2MT5A

Isolated ring domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 11
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mt5A00
2ECNA 3O37A 2Y43A 2RSDA 2M6MA 4NN2A 4ZDTA 3HTKC 4YBMA 2UZGA 1G25A 3MHHA 1FBVA 3N9QA 1WENA 3U5PA 3C5KA 2LGKA 1FP0A 1WEPA 3O33A 4YATA 1X4UA 3L1XA 2BAYA 3N9LA 2VNFA 4MSXA 1LDKC 3KV5A 4LK9A 2G6QA 2M3HA 2YUCA 4PPEA 3PURA 3LQHA 4LLBA 1WEEA 3QZVA 2YU4A 2YURA 1WEUA 1ZBDB 4GNFA 4ZQLA 5EYAF 2Y1NA 4GNGA 4I7BA 3EB5A 5KH7A 3LRQA 2L75A 3ASLA 2EGPA 4XI1A 3L1ZB 4QF3A 2VJEB 3KNVA 1WFKA 2MD8C 5B77A 2YHNA 2VJFB 2YREA 3O7AA 2L0BA 5FB1A 5AIUA 3T6RA 3IHPA 1T1HA 5H9MA 2I50A 5C13A 2CSYA 2LDRA 5AITA 2JRJA 4P5OB 3ZNIA 3GV4A 3ZVYA 4C9ZA 4AUQB 2L5UA 4FO9A 4A4CA 4ZUXU 1WIMA 1BORA 1VFYA 3HCUA 3HCSA 2CSZA 2QIZA 2K1JA 4FJCA 2VP7A 3HCTA 5B79A 2YSJA 2CKLA 1WILA 1WEQA 2VPBA 2F6NA 4LADB 2E6RA 4IC2A 1Z6UA 2KWNA 1RMDA 1WEOA 2ZETC 1MM3A 4L58A 3SHBA 5FB0A 1V87A 4I7CA 2F6JA 4I7DA 2MA6A 2LGVA 2YQMA 2IDAA 1WE9A 2MUMA 2LQ6A 2MIQA 5KH9A 4V3LC 2VPGA 2YHOA 2KFTA 2KGIA 1F62A 4UP0A 2LN0A 3DPLR 2FUIA 4FIPA 2LRIC 2H0DA 1LDJB 5D1MB 5DKAA 2KWKA 3V43A 3RTRB 2ECGA 2ECTA 4TKPB 5D1KB 2MD7B 5C11A 2C2LA 2ECIA 1Z60A 2M1RA 2YQLA 5TDRA 4F52B 2JMIA 2KWOA 4N4FA 2FUUA 2LGLA 4V3KC 2KR4A 4LJNA 2HYED 4IC3A 5TBNA 3N9PA 2YW8A 4AYCA 4N3WA 3NG2A 2PNXA 3ZPVE 4B7YC 2QICA 1DVPA 4MVTA 4YBTA 3KV6A 3GL6A 4O64A 3ZPV1 2MT5A 2VPDA 2YYRA 2G43A 5D1LB 5I3LA 2ECVA 3M62A 1JM7A 3I2DA 1K2FA 4CCGX 1VD4A 4WZ0A 2F42A 5LKUA 2KWJA 2MA5A 3RPGC 2AN6A 3SOXA 3RPGB 2H0DB 2KIZA 1E4UA 5TDWA 3LQIA 4S3OB 2LXHC 3M99A 4BBQA 3FL2A 4R2YA 2VPEA 3SOUA 3ZVZB 4R8PK 1Z2QA 2VJEA 3VK6A 5LKTA 2JMJA 2K4DA 2JMDA 2VJFA 3O34A 5B75A 3U5OA 2PUYA 2HDPA 1MM2A 2NAAA 1VYXA 5H1UA 3T7LA 2DX8A 4AYCB 2FSAA 4YADA 5TRBA 5LKXA 2QJ0A 4W4UA 1IYMA 5B78A 2MNZA 4UI9B 2YT5A 3L11A 3SOWA 3MHSA 5G05B 4PTBA 4L7XA 5G04B 2KE1A 5LCWB 4B86C 2EA6A 4CA1A 2Y1MA 2L80A 2K17A 1JM7B 4GB0A 3EB6A 4A0CD 4A4BA 3N9OA 3ZYQA 2G45A 3N9MA 4YC9A 2YSMA 2LV9A 1WESA 2RI7A 4GNEA 1N87A 4YABA 3O70A 2CKLB 2KU3A 5H1TA 5TABA 2LXPC 1WEVA 2LGGA 5DINA 3KQIA 5G0FA 4GNDA 4QF2A 3U5MA 4YAXA 1X4IA 4WZ2A 1WEMA 1WGMA 3DQVR 3N9NA 2MNYA 3PHDA 1HYIA 4A49A 4AP4A 4BHWA 4UP5A 3ZTGA 5J3XA 1X4JA 3O36A 1U6GB 4WZ3B 2CT2A 2L43A 5KH3A 4Q6FA 2EODA 5FERA 2D8SA 3O35A 5B8DA 1XWHA 2OXQC 5LKZA 2KGGA 2KREA 2ECJA 3C6WA 2E6SA 3M63A 1JOCA 4S3OC 2M85A 3LQJA 5B76A 3PUQA 1HYJA 4YBSA 4X3GA 2XB1A 5H1VA 2XEUA 4R7EA 3U5NA 5FEYA 4AVXA 2K16A 2ECWA 1CHCA 1WEWA 4FK5A 2C2VS 4WA6A 2KYUA 5JG6A 4LKAA
chains in the Genus database with same CATH superfamily
2ECNA 3O37A 3O47A 2IQJA 4Z0OA 2Y43A 2RSDA 2M6MA 4NN2A 4ZDTA 3HTKC 4YBMA 2UZGA 1G25A 3MHHA 1FBVA 3N9QA 1WENA 3U5PA 3C5KA 3MDBC 2LGKA 1FP0A 1WEPA 3O33A 4YATA 1X4UA 3L1XA 2BAYA 3N9LA 2VNFA 4MSXA 1LDKC 3KV5A 4LK9A 2G6QA 2M3HA 2YUCA 2RR4A 4PPEA 3PURA 3LQHA 4LLBA 1WEEA 3QZVA 2YU4A 2YURA 2FD4A 1WEUA 1ZBDB 3PLWA 4GNFA 4ZQLA 5EYAF 2Y1NA 3DDTA 4GNGA 4I7BA 3T9KA 3EB5A 2JUNA 2OWAA 5KH7A 3LRQA 2L75A 3ASLA 3LVRE 2EGPA 4XI1A 3M7KA 3L1ZB 3Q1DA 2MKEA 4QF3A 2VJEB 3KNVA 1WFKA 2MD8C 5B77A 4O62A 2YHNA 2VJFB 2YREA 3KDEC 3O7AA 2L0BA 5FB1A 2XOZA 5AIUA 3T6RA 3IHPA 1T1HA 5H9MA 2I50A 5C13A 2CSYA 2LDRA 5AITA 2XP0A 2JRJA 4P5OB 3ZNIA 3GV4A 3ZVYA 4C9ZA 4AUQB 2L5UA 4FO9A 4A4CA 4ZUXU 1WIMA 1BORA 1VFYA 3HCUA 3HCSA 2CSZA 2M13A 2QIZA 5SVYA 2K1JA 4FJCA 2VP7A 3HCTA 5B79A 2YSJA 2CKLA 2EXUA 1WILA 1WEQA 2FFWA 2F6NA 2VPBA 4LADB 3E2DA 2E6RA 3H7HA 4IC2A 4OGEA 1Z6UA 2KWNA 1RMDA 1WEOA 3DWDA 2ZETC 1MM3A 4L58A 3SHBA 5FB0A 1V87A 4I7CA 2F6JA 4I7DA 2MA6A 5SVIA 3JUEA 2LGVA 2YQMA 2IDAA 1WE9A 2MUMA 2LQ6A 2MIQA 5KH9A 4V3LC 2VPGA 2YHOA 2KFTA 2KGIA 1F62A 4H9DA 4UP0A 2LN0A 3DPLR 4FIPA 2FUIA 2LRIC 2H0DA 1LDJB 5D1MB 5DKAA 2JM3A 2KWKA 3V43A 2KKYA 3RTRB 2ECGA 2ECTA 4TKPB 5D1KB 2MD7B 5C11A 2C2LA 2ECIA 1Z60A 2M1RA 2YQLA 5TDRA 4F52B 2LAUA 2JMIA 2KWOA 4N4FA 2FUUA 2LGLA 4V3KC 2KR4A 4LJNA 2HYED 4IC3A 5TBNA 3N9PA 2YW8A 4AYCA 3FM8C 4N3WA 3NG2A 2PNXA 3ZPVE 4B7YC 2QICA 1DVPA 4MVTA 4YBTA 3KV6A 3GL6A 4O64A 3ZPV1 2MT5A 2VPDA 2YYRA 2G43A 5D1LB 5I3LA 2ECVA 3M62A 1JM7A 3I2DA 2CSVA 1K2FA 4CCGX 2CONA 1VD4A 5K3QA 4WZ0A 2CRRA 3SUBA 2F42A 5LKUA 2KWJA 2L7PA 2MA5A 3RPGC 2AN6A 3SOXA 3RPGB 2H0DB 2KIZA 1E4UA 2B0OE 5TDWA 3LQIA 4S3OB 2LXHC 3M99A 4QQ4A 4BBQA 3FL2A 4R2YA 2VPEA 3SOUA 3ZVZB 4R8PK 2CRWA 2P57A 1Z2QA 2VJEA 3VK6A 5LKTA 2JMJA 2K4DA 2JMDA 2VJFA 3O34A 5B75A 3U5OA 2PUYA 2HDPA 2E61A 1MM2A 2NAAA 1VYXA 2KKXA 5H1UA 3T7LA 2DX8A 3FAOA 4AYCB 2FSAA 4YADA 5TRBA 5LKXA 2QJ0A 4W4UA 1IYMA 5B78A 2MNZA 4UI9B 2YT5A 5SVXA 3L11A 3SOWA 3MHSA 5G05B 4PTBA 4L7XA 5G04B 2KE1A 5LCWB 4B86C 2EA6A 4CA1A 2Y1MA 2L80A 2K17A 1JM7B 4GB0A 3EB6A 4A0CD 4A4BA 3N9OA 3ZYQA 2G45A 3N9MA 4YC9A 3LJUX 2YSMA 2LV9A 1WESA 2RI7A 4GNEA 1N87A 2EGMA 2YVRA 4YABA 3O70A 2CKLB 2KU3A 3FJUB 5H1TA 5TABA 1MBMA 2LXPC 1WEVA 2LGGA 5DINA 3KQIA 1DCQA 5G0FA 4GNDA 4QF2A 3FANA 3U5MA 4YAXA 1X4IA 4WZ2A 1WEMA 1WGMA 3DQVR 3N9NA 2MNYA 3PHDA 1HYIA 5SVIB 4A49A 4AP4A 4BHWA 4UP5A 3ZTGA 5J3XA 4Z0RA 1X4JA 3O36A 1U6GB 4WZ3B 2DJAA 2CT2A 2L43A 5KH3A 4Q6FA 2EODA 5FERA 2D8SA 3O35A 4OGCA 2D8UA 3FEHA 5B8DA 1XWHA 2OXQC 5LKZA 2KGGA 2KREA 2ECJA 3C6WA 2E6SA 3M63A 1JOCA 4S3OC 2M85A 3LQJA 5B76A 3PUQA 1HYJA 4YBSA 4X3GA 2XB1A 5H1VA 2XEUA 2XOYA 2XOCA 4R7EA 3U5NA 5FEYA 4AVXA 2K16A 2ECWA 1CHCA 1WEWA 4FK5A 3LVQE 2C2VS 4WA6A 2KYUA 3LDYA 5JG6A 4F1PA 4LKAA 2DSMA
chains in the Genus database with same CATH topology
2ECNA 3O37A 2Y43A 2RSDA 2M6MA 4NN2A 4ZDTA 3HTKC 4YBMA 2UZGA 1G25A 3MHHA 1FBVA 3N9QA 1WENA 3U5PA 3C5KA 2LGKA 1FP0A 1WEPA 3O33A 4YATA 1X4UA 3L1XA 2BAYA 3N9LA 2VNFA 4MSXA 1LDKC 3KV5A 4LK9A 2G6QA 2M3HA 2YUCA 4PPEA 3PURA 3LQHA 4LLBA 1WEEA 3QZVA 2YU4A 2YURA 1WEUA 1ZBDB 4GNFA 4ZQLA 5EYAF 2Y1NA 4GNGA 4I7BA 3EB5A 5KH7A 3LRQA 2L75A 3ASLA 2EGPA 4XI1A 3L1ZB 4QF3A 2VJEB 3KNVA 1WFKA 2MD8C 5B77A 2YHNA 2VJFB 2YREA 3O7AA 2L0BA 5FB1A 5AIUA 3T6RA 3IHPA 1T1HA 5H9MA 2I50A 5C13A 2CSYA 2LDRA 5AITA 2JRJA 4P5OB 3ZNIA 3GV4A 3ZVYA 4C9ZA 4AUQB 2L5UA 4FO9A 4A4CA 4ZUXU 1WIMA 1BORA 1VFYA 3HCUA 3HCSA 2CSZA 2QIZA 2K1JA 4FJCA 2VP7A 3HCTA 5B79A 2YSJA 2CKLA 1WILA 1WEQA 2VPBA 2F6NA 4LADB 2E6RA 4IC2A 1Z6UA 2KWNA 1RMDA 1WEOA 2ZETC 1MM3A 4L58A 3SHBA 5FB0A 1V87A 4I7CA 2F6JA 4I7DA 2MA6A 2LGVA 2YQMA 2IDAA 1WE9A 2MUMA 2LQ6A 2MIQA 5KH9A 4V3LC 2VPGA 2YHOA 2KFTA 2KGIA 1F62A 4UP0A 2LN0A 3DPLR 2FUIA 4FIPA 2LRIC 2H0DA 1LDJB 5D1MB 5DKAA 2KWKA 3V43A 3RTRB 2ECGA 2ECTA 4TKPB 5D1KB 2MD7B 5C11A 2C2LA 2ECIA 1Z60A 2M1RA 2YQLA 5TDRA 4F52B 2JMIA 2KWOA 4N4FA 2FUUA 2LGLA 4V3KC 2KR4A 4LJNA 2HYED 4IC3A 5TBNA 3N9PA 2YW8A 4AYCA 4N3WA 3NG2A 2PNXA 3ZPVE 4B7YC 2QICA 1DVPA 4MVTA 4YBTA 3KV6A 3GL6A 4O64A 3ZPV1 2MT5A 2VPDA 2YYRA 2G43A 5D1LB 5I3LA 2ECVA 3M62A 1JM7A 3I2DA 1K2FA 4CCGX 1VD4A 4WZ0A 2F42A 5LKUA 2KWJA 2MA5A 3RPGC 2AN6A 3SOXA 3RPGB 2H0DB 2KIZA 1E4UA 5TDWA 3LQIA 4S3OB 2LXHC 3M99A 4BBQA 3FL2A 4R2YA 2VPEA 3SOUA 3ZVZB 4R8PK 1Z2QA 2VJEA 3VK6A 5LKTA 2JMJA 2K4DA 2JMDA 2VJFA 3O34A 5B75A 3U5OA 2PUYA 2HDPA 1MM2A 2NAAA 1VYXA 5H1UA 3T7LA 2DX8A 4AYCB 2FSAA 4YADA 5TRBA 5LKXA 2QJ0A 4W4UA 1IYMA 5B78A 2MNZA 4UI9B 2YT5A 3L11A 3SOWA 3MHSA 5G05B 4PTBA 4L7XA 5G04B 2KE1A 5LCWB 4B86C 2EA6A 4CA1A 2Y1MA 2L80A 2K17A 1JM7B 4GB0A 3EB6A 4A0CD 4A4BA 3N9OA 3ZYQA 2G45A 3N9MA 4YC9A 2YSMA 2LV9A 1WESA 2RI7A 4GNEA 1N87A 4YABA 3O70A 2CKLB 2KU3A 5H1TA 5TABA 2LXPC 1WEVA 2LGGA 5DINA 3KQIA 5G0FA 4GNDA 4QF2A 3U5MA 4YAXA 1X4IA 4WZ2A 1WEMA 1WGMA 3DQVR 3N9NA 2MNYA 3PHDA 1HYIA 4A49A 4AP4A 4BHWA 4UP5A 3ZTGA 5J3XA 1X4JA 3O36A 1U6GB 4WZ3B 2CT2A 2L43A 5KH3A 4Q6FA 2EODA 5FERA 2D8SA 3O35A 5B8DA 1XWHA 2OXQC 5LKZA 2KGGA 2KREA 2ECJA 3C6WA 2E6SA 3M63A 1JOCA 4S3OC 2M85A 3LQJA 5B76A 3PUQA 1HYJA 4YBSA 4X3GA 2XB1A 5H1VA 2XEUA 4R7EA 3U5NA 5FEYA 4AVXA 2K16A 2ECWA 1CHCA 1WEWA 4FK5A 2C2VS 4WA6A 2KYUA 5JG6A 4LKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECN A;  3O37 A;  2Y43 A;  2RSD A;  2M6M A;  4NN2 A;  4ZDT A;  3HTK C;  4YBM A;  2UZG A;  1G25 A;  3MHH A;  1FBV A;  3N9Q A;  1WEN A;  3U5P A;  3C5K A;  2LGK A;  1FP0 A;  1WEP A;  3O33 A;  4YAT A;  1X4U A;  3L1X A;  2BAY A;  3N9L A;  2VNF A;  4MSX A;  1LDK C;  3KV5 A;  4LK9 A;  2G6Q A;  2M3H A;  2YUC A;  4PPE A;  3PUR A;  3LQH A;  4LLB A;  1WEE A;  3QZV A;  2YU4 A;  2YUR A;  1WEU A;  1ZBD B;  4GNF A;  4ZQL A;  5EYA F;  2Y1N A;  4GNG A;  4I7B A;  3EB5 A;  5KH7 A;  3LRQ A;  2L75 A;  3ASL A;  2EGP A;  4XI1 A;  3L1Z B;  4QF3 A;  2VJE B;  3KNV A;  1WFK A;  2MD8 C;  5B77 A;  2YHN A;  2VJF B;  2YRE A;  3O7A A;  2L0B A;  5FB1 A;  5AIU A;  3T6R A;  3IHP A;  1T1H A;  5H9M A;  2I50 A;  5C13 A;  2CSY A;  2LDR A;  5AIT A;  2JRJ A;  4P5O B;  3ZNI A;  3GV4 A;  3ZVY A;  4C9Z A;  4AUQ B;  2L5U A;  4FO9 A;  4A4C A;  4ZUX U;  1WIM A;  1BOR A;  1VFY A;  3HCU A;  3HCS A;  2CSZ A;  2QIZ A;  2K1J A;  4FJC A;  2VP7 A;  3HCT A;  5B79 A;  2YSJ A;  2CKL A;  1WIL A;  1WEQ A;  2VPB A;  2F6N A;  4LAD B;  2E6R A;  4IC2 A;  1Z6U A;  2KWN A;  1RMD A;  1WEO A;  2ZET C;  1MM3 A;  4L58 A;  3SHB A;  5FB0 A;  1V87 A;  4I7C A;  2F6J A;  4I7D A;  2MA6 A;  2LGV A;  2YQM A;  2IDA A;  1WE9 A;  2MUM A;  2LQ6 A;  2MIQ A;  5KH9 A;  4V3L C;  2VPG A;  2YHO A;  2KFT A;  2KGI A;  1F62 A;  4UP0 A;  2LN0 A;  3DPL R;  2FUI A;  4FIP A;  2LRI C;  2H0D A;  1LDJ B;  5D1M B;  5DKA A;  2KWK A;  3V43 A;  3RTR B;  2ECG A;  2ECT A;  4TKP B;  5D1K B;  2MD7 B;  5C11 A;  2C2L A;  2ECI A;  1Z60 A;  2M1R A;  2YQL A;  5TDR A;  4F52 B;  2JMI A;  2KWO A;  4N4F A;  2FUU A;  2LGL A;  4V3K C;  2KR4 A;  4LJN A;  2HYE D;  4IC3 A;  5TBN A;  3N9P A;  2YW8 A;  4AYC A;  4N3W A;  3NG2 A;  2PNX A;  3ZPV E;  4B7Y C;  2QIC A;  1DVP A;  4MVT A;  4YBT A;  3KV6 A;  3GL6 A;  4O64 A;  3ZPV 1;  2MT5 A;  2VPD A;  2YYR A;  2G43 A;  5D1L B;  5I3L A;  2ECV A;  3M62 A;  1JM7 A;  3I2D A;  1K2F A;  4CCG X;  1VD4 A;  4WZ0 A;  2F42 A;  5LKU A;  2KWJ A;  2MA5 A;  3RPG C;  2AN6 A;  3SOX A;  3RPG B;  2H0D B;  2KIZ A;  1E4U A;  5TDW A;  3LQI A;  4S3O B;  2LXH C;  3M99 A;  4BBQ A;  3FL2 A;  4R2Y A;  2VPE A;  3SOU A;  3ZVZ B;  4R8P K;  1Z2Q A;  2VJE A;  3VK6 A;  5LKT A;  2JMJ A;  2K4D A;  2JMD A;  2VJF A;  3O34 A;  5B75 A;  3U5O A;  2PUY A;  2HDP A;  1MM2 A;  2NAA A;  1VYX A;  5H1U A;  3T7L A;  2DX8 A;  4AYC B;  2FSA A;  4YAD A;  5TRB A;  5LKX A;  2QJ0 A;  4W4U A;  1IYM A;  5B78 A;  2MNZ A;  4UI9 B;  2YT5 A;  3L11 A;  3SOW A;  3MHS A;  5G05 B;  4PTB A;  4L7X A;  5G04 B;  2KE1 A;  5LCW B;  4B86 C;  2EA6 A;  4CA1 A;  2Y1M A;  2L80 A;  2K17 A;  1JM7 B;  4GB0 A;  3EB6 A;  4A0C D;  4A4B A;  3N9O A;  3ZYQ A;  2G45 A;  3N9M A;  4YC9 A;  2YSM A;  2LV9 A;  1WES A;  2RI7 A;  4GNE A;  1N87 A;  4YAB A;  3O70 A;  2CKL B;  2KU3 A;  5H1T A;  5TAB A;  2LXP C;  1WEV A;  2LGG A;  5DIN A;  3KQI A;  5G0F A;  4GND A;  4QF2 A;  3U5M A;  4YAX A;  1X4I A;  4WZ2 A;  1WEM A;  1WGM A;  3DQV R;  3N9N A;  2MNY A;  3PHD A;  1HYI A;  4A49 A;  4AP4 A;  4BHW A;  4UP5 A;  3ZTG A;  5J3X A;  1X4J A;  3O36 A;  1U6G B;  4WZ3 B;  2CT2 A;  2L43 A;  5KH3 A;  4Q6F A;  2EOD A;  5FER A;  2D8S A;  3O35 A;  5B8D A;  1XWH A;  2OXQ C;  5LKZ A;  2KGG A;  2KRE A;  2ECJ A;  3C6W A;  2E6S A;  3M63 A;  1JOC A;  4S3O C;  2M85 A;  3LQJ A;  5B76 A;  3PUQ A;  1HYJ A;  4YBS A;  4X3G A;  2XB1 A;  5H1V A;  2XEU A;  4R7E A;  3U5N A;  5FEY A;  4AVX A;  2K16 A;  2ECW A;  1CHC A;  1WEW A;  4FK5 A;  2C2V S;  4WA6 A;  2KYU A;  5JG6 A;  4LKA A; 
#chains in the Genus database with same CATH topology
 2ECN A;  3O37 A;  3O47 A;  2IQJ A;  4Z0O A;  2Y43 A;  2RSD A;  2M6M A;  4NN2 A;  4ZDT A;  3HTK C;  4YBM A;  2UZG A;  1G25 A;  3MHH A;  1FBV A;  3N9Q A;  1WEN A;  3U5P A;  3C5K A;  3MDB C;  2LGK A;  1FP0 A;  1WEP A;  3O33 A;  4YAT A;  1X4U A;  3L1X A;  2BAY A;  3N9L A;  2VNF A;  4MSX A;  1LDK C;  3KV5 A;  4LK9 A;  2G6Q A;  2M3H A;  2YUC A;  2RR4 A;  4PPE A;  3PUR A;  3LQH A;  4LLB A;  1WEE A;  3QZV A;  2YU4 A;  2YUR A;  2FD4 A;  1WEU A;  1ZBD B;  3PLW A;  4GNF A;  4ZQL A;  5EYA F;  2Y1N A;  3DDT A;  4GNG A;  4I7B A;  3T9K A;  3EB5 A;  2JUN A;  2OWA A;  5KH7 A;  3LRQ A;  2L75 A;  3ASL A;  3LVR E;  2EGP A;  4XI1 A;  3M7K A;  3L1Z B;  3Q1D A;  2MKE A;  4QF3 A;  2VJE B;  3KNV A;  1WFK A;  2MD8 C;  5B77 A;  4O62 A;  2YHN A;  2VJF B;  2YRE A;  3KDE C;  3O7A A;  2L0B A;  5FB1 A;  2XOZ A;  5AIU A;  3T6R A;  3IHP A;  1T1H A;  5H9M A;  2I50 A;  5C13 A;  2CSY A;  2LDR A;  5AIT A;  2XP0 A;  2JRJ A;  4P5O B;  3ZNI A;  3GV4 A;  3ZVY A;  4C9Z A;  4AUQ B;  2L5U A;  4FO9 A;  4A4C A;  4ZUX U;  1WIM A;  1BOR A;  1VFY A;  3HCU A;  3HCS A;  2CSZ A;  2M13 A;  2QIZ A;  5SVY A;  2K1J A;  4FJC A;  2VP7 A;  3HCT A;  5B79 A;  2YSJ A;  2CKL A;  2EXU A;  1WIL A;  1WEQ A;  2FFW A;  2F6N A;  2VPB A;  4LAD B;  3E2D A;  2E6R A;  3H7H A;  4IC2 A;  4OGE A;  1Z6U A;  2KWN A;  1RMD A;  1WEO A;  3DWD A;  2ZET C;  1MM3 A;  4L58 A;  3SHB A;  5FB0 A;  1V87 A;  4I7C A;  2F6J A;  4I7D A;  2MA6 A;  5SVI A;  3JUE A;  2LGV A;  2YQM A;  2IDA A;  1WE9 A;  2MUM A;  2LQ6 A;  2MIQ A;  5KH9 A;  4V3L C;  2VPG A;  2YHO A;  2KFT A;  2KGI A;  1F62 A;  4H9D A;  4UP0 A;  2LN0 A;  3DPL R;  4FIP A;  2FUI A;  2LRI C;  2H0D A;  1LDJ B;  5D1M B;  5DKA A;  2JM3 A;  2KWK A;  3V43 A;  2KKY A;  3RTR B;  2ECG A;  2ECT A;  4TKP B;  5D1K B;  2MD7 B;  5C11 A;  2C2L A;  2ECI A;  1Z60 A;  2M1R A;  2YQL A;  5TDR A;  4F52 B;  2LAU A;  2JMI A;  2KWO A;  4N4F A;  2FUU A;  2LGL A;  4V3K C;  2KR4 A;  4LJN A;  2HYE D;  4IC3 A;  5TBN A;  3N9P A;  2YW8 A;  4AYC A;  3FM8 C;  4N3W A;  3NG2 A;  2PNX A;  3ZPV E;  4B7Y C;  2QIC A;  1DVP A;  4MVT A;  4YBT A;  3KV6 A;  3GL6 A;  4O64 A;  3ZPV 1;  2MT5 A;  2VPD A;  2YYR A;  2G43 A;  5D1L B;  5I3L A;  2ECV A;  3M62 A;  1JM7 A;  3I2D A;  2CSV A;  1K2F A;  4CCG X;  2CON A;  1VD4 A;  5K3Q A;  4WZ0 A;  2CRR A;  3SUB A;  2F42 A;  5LKU A;  2KWJ A;  2L7P A;  2MA5 A;  3RPG C;  2AN6 A;  3SOX A;  3RPG B;  2H0D B;  2KIZ A;  1E4U A;  2B0O E;  5TDW A;  3LQI A;  4S3O B;  2LXH C;  3M99 A;  4QQ4 A;  4BBQ A;  3FL2 A;  4R2Y A;  2VPE A;  3SOU A;  3ZVZ B;  4R8P K;  2CRW A;  2P57 A;  1Z2Q A;  2VJE A;  3VK6 A;  5LKT A;  2JMJ A;  2K4D A;  2JMD A;  2VJF A;  3O34 A;  5B75 A;  3U5O A;  2PUY A;  2HDP A;  2E61 A;  1MM2 A;  2NAA A;  1VYX A;  2KKX A;  5H1U A;  3T7L A;  2DX8 A;  3FAO A;  4AYC B;  2FSA A;  4YAD A;  5TRB A;  5LKX A;  2QJ0 A;  4W4U A;  1IYM A;  5B78 A;  2MNZ A;  4UI9 B;  2YT5 A;  5SVX A;  3L11 A;  3SOW A;  3MHS A;  5G05 B;  4PTB A;  4L7X A;  5G04 B;  2KE1 A;  5LCW B;  4B86 C;  2EA6 A;  4CA1 A;  2Y1M A;  2L80 A;  2K17 A;  1JM7 B;  4GB0 A;  3EB6 A;  4A0C D;  4A4B A;  3N9O A;  3ZYQ A;  2G45 A;  3N9M A;  4YC9 A;  3LJU X;  2YSM A;  2LV9 A;  1WES A;  2RI7 A;  4GNE A;  1N87 A;  2EGM A;  2YVR A;  4YAB A;  3O70 A;  2CKL B;  2KU3 A;  3FJU B;  5H1T A;  5TAB A;  1MBM A;  2LXP C;  1WEV A;  2LGG A;  5DIN A;  3KQI A;  1DCQ A;  5G0F A;  4GND A;  4QF2 A;  3FAN A;  3U5M A;  4YAX A;  1X4I A;  4WZ2 A;  1WEM A;  1WGM A;  3DQV R;  3N9N A;  2MNY A;  3PHD A;  1HYI A;  5SVI B;  4A49 A;  4AP4 A;  4BHW A;  4UP5 A;  3ZTG A;  5J3X A;  4Z0R A;  1X4J A;  3O36 A;  1U6G B;  4WZ3 B;  2DJA A;  2CT2 A;  2L43 A;  5KH3 A;  4Q6F A;  2EOD A;  5FER A;  2D8S A;  3O35 A;  4OGC A;  2D8U A;  3FEH A;  5B8D A;  1XWH A;  2OXQ C;  5LKZ A;  2KGG A;  2KRE A;  2ECJ A;  3C6W A;  2E6S A;  3M63 A;  1JOC A;  4S3O C;  2M85 A;  3LQJ A;  5B76 A;  3PUQ A;  1HYJ A;  4YBS A;  4X3G A;  2XB1 A;  5H1V A;  2XEU A;  2XOY A;  2XOC A;  4R7E A;  3U5N A;  5FEY A;  4AVX A;  2K16 A;  2ECW A;  1CHC A;  1WEW A;  4FK5 A;  3LVQ E;  2C2V S;  4WA6 A;  2KYU A;  3LDY A;  5JG6 A;  4F1P A;  4LKA A;  2DSM A; 
#chains in the Genus database with same CATH homology
 2ECN A;  3O37 A;  2Y43 A;  2RSD A;  2M6M A;  4NN2 A;  4ZDT A;  3HTK C;  4YBM A;  2UZG A;  1G25 A;  3MHH A;  1FBV A;  3N9Q A;  1WEN A;  3U5P A;  3C5K A;  2LGK A;  1FP0 A;  1WEP A;  3O33 A;  4YAT A;  1X4U A;  3L1X A;  2BAY A;  3N9L A;  2VNF A;  4MSX A;  1LDK C;  3KV5 A;  4LK9 A;  2G6Q A;  2M3H A;  2YUC A;  4PPE A;  3PUR A;  3LQH A;  4LLB A;  1WEE A;  3QZV A;  2YU4 A;  2YUR A;  1WEU A;  1ZBD B;  4GNF A;  4ZQL A;  5EYA F;  2Y1N A;  4GNG A;  4I7B A;  3EB5 A;  5KH7 A;  3LRQ A;  2L75 A;  3ASL A;  2EGP A;  4XI1 A;  3L1Z B;  4QF3 A;  2VJE B;  3KNV A;  1WFK A;  2MD8 C;  5B77 A;  2YHN A;  2VJF B;  2YRE A;  3O7A A;  2L0B A;  5FB1 A;  5AIU A;  3T6R A;  3IHP A;  1T1H A;  5H9M A;  2I50 A;  5C13 A;  2CSY A;  2LDR A;  5AIT A;  2JRJ A;  4P5O B;  3ZNI A;  3GV4 A;  3ZVY A;  4C9Z A;  4AUQ B;  2L5U A;  4FO9 A;  4A4C A;  4ZUX U;  1WIM A;  1BOR A;  1VFY A;  3HCU A;  3HCS A;  2CSZ A;  2QIZ A;  2K1J A;  4FJC A;  2VP7 A;  3HCT A;  5B79 A;  2YSJ A;  2CKL A;  1WIL A;  1WEQ A;  2VPB A;  2F6N A;  4LAD B;  2E6R A;  4IC2 A;  1Z6U A;  2KWN A;  1RMD A;  1WEO A;  2ZET C;  1MM3 A;  4L58 A;  3SHB A;  5FB0 A;  1V87 A;  4I7C A;  2F6J A;  4I7D A;  2MA6 A;  2LGV A;  2YQM A;  2IDA A;  1WE9 A;  2MUM A;  2LQ6 A;  2MIQ A;  5KH9 A;  4V3L C;  2VPG A;  2YHO A;  2KFT A;  2KGI A;  1F62 A;  4UP0 A;  2LN0 A;  3DPL R;  2FUI A;  4FIP A;  2LRI C;  2H0D A;  1LDJ B;  5D1M B;  5DKA A;  2KWK A;  3V43 A;  3RTR B;  2ECG A;  2ECT A;  4TKP B;  5D1K B;  2MD7 B;  5C11 A;  2C2L A;  2ECI A;  1Z60 A;  2M1R A;  2YQL A;  5TDR A;  4F52 B;  2JMI A;  2KWO A;  4N4F A;  2FUU A;  2LGL A;  4V3K C;  2KR4 A;  4LJN A;  2HYE D;  4IC3 A;  5TBN A;  3N9P A;  2YW8 A;  4AYC A;  4N3W A;  3NG2 A;  2PNX A;  3ZPV E;  4B7Y C;  2QIC A;  1DVP A;  4MVT A;  4YBT A;  3KV6 A;  3GL6 A;  4O64 A;  3ZPV 1;  2MT5 A;  2VPD A;  2YYR A;  2G43 A;  5D1L B;  5I3L A;  2ECV A;  3M62 A;  1JM7 A;  3I2D A;  1K2F A;  4CCG X;  1VD4 A;  4WZ0 A;  2F42 A;  5LKU A;  2KWJ A;  2MA5 A;  3RPG C;  2AN6 A;  3SOX A;  3RPG B;  2H0D B;  2KIZ A;  1E4U A;  5TDW A;  3LQI A;  4S3O B;  2LXH C;  3M99 A;  4BBQ A;  3FL2 A;  4R2Y A;  2VPE A;  3SOU A;  3ZVZ B;  4R8P K;  1Z2Q A;  2VJE A;  3VK6 A;  5LKT A;  2JMJ A;  2K4D A;  2JMD A;  2VJF A;  3O34 A;  5B75 A;  3U5O A;  2PUY A;  2HDP A;  1MM2 A;  2NAA A;  1VYX A;  5H1U A;  3T7L A;  2DX8 A;  4AYC B;  2FSA A;  4YAD A;  5TRB A;  5LKX A;  2QJ0 A;  4W4U A;  1IYM A;  5B78 A;  2MNZ A;  4UI9 B;  2YT5 A;  3L11 A;  3SOW A;  3MHS A;  5G05 B;  4PTB A;  4L7X A;  5G04 B;  2KE1 A;  5LCW B;  4B86 C;  2EA6 A;  4CA1 A;  2Y1M A;  2L80 A;  2K17 A;  1JM7 B;  4GB0 A;  3EB6 A;  4A0C D;  4A4B A;  3N9O A;  3ZYQ A;  2G45 A;  3N9M A;  4YC9 A;  2YSM A;  2LV9 A;  1WES A;  2RI7 A;  4GNE A;  1N87 A;  4YAB A;  3O70 A;  2CKL B;  2KU3 A;  5H1T A;  5TAB A;  2LXP C;  1WEV A;  2LGG A;  5DIN A;  3KQI A;  5G0F A;  4GND A;  4QF2 A;  3U5M A;  4YAX A;  1X4I A;  4WZ2 A;  1WEM A;  1WGM A;  3DQV R;  3N9N A;  2MNY A;  3PHD A;  1HYI A;  4A49 A;  4AP4 A;  4BHW A;  4UP5 A;  3ZTG A;  5J3X A;  1X4J A;  3O36 A;  1U6G B;  4WZ3 B;  2CT2 A;  2L43 A;  5KH3 A;  4Q6F A;  2EOD A;  5FER A;  2D8S A;  3O35 A;  5B8D A;  1XWH A;  2OXQ C;  5LKZ A;  2KGG A;  2KRE A;  2ECJ A;  3C6W A;  2E6S A;  3M63 A;  1JOC A;  4S3O C;  2M85 A;  3LQJ A;  5B76 A;  3PUQ A;  1HYJ A;  4YBS A;  4X3G A;  2XB1 A;  5H1V A;  2XEU A;  4R7E A;  3U5N A;  5FEY A;  4AVX A;  2K16 A;  2ECW A;  1CHC A;  1WEW A;  4FK5 A;  2C2V S;  4WA6 A;  2KYU A;  5JG6 A;  4LKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...