2MT5A

Isolated ring domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Anaphase-promoting complex subunit 11
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mt5A00
4R8PK 2L75A 5G04B 2LXPC 5I3LA 1WE9A 2YQLA 1ZBDB 4CA1A 2OXQC 2I50A 3SHBA 4WZ2A 3LQIA 2VNFA 3ZPV1 4S3OC 4IC3A 3DQVR 1RMDA 4FK5A 3M63A 3KNVA 5FERA 1IYMA 3N9PA 4C9ZA 2VPDA 2KWOA 5J3XA 4LJNA 4YABA 2AN6A 5H1VA 3LRQA 1WEWA 2ECWA 2G45A 2YREA 1WESA 2YURA 2ECJA 1E4UA 4L58A 3N9QA 2CKLA 3L1ZB 3N9MA 5G0FA 1CHCA 1WEMA 5DKAA 2VPEA 3N9OA 2M6MA 1JM7A 1XWHA 4UP0A 2QJ0A 1LDJB 2QICA 2KGIA 5H1TA 3IHPA 4MSXA 2F6JA 5LKTA 2UZGA 2D8SA 1X4UA 2G43A 3O70A 5H9MA 1WILA 2VP7A 4FJCA 4BBQA 5EYAF 3EB6A 4CCGX 1VFYA 4F52B 1LDKC 2HDPA 3FL2A 3HCSA 3ZVZB 1HYIA 2Y1MA 3ZVYA 5JG6A 2LXHC 3U5MA 1WGMA 2M3HA 5B78A 1WEUA 4MVTA 4N3WA 2LRIC 5DINA 1F62A 4IC2A 5TRBA 5TDRA 2Y43A 4X3GA 2L0BA 3C5KA 4B7YC 4O64A 4GNGA 2CSZA 3O34A 3I2DA 3LQHA 3SOXA 2RSDA 2IDAA 2YHNA 3KV5A 4R7EA 5D1MB 2MUMA 4YBTA 1X4JA 4I7BA 2E6SA 4PTBA 2MD7B 1WENA 2VJEB 2E6RA 4WZ3B 5KH3A 4L7XA 4I7CA 4LKAA 3KV6A 5LKXA 2F42A 5B75A 2CT2A 4YAXA 4A4CA 3U5PA 1WEQA 2LGLA 3M62A 4A0CD 2MIQA 2EA6A 2LN0A 2NAAA 2YU4A 3N9LA 1WFKA 4YADA 2PUYA 2LGGA 3PHDA 5LKZA 3L1XA 2L5UA 2H0DA 5TBNA 3NG2A 3O7AA 4V3KC 5LCWB 4ZDTA 2YT5A 2L80A 2JRJA 2YYRA 2ECVA 2MNZA 2KFTA 2QIZA 2LQ6A 3MHHA 3ZNIA 5C13A 2KWKA 2ECTA 3DPLR 2VJEA 4S3OB 4AP4A 5AITA 5D1LB 2MA5A 5FEYA 4LADB 3L11A 3VK6A 4A49A 2JMJA 1DVPA 4A4BA 2K16A 4AYCB 3KQIA 1Z6UA 4UI9B 2MA6A 3ASLA 2MD8C 2YW8A 5B8DA 2KU3A 4WZ0A 2XB1A 2H0DB 2DX8A 3HCTA 2F6NA 3HTKC 4I7DA 4GNFA 3RPGC 2KE1A 2K4DA 4NN2A 4GNDA 1MM2A 2FSAA 4LK9A 1V87A 1JOCA 1T1HA 4ZUXU 1BORA 1VD4A 1WIMA 4YBSA 2M1RA 1FP0A 4Q6FA 3MHSA 2FUUA 4ZQLA 1WEVA 3ZTGA 4P5OB 3GL6A 3O36A 4AYCA 1VYXA 3QZVA 5D1KB 5B79A 2YSJA 4GB0A 2EODA 2ECNA 2M85A 4TKPB 5TABA 3O37A 2ECGA 2RI7A 4GNEA 2LGVA 2JMIA 1Z60A 4FIPA 4W4UA 5KH7A 3C6WA 3PUQA 1WEEA 3SOWA 2MNYA 1N87A 3RPGB 2C2VS 1X4IA 2HYED 2YSMA 2VJFA 5B77A 5FB1A 2YQMA 2ZETC 1WEPA 3O35A 4UP5A 1K2FA 3M99A 3PURA 5TDWA 2K17A 3O33A 5KH9A 4PPEA 2YUCA 4WA6A 2KGGA 3V43A 4AUQB 3U5NA 4YC9A 5B76A 4QF3A 2LGKA 3EB5A 2FUIA 3LQJA 3T6RA 2KR4A 4XI1A 4FO9A 2CSYA 2G6QA 2KWNA 2KYUA 3SOUA 1FBVA 4YATA 2JMDA 5FB0A 1MM3A 3N9NA 2YHOA 5LKUA 2BAYA 3GV4A 2K1JA 2PNXA 1U6GB 2KIZA 2MT5A 2Y1NA 2L43A 2ECIA 3HCUA 4V3LC 3U5OA 1Z2QA 4N4FA 1HYJA 3ZYQA 2C2LA 2KREA 3T7LA 4R2YA 2LDRA 5H1UA 2KWJA 3RTRB 2VJFB 4BHWA 2XEUA 1G25A 2CKLB 2LV9A 5C11A 4AVXA 2VPBA 5G05B 3ZPVE 2EGPA 4LLBA 4YBMA 4B86C 2VPGA 1WEOA 1JM7B 5AIUA 4QF2A
chains in the Genus database with same CATH superfamily
4R8PK 3FAOA 2L75A 5G04B 3MDBC 2LXPC 3DDTA 5I3LA 1WE9A 2YQLA 1ZBDB 5SVIB 4CA1A 2OXQC 2I50A 3SHBA 4WZ2A 3LQIA 2M13A 3LVRE 2VNFA 3ZPV1 4S3OC 4IC3A 3DQVR 1RMDA 2CRWA 4FK5A 2OWAA 3M63A 3KNVA 5FERA 1IYMA 3N9PA 4C9ZA 2VPDA 2KWOA 5J3XA 4LJNA 3T9KA 4YABA 2AN6A 5H1VA 3LRQA 4Z0OA 1WEWA 2ECWA 2G45A 2YREA 1WESA 2YURA 2ECJA 1E4UA 4L58A 3N9QA 2CKLA 3L1ZB 2IQJA 3N9MA 5G0FA 1CHCA 1WEMA 5DKAA 2VPEA 3N9OA 3Q1DA 2M6MA 1JM7A 1XWHA 4UP0A 2QJ0A 1LDJB 2CRRA 2KGIA 2QICA 5H1TA 3IHPA 4MSXA 2F6JA 4F1PA 5LKTA 2UZGA 2D8SA 1X4UA 2G43A 2XOCA 2FFWA 3O70A 5H9MA 1WILA 2VP7A 4FJCA 2L7PA 4BBQA 5EYAF 3EB6A 4CCGX 1VFYA 4F52B 1LDKC 2HDPA 3FL2A 3HCSA 3LJUX 3ZVZB 1HYIA 4QQ4A 2Y1MA 3ZVYA 2E61A 5JG6A 2LXHC 1WGMA 3U5MA 2M3HA 5B78A 1WEUA 4MVTA 4N3WA 3SUBA 2LRIC 5DINA 1F62A 4IC2A 5TRBA 5TDRA 2D8UA 3PLWA 2Y43A 4X3GA 2L0BA 2XP0A 3C5KA 4B7YC 4O64A 2DJAA 4GNGA 2CSZA 3O34A 3I2DA 3LQHA 3SOXA 2RSDA 3LVQE 2IDAA 3FJUB 2YHNA 3KV5A 3FEHA 4R7EA 5D1MB 2JUNA 2MUMA 4YBTA 1X4JA 4I7BA 2E6SA 4PTBA 2MD7B 1WENA 2VJEB 2E6RA 4WZ3B 5KH3A 2EGMA 3KDEC 4L7XA 2LAUA 2CONA 4I7CA 4LKAA 3KV6A 5LKXA 2F42A 5B75A 2CT2A 4YAXA 4A4CA 3U5PA 1WEQA 2LGLA 3M62A 4A0CD 2MIQA 2EA6A 2LN0A 2NAAA 2YU4A 3N9LA 1WFKA 4YADA 4Z0RA 2PUYA 4H9DA 2LGGA 3PHDA 5LKZA 3L1XA 2XOYA 2L5UA 2H0DA 5TBNA 3LDYA 3NG2A 3O7AA 4V3KC 5LCWB 4ZDTA 2YT5A 1MBMA 2L80A 2JRJA 2YYRA 2ECVA 2MNZA 2KFTA 2QIZA 2LQ6A 3MHHA 3ZNIA 5C13A 2KWKA 2ECTA 3DPLR 2VJEA 2B0OE 4S3OB 4AP4A 5AITA 5D1LB 2MA5A 3H7HA 5FEYA 4LADB 3L11A 3VK6A 4A49A 5SVYA 2JMJA 1DVPA 4A4BA 2K16A 4AYCB 3KQIA 3JUEA 1Z6UA 4UI9B 2MA6A 3ASLA 2MD8C 2YW8A 5B8DA 2KU3A 4WZ0A 3M7KA 2XB1A 2H0DB 2DX8A 2MKEA 3HCTA 2F6NA 3HTKC 4I7DA 4GNFA 3RPGC 2KE1A 2K4DA 4NN2A 4GNDA 1MM2A 2FSAA 4O62A 4LK9A 1V87A 1JOCA 1T1HA 4ZUXU 1BORA 1VD4A 1WIMA 4OGEA 4YBSA 2M1RA 1FP0A 4Q6FA 3MHSA 2RR4A 2FUUA 4ZQLA 1WEVA 3ZTGA 4P5OB 3GL6A 3O36A 4AYCA 1VYXA 3QZVA 5D1KB 5B79A 2YSJA 2DSMA 4GB0A 2EODA 2ECNA 2M85A 3FANA 4TKPB 3O37A 5TABA 2ECGA 2RI7A 4GNEA 2LGVA 2JMIA 3O47A 1Z60A 2P57A 4FIPA 4W4UA 5KH7A 3C6WA 2CSVA 1WEEA 3PUQA 2MNYA 1N87A 3SOWA 3RPGB 2C2VS 1X4IA 2HYED 2YSMA 2VJFA 5B77A 5FB1A 2YQMA 2ZETC 3FM8C 1WEPA 3DWDA 3O35A 4UP5A 1K2FA 3M99A 3PURA 5TDWA 2K17A 3O33A 5KH9A 4PPEA 2YUCA 4WA6A 2KGGA 3V43A 4AUQB 3U5NA 4OGCA 4YC9A 5B76A 4QF3A 2LGKA 3EB5A 2FUIA 3LQJA 2JM3A 2KKYA 5SVIA 3T6RA 2KR4A 4XI1A 2YVRA 4FO9A 2CSYA 2G6QA 2KWNA 2KYUA 3SOUA 1FBVA 4YATA 2JMDA 5FB0A 1MM3A 2XOZA 3N9NA 2YHOA 5LKUA 5SVXA 2BAYA 3GV4A 2K1JA 2PNXA 1U6GB 2KIZA 2MT5A 2Y1NA 2L43A 2FD4A 2ECIA 2EXUA 3HCUA 4V3LC 3U5OA 1Z2QA 4N4FA 1HYJA 3ZYQA 2C2LA 1DCQA 2KREA 3T7LA 4R2YA 2LDRA 5H1UA 2KWJA 3RTRB 2VJFB 4BHWA 2XEUA 1G25A 2CKLB 2LV9A 5C11A 4AVXA 3E2DA 2VPBA 2KKXA 5G05B 3ZPVE 2EGPA 4LLBA 4YBMA 4B86C 2VPGA 5K3QA 1WEOA 1JM7B 5AIUA 4QF2A
chains in the Genus database with same CATH topology
4R8PK 2L75A 5G04B 2LXPC 5I3LA 1WE9A 2YQLA 1ZBDB 4CA1A 2OXQC 2I50A 3SHBA 4WZ2A 3LQIA 2VNFA 3ZPV1 4S3OC 4IC3A 3DQVR 1RMDA 4FK5A 3M63A 3KNVA 5FERA 1IYMA 3N9PA 4C9ZA 2VPDA 2KWOA 5J3XA 4LJNA 4YABA 2AN6A 5H1VA 3LRQA 1WEWA 2ECWA 2G45A 2YREA 1WESA 2YURA 2ECJA 1E4UA 4L58A 3N9QA 2CKLA 3L1ZB 3N9MA 5G0FA 1CHCA 1WEMA 5DKAA 2VPEA 3N9OA 2M6MA 1JM7A 1XWHA 4UP0A 2QJ0A 1LDJB 2QICA 2KGIA 5H1TA 3IHPA 4MSXA 2F6JA 5LKTA 2UZGA 2D8SA 1X4UA 2G43A 3O70A 5H9MA 1WILA 2VP7A 4FJCA 4BBQA 5EYAF 3EB6A 4CCGX 1VFYA 4F52B 1LDKC 2HDPA 3FL2A 3HCSA 3ZVZB 1HYIA 2Y1MA 3ZVYA 5JG6A 2LXHC 3U5MA 1WGMA 2M3HA 5B78A 1WEUA 4MVTA 4N3WA 2LRIC 5DINA 1F62A 4IC2A 5TRBA 5TDRA 2Y43A 4X3GA 2L0BA 3C5KA 4B7YC 4O64A 4GNGA 2CSZA 3O34A 3I2DA 3LQHA 3SOXA 2RSDA 2IDAA 2YHNA 3KV5A 4R7EA 5D1MB 2MUMA 4YBTA 1X4JA 4I7BA 2E6SA 4PTBA 2MD7B 1WENA 2VJEB 2E6RA 4WZ3B 5KH3A 4L7XA 4I7CA 4LKAA 3KV6A 5LKXA 2F42A 5B75A 2CT2A 4YAXA 4A4CA 3U5PA 1WEQA 2LGLA 3M62A 4A0CD 2MIQA 2EA6A 2LN0A 2NAAA 2YU4A 3N9LA 1WFKA 4YADA 2PUYA 2LGGA 3PHDA 5LKZA 3L1XA 2L5UA 2H0DA 5TBNA 3NG2A 3O7AA 4V3KC 5LCWB 4ZDTA 2YT5A 2L80A 2JRJA 2YYRA 2ECVA 2MNZA 2KFTA 2QIZA 2LQ6A 3MHHA 3ZNIA 5C13A 2KWKA 2ECTA 3DPLR 2VJEA 4S3OB 4AP4A 5AITA 5D1LB 2MA5A 5FEYA 4LADB 3L11A 3VK6A 4A49A 2JMJA 1DVPA 4A4BA 2K16A 4AYCB 3KQIA 1Z6UA 4UI9B 2MA6A 3ASLA 2MD8C 2YW8A 5B8DA 2KU3A 4WZ0A 2XB1A 2H0DB 2DX8A 3HCTA 2F6NA 3HTKC 4I7DA 4GNFA 3RPGC 2KE1A 2K4DA 4NN2A 4GNDA 1MM2A 2FSAA 4LK9A 1V87A 1JOCA 1T1HA 4ZUXU 1BORA 1VD4A 1WIMA 4YBSA 2M1RA 1FP0A 4Q6FA 3MHSA 2FUUA 4ZQLA 1WEVA 3ZTGA 4P5OB 3GL6A 3O36A 4AYCA 1VYXA 3QZVA 5D1KB 5B79A 2YSJA 4GB0A 2EODA 2ECNA 2M85A 4TKPB 5TABA 3O37A 2ECGA 2RI7A 4GNEA 2LGVA 2JMIA 1Z60A 4FIPA 4W4UA 5KH7A 3C6WA 3PUQA 1WEEA 3SOWA 2MNYA 1N87A 3RPGB 2C2VS 1X4IA 2HYED 2YSMA 2VJFA 5B77A 5FB1A 2YQMA 2ZETC 1WEPA 3O35A 4UP5A 1K2FA 3M99A 3PURA 5TDWA 2K17A 3O33A 5KH9A 4PPEA 2YUCA 4WA6A 2KGGA 3V43A 4AUQB 3U5NA 4YC9A 5B76A 4QF3A 2LGKA 3EB5A 2FUIA 3LQJA 3T6RA 2KR4A 4XI1A 4FO9A 2CSYA 2G6QA 2KWNA 2KYUA 3SOUA 1FBVA 4YATA 2JMDA 5FB0A 1MM3A 3N9NA 2YHOA 5LKUA 2BAYA 3GV4A 2K1JA 2PNXA 1U6GB 2KIZA 2MT5A 2Y1NA 2L43A 2ECIA 3HCUA 4V3LC 3U5OA 1Z2QA 4N4FA 1HYJA 3ZYQA 2C2LA 2KREA 3T7LA 4R2YA 2LDRA 5H1UA 2KWJA 3RTRB 2VJFB 4BHWA 2XEUA 1G25A 2CKLB 2LV9A 5C11A 4AVXA 2VPBA 5G05B 3ZPVE 2EGPA 4LLBA 4YBMA 4B86C 2VPGA 1WEOA 1JM7B 5AIUA 4QF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P K;  2L75 A;  5G04 B;  2LXP C;  5I3L A;  1WE9 A;  2YQL A;  1ZBD B;  4CA1 A;  2OXQ C;  2I50 A;  3SHB A;  4WZ2 A;  3LQI A;  2VNF A;  3ZPV 1;  4S3O C;  4IC3 A;  3DQV R;  1RMD A;  4FK5 A;  3M63 A;  3KNV A;  5FER A;  1IYM A;  3N9P A;  4C9Z A;  2VPD A;  2KWO A;  5J3X A;  4LJN A;  4YAB A;  2AN6 A;  5H1V A;  3LRQ A;  1WEW A;  2ECW A;  2G45 A;  2YRE A;  1WES A;  2YUR A;  2ECJ A;  1E4U A;  4L58 A;  3N9Q A;  2CKL A;  3L1Z B;  3N9M A;  5G0F A;  1CHC A;  1WEM A;  5DKA A;  2VPE A;  3N9O A;  2M6M A;  1JM7 A;  1XWH A;  4UP0 A;  2QJ0 A;  1LDJ B;  2QIC A;  2KGI A;  5H1T A;  3IHP A;  4MSX A;  2F6J A;  5LKT A;  2UZG A;  2D8S A;  1X4U A;  2G43 A;  3O70 A;  5H9M A;  1WIL A;  2VP7 A;  4FJC A;  4BBQ A;  5EYA F;  3EB6 A;  4CCG X;  1VFY A;  4F52 B;  1LDK C;  2HDP A;  3FL2 A;  3HCS A;  3ZVZ B;  1HYI A;  2Y1M A;  3ZVY A;  5JG6 A;  2LXH C;  3U5M A;  1WGM A;  2M3H A;  5B78 A;  1WEU A;  4MVT A;  4N3W A;  2LRI C;  5DIN A;  1F62 A;  4IC2 A;  5TRB A;  5TDR A;  2Y43 A;  4X3G A;  2L0B A;  3C5K A;  4B7Y C;  4O64 A;  4GNG A;  2CSZ A;  3O34 A;  3I2D A;  3LQH A;  3SOX A;  2RSD A;  2IDA A;  2YHN A;  3KV5 A;  4R7E A;  5D1M B;  2MUM A;  4YBT A;  1X4J A;  4I7B A;  2E6S A;  4PTB A;  2MD7 B;  1WEN A;  2VJE B;  2E6R A;  4WZ3 B;  5KH3 A;  4L7X A;  4I7C A;  4LKA A;  3KV6 A;  5LKX A;  2F42 A;  5B75 A;  2CT2 A;  4YAX A;  4A4C A;  3U5P A;  1WEQ A;  2LGL A;  3M62 A;  4A0C D;  2MIQ A;  2EA6 A;  2LN0 A;  2NAA A;  2YU4 A;  3N9L A;  1WFK A;  4YAD A;  2PUY A;  2LGG A;  3PHD A;  5LKZ A;  3L1X A;  2L5U A;  2H0D A;  5TBN A;  3NG2 A;  3O7A A;  4V3K C;  5LCW B;  4ZDT A;  2YT5 A;  2L80 A;  2JRJ A;  2YYR A;  2ECV A;  2MNZ A;  2KFT A;  2QIZ A;  2LQ6 A;  3MHH A;  3ZNI A;  5C13 A;  2KWK A;  2ECT A;  3DPL R;  2VJE A;  4S3O B;  4AP4 A;  5AIT A;  5D1L B;  2MA5 A;  5FEY A;  4LAD B;  3L11 A;  3VK6 A;  4A49 A;  2JMJ A;  1DVP A;  4A4B A;  2K16 A;  4AYC B;  3KQI A;  1Z6U A;  4UI9 B;  2MA6 A;  3ASL A;  2MD8 C;  2YW8 A;  5B8D A;  2KU3 A;  4WZ0 A;  2XB1 A;  2H0D B;  2DX8 A;  3HCT A;  2F6N A;  3HTK C;  4I7D A;  4GNF A;  3RPG C;  2KE1 A;  2K4D A;  4NN2 A;  4GND A;  1MM2 A;  2FSA A;  4LK9 A;  1V87 A;  1JOC A;  1T1H A;  4ZUX U;  1BOR A;  1VD4 A;  1WIM A;  4YBS A;  2M1R A;  1FP0 A;  4Q6F A;  3MHS A;  2FUU A;  4ZQL A;  1WEV A;  3ZTG A;  4P5O B;  3GL6 A;  3O36 A;  4AYC A;  1VYX A;  3QZV A;  5D1K B;  5B79 A;  2YSJ A;  4GB0 A;  2EOD A;  2ECN A;  2M85 A;  4TKP B;  5TAB A;  3O37 A;  2ECG A;  2RI7 A;  4GNE A;  2LGV A;  2JMI A;  1Z60 A;  4FIP A;  4W4U A;  5KH7 A;  3C6W A;  3PUQ A;  1WEE A;  3SOW A;  2MNY A;  1N87 A;  3RPG B;  2C2V S;  1X4I A;  2HYE D;  2YSM A;  2VJF A;  5B77 A;  5FB1 A;  2YQM A;  2ZET C;  1WEP A;  3O35 A;  4UP5 A;  1K2F A;  3M99 A;  3PUR A;  5TDW A;  2K17 A;  3O33 A;  5KH9 A;  4PPE A;  2YUC A;  4WA6 A;  2KGG A;  3V43 A;  4AUQ B;  3U5N A;  4YC9 A;  5B76 A;  4QF3 A;  2LGK A;  3EB5 A;  2FUI A;  3LQJ A;  3T6R A;  2KR4 A;  4XI1 A;  4FO9 A;  2CSY A;  2G6Q A;  2KWN A;  2KYU A;  3SOU A;  1FBV A;  4YAT A;  2JMD A;  5FB0 A;  1MM3 A;  3N9N A;  2YHO A;  5LKU A;  2BAY A;  3GV4 A;  2K1J A;  2PNX A;  1U6G B;  2KIZ A;  2MT5 A;  2Y1N A;  2L43 A;  2ECI A;  3HCU A;  4V3L C;  3U5O A;  1Z2Q A;  4N4F A;  1HYJ A;  3ZYQ A;  2C2L A;  2KRE A;  3T7L A;  4R2Y A;  2LDR A;  5H1U A;  2KWJ A;  3RTR B;  2VJF B;  4BHW A;  2XEU A;  1G25 A;  2CKL B;  2LV9 A;  5C11 A;  4AVX A;  2VPB A;  5G05 B;  3ZPV E;  2EGP A;  4LLB A;  4YBM A;  4B86 C;  2VPG A;  1WEO A;  1JM7 B;  5AIU A;  4QF2 A; 
#chains in the Genus database with same CATH topology
 4R8P K;  3FAO A;  2L75 A;  5G04 B;  3MDB C;  2LXP C;  3DDT A;  5I3L A;  1WE9 A;  2YQL A;  1ZBD B;  5SVI B;  4CA1 A;  2OXQ C;  2I50 A;  3SHB A;  4WZ2 A;  3LQI A;  2M13 A;  3LVR E;  2VNF A;  3ZPV 1;  4S3O C;  4IC3 A;  3DQV R;  1RMD A;  2CRW A;  4FK5 A;  2OWA A;  3M63 A;  3KNV A;  5FER A;  1IYM A;  3N9P A;  4C9Z A;  2VPD A;  2KWO A;  5J3X A;  4LJN A;  3T9K A;  4YAB A;  2AN6 A;  5H1V A;  3LRQ A;  4Z0O A;  1WEW A;  2ECW A;  2G45 A;  2YRE A;  1WES A;  2YUR A;  2ECJ A;  1E4U A;  4L58 A;  3N9Q A;  2CKL A;  3L1Z B;  2IQJ A;  3N9M A;  5G0F A;  1CHC A;  1WEM A;  5DKA A;  2VPE A;  3N9O A;  3Q1D A;  2M6M A;  1JM7 A;  1XWH A;  4UP0 A;  2QJ0 A;  1LDJ B;  2CRR A;  2KGI A;  2QIC A;  5H1T A;  3IHP A;  4MSX A;  2F6J A;  4F1P A;  5LKT A;  2UZG A;  2D8S A;  1X4U A;  2G43 A;  2XOC A;  2FFW A;  3O70 A;  5H9M A;  1WIL A;  2VP7 A;  4FJC A;  2L7P A;  4BBQ A;  5EYA F;  3EB6 A;  4CCG X;  1VFY A;  4F52 B;  1LDK C;  2HDP A;  3FL2 A;  3HCS A;  3LJU X;  3ZVZ B;  1HYI A;  4QQ4 A;  2Y1M A;  3ZVY A;  2E61 A;  5JG6 A;  2LXH C;  1WGM A;  3U5M A;  2M3H A;  5B78 A;  1WEU A;  4MVT A;  4N3W A;  3SUB A;  2LRI C;  5DIN A;  1F62 A;  4IC2 A;  5TRB A;  5TDR A;  2D8U A;  3PLW A;  2Y43 A;  4X3G A;  2L0B A;  2XP0 A;  3C5K A;  4B7Y C;  4O64 A;  2DJA A;  4GNG A;  2CSZ A;  3O34 A;  3I2D A;  3LQH A;  3SOX A;  2RSD A;  3LVQ E;  2IDA A;  3FJU B;  2YHN A;  3KV5 A;  3FEH A;  4R7E A;  5D1M B;  2JUN A;  2MUM A;  4YBT A;  1X4J A;  4I7B A;  2E6S A;  4PTB A;  2MD7 B;  1WEN A;  2VJE B;  2E6R A;  4WZ3 B;  5KH3 A;  2EGM A;  3KDE C;  4L7X A;  2LAU A;  2CON A;  4I7C A;  4LKA A;  3KV6 A;  5LKX A;  2F42 A;  5B75 A;  2CT2 A;  4YAX A;  4A4C A;  3U5P A;  1WEQ A;  2LGL A;  3M62 A;  4A0C D;  2MIQ A;  2EA6 A;  2LN0 A;  2NAA A;  2YU4 A;  3N9L A;  1WFK A;  4YAD A;  4Z0R A;  2PUY A;  4H9D A;  2LGG A;  3PHD A;  5LKZ A;  3L1X A;  2XOY A;  2L5U A;  2H0D A;  5TBN A;  3LDY A;  3NG2 A;  3O7A A;  4V3K C;  5LCW B;  4ZDT A;  2YT5 A;  1MBM A;  2L80 A;  2JRJ A;  2YYR A;  2ECV A;  2MNZ A;  2KFT A;  2QIZ A;  2LQ6 A;  3MHH A;  3ZNI A;  5C13 A;  2KWK A;  2ECT A;  3DPL R;  2VJE A;  2B0O E;  4S3O B;  4AP4 A;  5AIT A;  5D1L B;  2MA5 A;  3H7H A;  5FEY A;  4LAD B;  3L11 A;  3VK6 A;  4A49 A;  5SVY A;  2JMJ A;  1DVP A;  4A4B A;  2K16 A;  4AYC B;  3KQI A;  3JUE A;  1Z6U A;  4UI9 B;  2MA6 A;  3ASL A;  2MD8 C;  2YW8 A;  5B8D A;  2KU3 A;  4WZ0 A;  3M7K A;  2XB1 A;  2H0D B;  2DX8 A;  2MKE A;  3HCT A;  2F6N A;  3HTK C;  4I7D A;  4GNF A;  3RPG C;  2KE1 A;  2K4D A;  4NN2 A;  4GND A;  1MM2 A;  2FSA A;  4O62 A;  4LK9 A;  1V87 A;  1JOC A;  1T1H A;  4ZUX U;  1BOR A;  1VD4 A;  1WIM A;  4OGE A;  4YBS A;  2M1R A;  1FP0 A;  4Q6F A;  3MHS A;  2RR4 A;  2FUU A;  4ZQL A;  1WEV A;  3ZTG A;  4P5O B;  3GL6 A;  3O36 A;  4AYC A;  1VYX A;  3QZV A;  5D1K B;  5B79 A;  2YSJ A;  2DSM A;  4GB0 A;  2EOD A;  2ECN A;  2M85 A;  3FAN A;  4TKP B;  3O37 A;  5TAB A;  2ECG A;  2RI7 A;  4GNE A;  2LGV A;  2JMI A;  3O47 A;  1Z60 A;  2P57 A;  4FIP A;  4W4U A;  5KH7 A;  3C6W A;  2CSV A;  1WEE A;  3PUQ A;  2MNY A;  1N87 A;  3SOW A;  3RPG B;  2C2V S;  1X4I A;  2HYE D;  2YSM A;  2VJF A;  5B77 A;  5FB1 A;  2YQM A;  2ZET C;  3FM8 C;  1WEP A;  3DWD A;  3O35 A;  4UP5 A;  1K2F A;  3M99 A;  3PUR A;  5TDW A;  2K17 A;  3O33 A;  5KH9 A;  4PPE A;  2YUC A;  4WA6 A;  2KGG A;  3V43 A;  4AUQ B;  3U5N A;  4OGC A;  4YC9 A;  5B76 A;  4QF3 A;  2LGK A;  3EB5 A;  2FUI A;  3LQJ A;  2JM3 A;  2KKY A;  5SVI A;  3T6R A;  2KR4 A;  4XI1 A;  2YVR A;  4FO9 A;  2CSY A;  2G6Q A;  2KWN A;  2KYU A;  3SOU A;  1FBV A;  4YAT A;  2JMD A;  5FB0 A;  1MM3 A;  2XOZ A;  3N9N A;  2YHO A;  5LKU A;  5SVX A;  2BAY A;  3GV4 A;  2K1J A;  2PNX A;  1U6G B;  2KIZ A;  2MT5 A;  2Y1N A;  2L43 A;  2FD4 A;  2ECI A;  2EXU A;  3HCU A;  4V3L C;  3U5O A;  1Z2Q A;  4N4F A;  1HYJ A;  3ZYQ A;  2C2L A;  1DCQ A;  2KRE A;  3T7L A;  4R2Y A;  2LDR A;  5H1U A;  2KWJ A;  3RTR B;  2VJF B;  4BHW A;  2XEU A;  1G25 A;  2CKL B;  2LV9 A;  5C11 A;  4AVX A;  3E2D A;  2VPB A;  2KKX A;  5G05 B;  3ZPV E;  2EGP A;  4LLB A;  4YBM A;  4B86 C;  2VPG A;  5K3Q A;  1WEO A;  1JM7 B;  5AIU A;  4QF2 A; 
#chains in the Genus database with same CATH homology
 4R8P K;  2L75 A;  5G04 B;  2LXP C;  5I3L A;  1WE9 A;  2YQL A;  1ZBD B;  4CA1 A;  2OXQ C;  2I50 A;  3SHB A;  4WZ2 A;  3LQI A;  2VNF A;  3ZPV 1;  4S3O C;  4IC3 A;  3DQV R;  1RMD A;  4FK5 A;  3M63 A;  3KNV A;  5FER A;  1IYM A;  3N9P A;  4C9Z A;  2VPD A;  2KWO A;  5J3X A;  4LJN A;  4YAB A;  2AN6 A;  5H1V A;  3LRQ A;  1WEW A;  2ECW A;  2G45 A;  2YRE A;  1WES A;  2YUR A;  2ECJ A;  1E4U A;  4L58 A;  3N9Q A;  2CKL A;  3L1Z B;  3N9M A;  5G0F A;  1CHC A;  1WEM A;  5DKA A;  2VPE A;  3N9O A;  2M6M A;  1JM7 A;  1XWH A;  4UP0 A;  2QJ0 A;  1LDJ B;  2QIC A;  2KGI A;  5H1T A;  3IHP A;  4MSX A;  2F6J A;  5LKT A;  2UZG A;  2D8S A;  1X4U A;  2G43 A;  3O70 A;  5H9M A;  1WIL A;  2VP7 A;  4FJC A;  4BBQ A;  5EYA F;  3EB6 A;  4CCG X;  1VFY A;  4F52 B;  1LDK C;  2HDP A;  3FL2 A;  3HCS A;  3ZVZ B;  1HYI A;  2Y1M A;  3ZVY A;  5JG6 A;  2LXH C;  3U5M A;  1WGM A;  2M3H A;  5B78 A;  1WEU A;  4MVT A;  4N3W A;  2LRI C;  5DIN A;  1F62 A;  4IC2 A;  5TRB A;  5TDR A;  2Y43 A;  4X3G A;  2L0B A;  3C5K A;  4B7Y C;  4O64 A;  4GNG A;  2CSZ A;  3O34 A;  3I2D A;  3LQH A;  3SOX A;  2RSD A;  2IDA A;  2YHN A;  3KV5 A;  4R7E A;  5D1M B;  2MUM A;  4YBT A;  1X4J A;  4I7B A;  2E6S A;  4PTB A;  2MD7 B;  1WEN A;  2VJE B;  2E6R A;  4WZ3 B;  5KH3 A;  4L7X A;  4I7C A;  4LKA A;  3KV6 A;  5LKX A;  2F42 A;  5B75 A;  2CT2 A;  4YAX A;  4A4C A;  3U5P A;  1WEQ A;  2LGL A;  3M62 A;  4A0C D;  2MIQ A;  2EA6 A;  2LN0 A;  2NAA A;  2YU4 A;  3N9L A;  1WFK A;  4YAD A;  2PUY A;  2LGG A;  3PHD A;  5LKZ A;  3L1X A;  2L5U A;  2H0D A;  5TBN A;  3NG2 A;  3O7A A;  4V3K C;  5LCW B;  4ZDT A;  2YT5 A;  2L80 A;  2JRJ A;  2YYR A;  2ECV A;  2MNZ A;  2KFT A;  2QIZ A;  2LQ6 A;  3MHH A;  3ZNI A;  5C13 A;  2KWK A;  2ECT A;  3DPL R;  2VJE A;  4S3O B;  4AP4 A;  5AIT A;  5D1L B;  2MA5 A;  5FEY A;  4LAD B;  3L11 A;  3VK6 A;  4A49 A;  2JMJ A;  1DVP A;  4A4B A;  2K16 A;  4AYC B;  3KQI A;  1Z6U A;  4UI9 B;  2MA6 A;  3ASL A;  2MD8 C;  2YW8 A;  5B8D A;  2KU3 A;  4WZ0 A;  2XB1 A;  2H0D B;  2DX8 A;  3HCT A;  2F6N A;  3HTK C;  4I7D A;  4GNF A;  3RPG C;  2KE1 A;  2K4D A;  4NN2 A;  4GND A;  1MM2 A;  2FSA A;  4LK9 A;  1V87 A;  1JOC A;  1T1H A;  4ZUX U;  1BOR A;  1VD4 A;  1WIM A;  4YBS A;  2M1R A;  1FP0 A;  4Q6F A;  3MHS A;  2FUU A;  4ZQL A;  1WEV A;  3ZTG A;  4P5O B;  3GL6 A;  3O36 A;  4AYC A;  1VYX A;  3QZV A;  5D1K B;  5B79 A;  2YSJ A;  4GB0 A;  2EOD A;  2ECN A;  2M85 A;  4TKP B;  5TAB A;  3O37 A;  2ECG A;  2RI7 A;  4GNE A;  2LGV A;  2JMI A;  1Z60 A;  4FIP A;  4W4U A;  5KH7 A;  3C6W A;  3PUQ A;  1WEE A;  3SOW A;  2MNY A;  1N87 A;  3RPG B;  2C2V S;  1X4I A;  2HYE D;  2YSM A;  2VJF A;  5B77 A;  5FB1 A;  2YQM A;  2ZET C;  1WEP A;  3O35 A;  4UP5 A;  1K2F A;  3M99 A;  3PUR A;  5TDW A;  2K17 A;  3O33 A;  5KH9 A;  4PPE A;  2YUC A;  4WA6 A;  2KGG A;  3V43 A;  4AUQ B;  3U5N A;  4YC9 A;  5B76 A;  4QF3 A;  2LGK A;  3EB5 A;  2FUI A;  3LQJ A;  3T6R A;  2KR4 A;  4XI1 A;  4FO9 A;  2CSY A;  2G6Q A;  2KWN A;  2KYU A;  3SOU A;  1FBV A;  4YAT A;  2JMD A;  5FB0 A;  1MM3 A;  3N9N A;  2YHO A;  5LKU A;  2BAY A;  3GV4 A;  2K1J A;  2PNX A;  1U6G B;  2KIZ A;  2MT5 A;  2Y1N A;  2L43 A;  2ECI A;  3HCU A;  4V3L C;  3U5O A;  1Z2Q A;  4N4F A;  1HYJ A;  3ZYQ A;  2C2L A;  2KRE A;  3T7L A;  4R2Y A;  2LDR A;  5H1U A;  2KWJ A;  3RTR B;  2VJF B;  4BHW A;  2XEU A;  1G25 A;  2CKL B;  2LV9 A;  5C11 A;  4AVX A;  2VPB A;  5G05 B;  3ZPV E;  2EGP A;  4LLB A;  4YBM A;  4B86 C;  2VPG A;  1WEO A;  1JM7 B;  5AIU A;  4QF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...