDB C;  5EYA F;  3KDE C;  2MA6 A;  2YRE A;  4ZQL A;  3O34 A;  1JM7 B;  5SVI B;  4YBM A;  1WIM A;  3U5P A;  3HTK C;  2CRR A;  4W4U A;  3U5M A;  4XI1 A;  2K4D A;  3ZNI A;  2B0O E;  3GV4 A;  2M1R A;  1CHC A;  3M7K A;  1WFK A;  5FB0 A;  4B86 C;  3ZVY A;  5B79 A;  4L58 A;  3KNV A;  2KWO A;  2ZET C;  3PUR A;  5AIT A;  3HCT A;  3HCU A;  3ZTG A;  2KWN A;  4OGE A;  5FB1 A;  2VPE A;  2LDR A;  5KH3 A;  2YUR A;  3N9M A;  4YBT A;  4CCG X;  3PUQ A;  2CKL A;  4AVX A;  2XB1 A;  2K1J A;  4Q6F A;  1Z6U A;  3ZPV E;  1VYX A;  3LDY A;  1RMD A;  2KWJ A;  1WEN A;  2MNY A;  4BHW A;  2E6R A;  3MHH A;  3FEH A;  1X4U A;  5B76 A;  2HDP A;  3ZYQ A;  2XOZ A;  3SOU A;  2YQM A;  2JUN A;  3LQH A;  2FFW A;  2G45 A;  3O36 A;  2KR4 A;  2LQ6 A;  4YAD A;  4CA1 A;  4MVT A;  2D8S A;  4WZ2 A;  2M85 A;  4R7E A;  2Y1M A;  5LKZ A;  1WEV A;  1WEQ A;  4PTB A;  2ECN A;  5TBN A;  2ECG A;  2LGL A;  1WEU A;  3LVR E;  2EGM A;  2LXH C;  4QF2 A;  2H0D A;  4V3L C;  3IHP A;  3QZV A;  4AUQ B;  2KKX A;  2E61 A;  5KH7 A;  1WEM A;  5LKU A;  2YW8 A;  4YC9 A;  2Y1N A;  3V43 A;  5I3L A;  4BBQ A;  3PLW A;  2XOC A;  4R2Y A;  4ZDT A;  4UP5 A;  2EA6 A;  4YAB A;  2L5U A;  3N9Q A;  3M62 A;  4OGC A;  2KRE A;  1Z60 A;  3O70 A;  3E2D A;  5SVY A;  2C2L A;  2MNZ A;  2VJE A;  2E6S A;  3SUB A;  4I7D A;  5D1M B;  5JG6 A;  2XEU A;  4A0C D;  3O33 A;  2CKL B;  4A4B A;  2QIC A;  2HYE D;  1DCQ A;  2LRI C;  1WEP A;  2M13 A;  3LVQ E;  2XOY A;  3RPG B;  2YU4 A;  3T6R A;  4AYC B;  5C11 A;  2YT5 A;  2KE1 A;  4F52 B;  2KGG A;  5FER A;  4QQ4 A;  2ECJ A;  3C5K A;  2YYR A;  5D1K B;  4YAX A;  2RI7 A;  3GL6 A;  4TKP B;  3RPG C;  1LDK C;  2KWK A;  4R8P K;  2XP0 A;  1G25 A;  2QIZ A;  2Y43 A;  5K3Q A;  2L80 A;  3I2D A;  5TRB A;  3HCS A;  3SOX A; 
#chains in the Genus database with same CATH homology
 4LK9 A;  2FUI A;  4L7X A;  2KFT A;  2YSJ A;  5H1V A;  4S3O C;  5G05 B;  2VPG A;  4V3K C;  1VFY A;  1BOR A;  1IYM A;  4FK5 A;  2H0D B;  2MT5 A;  1MM3 A;  3O7A A;  5TDR A;  2L75 A;  4GND A;  2I50 A;  2QJ0 A;  1DVP A;  1WEO A;  3L1X A;  2VPB A;  5G04 B;  2CT2 A;  5LCW B;  2CSZ A;  3C6W A;  3SHB A;  4S3O B;  2JRJ A;  3KV6 A;  2FSA A;  5B77 A;  2M6M A;  1ZBD B;  2OXQ C;  2G43 A;  1N87 A;  2YUC A;  1V87 A;  4I7B A;  2RSD A;  3ASL A;  5AIU A;  2VNF A;  3NG2 A;  2K17 A;  2LXP C;  2KIZ A;  2ECI A;  2C2V S;  2JMJ A;  3DQV R;  3PHD A;  4UP0 A;  3DPL R;  1FP0 A;  2G6Q A;  2EOD A;  4P5O B;  2LV9 A;  4X3G A;  3ZPV 1;  2ECT A;  2PUY A;  4FJC A;  1WIL A;  3U5N A;  4NN2 A;  4FIP A;  4N4F A;  4UI9 B;  1K2F A;  2F6N A;  2ECW A;  4A49 A;  2L43 A;  3KQI A;  2NAA A;  2VJF B;  2LGK A;  5DKA A;  2FUU A;  4PPE A;  3L1Z B;  1MM2 A;  4WA6 A;  1E4U A;  5H1T A;  3M63 A;  5DIN A;  4IC2 A;  1WES A;  2VJE B;  2KGI A;  1LDJ B;  2M3H A;  2BAY A;  1F62 A;  4WZ0 A;  2YHO A;  3FL2 A;  4ZUX U;  5LKT A;  3KV5 A;  3N9L A;  1VD4 A;  3LQJ A;  3O35 A;  3M99 A;  5D1L B;  5G0F A;  3RTR B;  4FO9 A;  2KYU A;  4LAD B;  4GNF A;  2MA5 A;  3O37 A;  4AYC A;  4N3W A;  5B78 A;  1WEE A;  2LN0 A;  4YAT A;  3N9O A;  1JM7 A;  2YQL A;  5TDW A;  2KU3 A;  1X4I A;  2DX8 A;  5B75 A;  3SOW A;  4GNG A;  1FBV A;  2UZG A;  4LJN A;  1T1H A;  4A4C A;  4I7C A;  1WGM A;  1X4J A;  4YBS A;  4MSX A;  3T7L A;  2MUM A;  1JOC A;  3LRQ A;  3L11 A;  4GNE A;  2EGP A;  2IDA A;  2YSM A;  3EB5 A;  3ZVZ B;  5H1U A;  1Z2Q A;  2L0B A;  3N9N A;  3LQI A;  2F6J A;  2ECV A;  1XWH A;  2MD7 B;  2JMI A;  2F42 A;  4B7Y C;  5B8D A;  2CSY A;  1WEW A;  2JMD A;  2VPD A;  5J3X A;  2VJF A;  4QF3 A;  4LLB A;  2LGV A;  5C13 A;  2AN6 A;  3EB6 A;  5H9M A;  5KH9 A;  5LKX A;  4AP4 A;  5FEY A;  3VK6 A;  2VP7 A;  4IC3 A;  3U5O A;  1HYI A;  4C9Z A;  3N9P A;  2PNX A;  4WZ3 B;  5TAB A;  1HYJ A;  2YHN A;  3MHS A;  2MD8 C;  2LGG A;  1WE9 A;  4O64 A;  1U6G B;  2K16 A;  4LKA A;  4GB0 A;  2MIQ A;  5EYA F;  2MA6 A;  2YRE A;  4ZQL A;  3O34 A;  1JM7 B;  4YBM A;  1WIM A;  3U5P A;  3HTK C;  4W4U A;  3U5M A;  4XI1 A;  2K4D A;  3ZNI A;  3GV4 A;  2M1R A;  1CHC A;  1WFK A;  5FB0 A;  4B86 C;  3ZVY A;  5B79 A;  4L58 A;  3KNV A;  2KWO A;  2ZET C;  3PUR A;  5AIT A;  3HCT A;  3HCU A;  3ZTG A;  2KWN A;  5FB1 A;  2VPE A;  2LDR A;  5KH3 A;  2YUR A;  3N9M A;  4YBT A;  4CCG X;  3PUQ A;  2CKL A;  4AVX A;  2XB1 A;  2K1J A;  4Q6F A;  1Z6U A;  3ZPV E;  1VYX A;  1RMD A;  2KWJ A;  1WEN A;  2MNY A;  4BHW A;  2E6R A;  3MHH A;  1X4U A;  5B76 A;  2HDP A;  3ZYQ A;  3SOU A;  2YQM A;  3LQH A;  2G45 A;  3O36 A;  2KR4 A;  2LQ6 A;  4YAD A;  4CA1 A;  4MVT A;  2D8S A;  4WZ2 A;  2M85 A;  4R7E A;  2Y1M A;  5LKZ A;  1WEV A;  1WEQ A;  4PTB A;  2ECN A;  5TBN A;  2ECG A;  2LGL A;  1WEU A;  2LXH C;  4QF2 A;  2H0D A;  4V3L C;  3IHP A;  3QZV A;  4AUQ B;  5KH7 A;  1WEM A;  5LKU A;  2YW8 A;  4YC9 A;  2Y1N A;  3V43 A;  5I3L A;  4BBQ A;  4R2Y A;  4UP5 A;  4ZDT A;  2EA6 A;  4YAB A;  2L5U A;  3N9Q A;  3M62 A;  2KRE A;  1Z60 A;  3O70 A;  2C2L A;  2MNZ A;  2VJE A;  2E6S A;  4I7D A;  5D1M B;  5JG6 A;  2XEU A;  4A0C D;  3O33 A;  2CKL B;  4A4B A;  2QIC A;  2HYE D;  2LRI C;  1WEP A;  3RPG B;  2YU4 A;  3T6R A;  4AYC B;  5C11 A;  2YT5 A;  2KE1 A;  4F52 B;  2KGG A;  5FER A;  2ECJ A;  3C5K A;  2YYR A;  5D1K B;  4YAX A;  2RI7 A;  3GL6 A;  4TKP B;  3RPG C;  1LDK C;  2KWK A;  4R8P K;  1G25 A;  2QIZ A;  2Y43 A;  2L80 A;  3I2D A;  5TRB A;  3HCS A;  3SOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...