2MT5A

Isolated ring domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 11
publication title Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mt5A00
2XEUA 2LGLA 3RPGC 3GL6A 2VJFB 4I7DA 3DQVR 2JMIA 2QJ0A 1WEOA 2M3HA 4R8PK 2YURA 4BBQA 4A4BA 2Y1NA 5C11A 2EODA 1VFYA 2KYUA 1E4UA 2KIZA 1WESA 2YSJA 3FL2A 3EB5A 3IHPA 5C13A 2VPEA 1CHCA 2YUCA 2EGPA 2ECTA 1WEUA 5D1MB 2C2VS 2IDAA 4WZ0A 1FP0A 1N87A 3T7LA 2D8SA 2VPGA 2KU3A 2G45A 3N9NA 5B76A 1X4IA 2F42A 5H1VA 2JMJA 1WEMA 2L75A 4L7XA 4C9ZA 3KV6A 3I2DA 4QF3A 2YHNA 2ECIA 4IC3A 3U5MA 2YREA 5TDWA 5B8DA 2CT2A 3SOWA 4FK5A 4LJNA 2LQ6A 5JG6A 5TRBA 3KV5A 4TKPB 3KQIA 2H0DA 4B7YC 3ZPVE 2L5UA 2AN6A 2LN0A 5TBNA 1K2FA 2ECWA 3LQHA 2M85A 1LDJB 2CSYA 2PNXA 1X4JA 4YBSA 1WGMA 5AITA 4Q6FA 3ZNIA 4S3OC 2KWOA 3LQJA 1X4UA 2KWJA 4AYCA 1WEPA 5LCWB 5FEYA 4N4FA 1VD4A 2L43A 2M6MA 2YT5A 2E6SA 4MVTA 3L1XA 5B75A 2LXPC 2RSDA 2L80A 3N9QA 3HCTA 4LLBA 2KE1A 2PUYA 5FB1A 2YW8A 4CCGX 2CKLB 4FJCA 3O34A 4MSXA 1V87A 2YU4A 4QF2A 3O36A 4PPEA 2MUMA 2VJEA 3RPGB 4N3WA 2VNFA 2LXHC 3N9MA 1T1HA 2K16A 3M62A 3O33A 4W4UA 2K17A 5G05B 4UP0A 2FSAA 4UI9B 2FUIA 2NAAA 2FUUA 3L1ZB 4AUQB 5H1UA 2KWNA 2YHOA 3HCUA 3ZPV1 4B86C 5KH7A 4YC9A 5LKZA 2MNYA 1Z60A 3HTKC 5FERA 2VPDA 2KGGA 3ZTGA 3O35A 1WENA 3M63A 5LKUA 2QICA 4A49A 2ECJA 2ECNA 4WZ3B 2E6RA 3NG2A 4P5OB 4ZUXU 2LGGA 2MA5A 2M1RA 4AP4A 3VK6A 3C5KA 2BAYA 3L11A 2KR4A 3U5NA 4GNFA 2YYRA 4PTBA 3PUQA 1XWHA 3LRQA 5G0FA 4YBTA 2OXQC 2VP7A 2VJFA 3ZVYA 4GNEA 2MD7B 3N9OA 1RMDA 4LADB 3O70A 4UP5A 4I7BA 2LDRA 2UZGA 5D1LB 5J3XA 1VYXA 1G25A 4R2YA 4ZDTA 4V3LC 5D1KB 3QZVA 4GNGA 1Z6UA 1JM7A 2C2LA 1JOCA 1MM2A 4GNDA 1WIMA 5TDRA 4YBMA 5I3LA 2MIQA 4GB0A 5H1TA 4L58A 1U6GB 1WEQA 5AIUA 2Y43A 2QIZA 4WA6A 2K4DA 3MHSA 3SHBA 1HYIA 2KGIA 2HDPA 4R7EA 2H0DB 3N9PA 5DKAA 1DVPA 3RTRB 3KNVA 3O7AA 2KREA 1WE9A 4V3KC 3SOUA 4YABA 2ZETC 2LV9A 1IYMA 3GV4A 4CA1A 2KFTA 5B78A 4YAXA 2YQMA 4A4CA 4BHWA 4I7CA 4AYCB 1MM3A 2YSMA 2HYED 1BORA 2MD8C 5G04B 1JM7B 2ECVA 5EYAF 1WILA 4FIPA 2F6JA 2DX8A 5H9MA 5LKTA 4YATA 2KWKA 5TABA 3O37A 4ZQLA 2LGKA 2YQLA 1F62A 3LQIA 2MT5A 1FBVA 1WEVA 3PURA 2CKLA 2VJEB 4FO9A 2LRIC 5B79A 3U5OA 3HCSA 4A0CD 2VPBA 2RI7A 3M99A 2JMDA 4IC2A 3ASLA 3PHDA 4LKAA 2ECGA 3V43A 4NN2A 1Z2QA 2Y1MA 5FB0A 5KH9A 3C6WA 5DINA 2LGVA 4YADA 2CSZA 4S3OB 2JRJA 2L0BA 5KH3A 1ZBDB 2G6QA 3U5PA 2MA6A 1LDKC 2EA6A 2G43A 3T6RA 2I50A 4X3GA 1WEWA 5LKXA 4AVXA 2K1JA 4F52B 5B77A 2F6NA 2XB1A 4LK9A 3MHHA 1WEEA 4O64A 4XI1A 1HYJA 1WFKA 3N9LA 3DPLR 2MNZA 3SOXA 3ZYQA 3EB6A 3ZVZB 4WZ2A
chains in the Genus database with same CATH superfamily
2KKXA 3MDBC 2XEUA 2LGLA 2EXUA 3RPGC 3GL6A 2VJFB 4I7DA 3E2DA 3DQVR 2JMIA 2QJ0A 1WEOA 2M3HA 4R8PK 2YURA 4BBQA 4A4BA 2Y1NA 5C11A 2EODA 1VFYA 2P57A 2KYUA 1E4UA 2KIZA 1WESA 2YSJA 3FL2A 3EB5A 3IHPA 5C13A 2VPEA 1CHCA 2YUCA 2EGPA 2ECTA 3FEHA 1WEUA 3DWDA 5D1MB 2C2VS 2IDAA 4WZ0A 1FP0A 1N87A 3T7LA 2D8SA 2VPGA 2KU3A 2G45A 3N9NA 5B76A 3LVQE 1X4IA 2F42A 5H1VA 2EGMA 2JMJA 1WEMA 2L75A 4L7XA 4C9ZA 3SUBA 3KV6A 3I2DA 4QF3A 2YHNA 2ECIA 4IC3A 3U5MA 2YREA 5TDWA 5B8DA 2CT2A 3SOWA 4FK5A 4LJNA 2LQ6A 5JG6A 5TRBA 3KV5A 4TKPB 3KQIA 2H0DA 4B7YC 3ZPVE 5SVIA 2L5UA 2AN6A 2LN0A 5TBNA 1K2FA 2ECWA 3LQHA 2M85A 2IQJA 1LDJB 2CSYA 2PNXA 3FJUB 4H9DA 4OGCA 1X4JA 4YBSA 1WGMA 1DCQA 5AITA 4Q6FA 3ZNIA 4S3OC 2KWOA 3LQJA 3PLWA 1X4UA 2KWJA 4AYCA 1WEPA 5LCWB 5FEYA 4N4FA 1VD4A 2L43A 2M6MA 2YT5A 2E6SA 4MVTA 3L1XA 5B75A 2LXPC 2RSDA 2XP0A 2L80A 3N9QA 3HCTA 4LLBA 2KE1A 2PUYA 5FB1A 2YW8A 4CCGX 2CKLB 4FJCA 3O34A 2D8UA 4MSXA 1V87A 3FM8C 2CONA 2YU4A 4QF2A 3O36A 4PPEA 4F1PA 2MUMA 2VJEA 3RPGB 2XOYA 4N3WA 2MKEA 2VNFA 5SVXA 2LXHC 3N9MA 1T1HA 2K16A 3M62A 3O33A 4W4UA 2K17A 5G05B 4UP0A 2FSAA 4UI9B 2FUIA 3LDYA 2NAAA 2FUUA 3L1ZB 4AUQB 4QQ4A 5H1UA 2KWNA 2XOZA 2YHOA 3HCUA 3ZPV1 4B86C 5KH7A 4YC9A 5LKZA 2MNYA 1Z60A 3HTKC 5FERA 2DJAA 2VPDA 2KGGA 3ZTGA 3O35A 1WENA 3M63A 5LKUA 2QICA 4A49A 2ECJA 2ECNA 4WZ3B 2E6RA 3NG2A 4P5OB 3M7KA 4ZUXU 2LGGA 2MA5A 2M1RA 2E61A 4AP4A 3VK6A 3C5KA 2BAYA 3L11A 2KR4A 4O62A 3U5NA 4GNFA 2B0OE 2CSVA 2YYRA 4PTBA 3PUQA 1XWHA 3LRQA 5G0FA 4YBTA 2OXQC 2VP7A 2VJFA 2XOCA 3ZVYA 4GNEA 2MD7B 3N9OA 1RMDA 4LADB 3O70A 4UP5A 4I7BA 2LDRA 2UZGA 2L7PA 5D1LB 5J3XA 1VYXA 2YVRA 4Z0OA 1G25A 4R2YA 4ZDTA 4V3LC 2FD4A 5D1KB 3QZVA 4GNGA 1Z6UA 1JM7A 2C2LA 4Z0RA 1JOCA 1MM2A 4GNDA 1WIMA 5TDRA 4YBMA 3LVRE 3FAOA 5I3LA 2MIQA 4GB0A 5H1TA 4L58A 1U6GB 1WEQA 5AIUA 2Y43A 2QIZA 2CRRA 4WA6A 2K4DA 3MHSA 3SHBA 1HYIA 2KGIA 5SVYA 2HDPA 2M13A 4R7EA 2H0DB 5SVIB 3N9PA 3Q1DA 2LAUA 5DKAA 1DVPA 3RTRB 3KNVA 3O7AA 2KREA 3JUEA 1WE9A 4V3KC 3SOUA 4YABA 3KDEC 2ZETC 2LV9A 1IYMA 3GV4A 4CA1A 2KFTA 5B78A 4YAXA 2YQMA 4A4CA 4BHWA 4I7CA 2OWAA 4AYCB 1MM3A 2YSMA 2HYED 1BORA 3DDTA 5G04B 2MD8C 1JM7B 2ECVA 5EYAF 1WILA 4FIPA 2F6JA 2DX8A 5H9MA 5LKTA 4YATA 2KWKA 5TABA 3O37A 4ZQLA 2LGKA 2YQLA 1F62A 3LQIA 3O47A 2MT5A 1FBVA 1WEVA 3PURA 2CKLA 1MBMA 2JUNA 2VJEB 2CRWA 4FO9A 2LRIC 2DSMA 5B79A 3U5OA 3HCSA 4A0CD 2VPBA 2RI7A 3M99A 2JMDA 4OGEA 4IC2A 3ASLA 3PHDA 4LKAA 2ECGA 3V43A 4NN2A 1Z2QA 2Y1MA 5FB0A 3LJUX 5KH9A 3C6WA 5DINA 2RR4A 2LGVA 4YADA 2CSZA 4S3OB 2JRJA 2L0BA 5KH3A 1ZBDB 2G6QA 3U5PA 2MA6A 1LDKC 3H7HA 2EA6A 2G43A 3T6RA 2I50A 4X3GA 1WEWA 5LKXA 4AVXA 2K1JA 4F52B 5B77A 2KKYA 2F6NA 5K3QA 2XB1A 4LK9A 3MHHA 1WEEA 4O64A 4XI1A 1HYJA 3FANA 1WFKA 3N9LA 3DPLR 2JM3A 2FFWA 2MNZA 3SOXA 3EB6A 3T9KA 3ZYQA 3ZVZB 4WZ2A
chains in the Genus database with same CATH topology
2XEUA 2LGLA 3RPGC 3GL6A 2VJFB 4I7DA 3DQVR 2JMIA 2QJ0A 1WEOA 2M3HA 4R8PK 2YURA 4BBQA 4A4BA 2Y1NA 5C11A 2EODA 1VFYA 2KYUA 1E4UA 2KIZA 1WESA 2YSJA 3FL2A 3EB5A 3IHPA 5C13A 2VPEA 1CHCA 2YUCA 2EGPA 2ECTA 1WEUA 5D1MB 2C2VS 2IDAA 4WZ0A 1FP0A 1N87A 3T7LA 2D8SA 2VPGA 2KU3A 2G45A 3N9NA 5B76A 1X4IA 2F42A 5H1VA 2JMJA 1WEMA 2L75A 4L7XA 4C9ZA 3KV6A 3I2DA 4QF3A 2YHNA 2ECIA 4IC3A 3U5MA 2YREA 5TDWA 5B8DA 2CT2A 3SOWA 4FK5A 4LJNA 2LQ6A 5JG6A 5TRBA 3KV5A 4TKPB 3KQIA 2H0DA 4B7YC 3ZPVE 2L5UA 2AN6A 2LN0A 5TBNA 1K2FA 2ECWA 3LQHA 2M85A 1LDJB 2CSYA 2PNXA 1X4JA 4YBSA 1WGMA 5AITA 4Q6FA 3ZNIA 4S3OC 2KWOA 3LQJA 1X4UA 2KWJA 4AYCA 1WEPA 5LCWB 5FEYA 4N4FA 1VD4A 2L43A 2M6MA 2YT5A 2E6SA 4MVTA 3L1XA 5B75A 2LXPC 2RSDA 2L80A 3N9QA 3HCTA 4LLBA 2KE1A 2PUYA 5FB1A 2YW8A 4CCGX 2CKLB 4FJCA 3O34A 4MSXA 1V87A 2YU4A 4QF2A 3O36A 4PPEA 2MUMA 2VJEA 3RPGB 4N3WA 2VNFA 2LXHC 3N9MA 1T1HA 2K16A 3M62A 3O33A 4W4UA 2K17A 5G05B 4UP0A 2FSAA 4UI9B 2FUIA 2NAAA 2FUUA 3L1ZB 4AUQB 5H1UA 2KWNA 2YHOA 3HCUA 3ZPV1 4B86C 5KH7A 4YC9A 5LKZA 2MNYA 1Z60A 3HTKC 5FERA 2VPDA 2KGGA 3ZTGA 3O35A 1WENA 3M63A 5LKUA 2QICA 4A49A 2ECJA 2ECNA 4WZ3B 2E6RA 3NG2A 4P5OB 4ZUXU 2LGGA 2MA5A 2M1RA 4AP4A 3VK6A 3C5KA 2BAYA 3L11A 2KR4A 3U5NA 4GNFA 2YYRA 4PTBA 3PUQA 1XWHA 3LRQA 5G0FA 4YBTA 2OXQC 2VP7A 2VJFA 3ZVYA 4GNEA 2MD7B 3N9OA 1RMDA 4LADB 3O70A 4UP5A 4I7BA 2LDRA 2UZGA 5D1LB 5J3XA 1VYXA 1G25A 4R2YA 4ZDTA 4V3LC 5D1KB 3QZVA 4GNGA 1Z6UA 1JM7A 2C2LA 1JOCA 1MM2A 4GNDA 1WIMA 5TDRA 4YBMA 5I3LA 2MIQA 4GB0A 5H1TA 4L58A 1U6GB 1WEQA 5AIUA 2Y43A 2QIZA 4WA6A 2K4DA 3MHSA 3SHBA 1HYIA 2KGIA 2HDPA 4R7EA 2H0DB 3N9PA 5DKAA 1DVPA 3RTRB 3KNVA 3O7AA 2KREA 1WE9A 4V3KC 3SOUA 4YABA 2ZETC 2LV9A 1IYMA 3GV4A 4CA1A 2KFTA 5B78A 4YAXA 2YQMA 4A4CA 4BHWA 4I7CA 4AYCB 1MM3A 2YSMA 2HYED 1BORA 2MD8C 5G04B 1JM7B 2ECVA 5EYAF 1WILA 4FIPA 2F6JA 2DX8A 5H9MA 5LKTA 4YATA 2KWKA 5TABA 3O37A 4ZQLA 2LGKA 2YQLA 1F62A 3LQIA 2MT5A 1FBVA 1WEVA 3PURA 2CKLA 2VJEB 4FO9A 2LRIC 5B79A 3U5OA 3HCSA 4A0CD 2VPBA 2RI7A 3M99A 2JMDA 4IC2A 3ASLA 3PHDA 4LKAA 2ECGA 3V43A 4NN2A 1Z2QA 2Y1MA 5FB0A 5KH9A 3C6WA 5DINA 2LGVA 4YADA 2CSZA 4S3OB 2JRJA 2L0BA 5KH3A 1ZBDB 2G6QA 3U5PA 2MA6A 1LDKC 2EA6A 2G43A 3T6RA 2I50A 4X3GA 1WEWA 5LKXA 4AVXA 2K1JA 4F52B 5B77A 2F6NA 2XB1A 4LK9A 3MHHA 1WEEA 4O64A 4XI1A 1HYJA 1WFKA 3N9LA 3DPLR 2MNZA 3SOXA 3ZYQA 3EB6A 3ZVZB 4WZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEU A;  2LGL A;  3RPG C;  3GL6 A;  2VJF B;  4I7D A;  3DQV R;  2JMI A;  2QJ0 A;  1WEO A;  2M3H A;  4R8P K;  2YUR A;  4BBQ A;  4A4B A;  2Y1N A;  5C11 A;  2EOD A;  1VFY A;  2KYU A;  1E4U A;  2KIZ A;  1WES A;  2YSJ A;  3FL2 A;  3EB5 A;  3IHP A;  5C13 A;  2VPE A;  1CHC A;  2YUC A;  2EGP A;  2ECT A;  1WEU A;  5D1M B;  2C2V S;  2IDA A;  4WZ0 A;  1FP0 A;  1N87 A;  3T7L A;  2D8S A;  2VPG A;  2KU3 A;  2G45 A;  3N9N A;  5B76 A;  1X4I A;  2F42 A;  5H1V A;  2JMJ A;  1WEM A;  2L75 A;  4L7X A;  4C9Z A;  3KV6 A;  3I2D A;  4QF3 A;  2YHN A;  2ECI A;  4IC3 A;  3U5M A;  2YRE A;  5TDW A;  5B8D A;  2CT2 A;  3SOW A;  4FK5 A;  4LJN A;  2LQ6 A;  5JG6 A;  5TRB A;  3KV5 A;  4TKP B;  3KQI A;  2H0D A;  4B7Y C;  3ZPV E;  2L5U A;  2AN6 A;  2LN0 A;  5TBN A;  1K2F A;  2ECW A;  3LQH A;  2M85 A;  1LDJ B;  2CSY A;  2PNX A;  1X4J A;  4YBS A;  1WGM A;  5AIT A;  4Q6F A;  3ZNI A;  4S3O C;  2KWO A;  3LQJ A;  1X4U A;  2KWJ A;  4AYC A;  1WEP A;  5LCW B;  5FEY A;  4N4F A;  1VD4 A;  2L43 A;  2M6M A;  2YT5 A;  2E6S A;  4MVT A;  3L1X A;  5B75 A;  2LXP C;  2RSD A;  2L80 A;  3N9Q A;  3HCT A;  4LLB A;  2KE1 A;  2PUY A;  5FB1 A;  2YW8 A;  4CCG X;  2CKL B;  4FJC A;  3O34 A;  4MSX A;  1V87 A;  2YU4 A;  4QF2 A;  3O36 A;  4PPE A;  2MUM A;  2VJE A;  3RPG B;  4N3W A;  2VNF A;  2LXH C;  3N9M A;  1T1H A;  2K16 A;  3M62 A;  3O33 A;  4W4U A;  2K17 A;  5G05 B;  4UP0 A;  2FSA A;  4UI9 B;  2FUI A;  2NAA A;  2FUU A;  3L1Z B;  4AUQ B;  5H1U A;  2KWN A;  2YHO A;  3HCU A;  3ZPV 1;  4B86 C;  5KH7 A;  4YC9 A;  5LKZ A;  2MNY A;  1Z60 A;  3HTK C;  5FER A;  2VPD A;  2KGG A;  3ZTG A;  3O35 A;  1WEN A;  3M63 A;  5LKU A;  2QIC A;  4A49 A;  2ECJ A;  2ECN A;  4WZ3 B;  2E6R A;  3NG2 A;  4P5O B;  4ZUX U;  2LGG A;  2MA5 A;  2M1R A;  4AP4 A;  3VK6 A;  3C5K A;  2BAY A;  3L11 A;  2KR4 A;  3U5N A;  4GNF A;  2YYR A;  4PTB A;  3PUQ A;  1XWH A;  3LRQ A;  5G0F A;  4YBT A;  2OXQ C;  2VP7 A;  2VJF A;  3ZVY A;  4GNE A;  2MD7 B;  3N9O A;  1RMD A;  4LAD B;  3O70 A;  4UP5 A;  4I7B A;  2LDR A;  2UZG A;  5D1L B;  5J3X A;  1VYX A;  1G25 A;  4R2Y A;  4ZDT A;  4V3L C;  5D1K B;  3QZV A;  4GNG A;  1Z6U A;  1JM7 A;  2C2L A;  1JOC A;  1MM2 A;  4GND A;  1WIM A;  5TDR A;  4YBM A;  5I3L A;  2MIQ A;  4GB0 A;  5H1T A;  4L58 A;  1U6G B;  1WEQ A;  5AIU A;  2Y43 A;  2QIZ A;  4WA6 A;  2K4D A;  3MHS A;  3SHB A;  1HYI A;  2KGI A;  2HDP A;  4R7E A;  2H0D B;  3N9P A;  5DKA A;  1DVP A;  3RTR B;  3KNV A;  3O7A A;  2KRE A;  1WE9 A;  4V3K C;  3SOU A;  4YAB A;  2ZET C;  2LV9 A;  1IYM A;  3GV4 A;  4CA1 A;  2KFT A;  5B78 A;  4YAX A;  2YQM A;  4A4C A;  4BHW A;  4I7C A;  4AYC B;  1MM3 A;  2YSM A;  2HYE D;  1BOR A;  2MD8 C;  5G04 B;  1JM7 B;  2ECV A;  5EYA F;  1WIL A;  4FIP A;  2F6J A;  2DX8 A;  5H9M A;  5LKT A;  4YAT A;  2KWK A;  5TAB A;  3O37 A;  4ZQL A;  2LGK A;  2YQL A;  1F62 A;  3LQI A;  2MT5 A;  1FBV A;  1WEV A;  3PUR A;  2CKL A;  2VJE B;  4FO9 A;  2LRI C;  5B79 A;  3U5O A;  3HCS A;  4A0C D;  2VPB A;  2RI7 A;  3M99 A;  2JMD A;  4IC2 A;  3ASL A;  3PHD A;  4LKA A;  2ECG A;  3V43 A;  4NN2 A;  1Z2Q A;  2Y1M A;  5FB0 A;  5KH9 A;  3C6W A;  5DIN A;  2LGV A;  4YAD A;  2CSZ A;  4S3O B;  2JRJ A;  2L0B A;  5KH3 A;  1ZBD B;  2G6Q A;  3U5P A;  2MA6 A;  1LDK C;  2EA6 A;  2G43 A;  3T6R A;  2I50 A;  4X3G A;  1WEW A;  5LKX A;  4AVX A;  2K1J A;  4F52 B;  5B77 A;  2F6N A;  2XB1 A;  4LK9 A;  3MHH A;  1WEE A;  4O64 A;  4XI1 A;  1HYJ A;  1WFK A;  3N9L A;  3DPL R;  2MNZ A;  3SOX A;  3ZYQ A;  3EB6 A;  3ZVZ B;  4WZ2 A; 
#chains in the Genus database with same CATH topology
 2KKX A;  3MDB C;  2XEU A;  2LGL A;  2EXU A;  3RPG C;  3GL6 A;  2VJF B;  4I7D A;  3E2D A;  3DQV R;  2JMI A;  2QJ0 A;  1WEO A;  2M3H A;  4R8P K;  2YUR A;  4BBQ A;  4A4B A;  2Y1N A;  5C11 A;  2EOD A;  1VFY A;  2P57 A;  2KYU A;  1E4U A;  2KIZ A;  1WES A;  2YSJ A;  3FL2 A;  3EB5 A;  3IHP A;  5C13 A;  2VPE A;  1CHC A;  2YUC A;  2EGP A;  2ECT A;  3FEH A;  1WEU A;  3DWD A;  5D1M B;  2C2V S;  2IDA A;  4WZ0 A;  1FP0 A;  1N87 A;  3T7L A;  2D8S A;  2VPG A;  2KU3 A;  2G45 A;  3N9N A;  5B76 A;  3LVQ E;  1X4I A;  2F42 A;  5H1V A;  2EGM A;  2JMJ A;  1WEM A;  2L75 A;  4L7X A;  4C9Z A;  3SUB A;  3KV6 A;  3I2D A;  4QF3 A;  2YHN A;  2ECI A;  4IC3 A;  3U5M A;  2YRE A;  5TDW A;  5B8D A;  2CT2 A;  3SOW A;  4FK5 A;  4LJN A;  2LQ6 A;  5JG6 A;  5TRB A;  3KV5 A;  4TKP B;  3KQI A;  2H0D A;  4B7Y C;  3ZPV E;  5SVI A;  2L5U A;  2AN6 A;  2LN0 A;  5TBN A;  1K2F A;  2ECW A;  3LQH A;  2M85 A;  2IQJ A;  1LDJ B;  2CSY A;  2PNX A;  3FJU B;  4H9D A;  4OGC A;  1X4J A;  4YBS A;  1WGM A;  1DCQ A;  5AIT A;  4Q6F A;  3ZNI A;  4S3O C;  2KWO A;  3LQJ A;  3PLW A;  1X4U A;  2KWJ A;  4AYC A;  1WEP A;  5LCW B;  5FEY A;  4N4F A;  1VD4 A;  2L43 A;  2M6M A;  2YT5 A;  2E6S A;  4MVT A;  3L1X A;  5B75 A;  2LXP C;  2RSD A;  2XP0 A;  2L80 A;  3N9Q A;  3HCT A;  4LLB A;  2KE1 A;  2PUY A;  5FB1 A;  2YW8 A;  4CCG X;  2CKL B;  4FJC A;  3O34 A;  2D8U A;  4MSX A;  1V87 A;  3FM8 C;  2CON A;  2YU4 A;  4QF2 A;  3O36 A;  4PPE A;  4F1P A;  2MUM A;  2VJE A;  3RPG B;  2XOY A;  4N3W A;  2MKE A;  2VNF A;  5SVX A;  2LXH C;  3N9M A;  1T1H A;  2K16 A;  3M62 A;  3O33 A;  4W4U A;  2K17 A;  5G05 B;  4UP0 A;  2FSA A;  4UI9 B;  2FUI A;  3LDY A;  2NAA A;  2FUU A;  3L1Z B;  4AUQ B;  4QQ4 A;  5H1U A;  2KWN A;  2XOZ A;  2YHO A;  3HCU A;  3ZPV 1;  4B86 C;  5KH7 A;  4YC9 A;  5LKZ A;  2MNY A;  1Z60 A;  3HTK C;  5FER A;  2DJA A;  2VPD A;  2KGG A;  3ZTG A;  3O35 A;  1WEN A;  3M63 A;  5LKU A;  2QIC A;  4A49 A;  2ECJ A;  2ECN A;  4WZ3 B;  2E6R A;  3NG2 A;  4P5O B;  3M7K A;  4ZUX U;  2LGG A;  2MA5 A;  2M1R A;  2E61 A;  4AP4 A;  3VK6 A;  3C5K A;  2BAY A;  3L11 A;  2KR4 A;  4O62 A;  3U5N A;  4GNF A;  2B0O E;  2CSV A;  2YYR A;  4PTB A;  3PUQ A;  1XWH A;  3LRQ A;  5G0F A;  4YBT A;  2OXQ C;  2VP7 A;  2VJF A;  2XOC A;  3ZVY A;  4GNE A;  2MD7 B;  3N9O A;  1RMD A;  4LAD B;  3O70 A;  4UP5 A;  4I7B A;  2LDR A;  2UZG A;  2L7P A;  5D1L B;  5J3X A;  1VYX A;  2YVR A;  4Z0O A;  1G25 A;  4R2Y A;  4ZDT A;  4V3L C;  2FD4 A;  5D1K B;  3QZV A;  4GNG A;  1Z6U A;  1JM7 A;  2C2L A;  4Z0R A;  1JOC A;  1MM2 A;  4GND A;  1WIM A;  5TDR A;  4YBM A;  3LVR E;  3FAO A;  5I3L A;  2MIQ A;  4GB0 A;  5H1T A;  4L58 A;  1U6G B;  1WEQ A;  5AIU A;  2Y43 A;  2QIZ A;  2CRR A;  4WA6 A;  2K4D A;  3MHS A;  3SHB A;  1HYI A;  2KGI A;  5SVY A;  2HDP A;  2M13 A;  4R7E A;  2H0D B;  5SVI B;  3N9P A;  3Q1D A;  2LAU A;  5DKA A;  1DVP A;  3RTR B;  3KNV A;  3O7A A;  2KRE A;  3JUE A;  1WE9 A;  4V3K C;  3SOU A;  4YAB A;  3KDE C;  2ZET C;  2LV9 A;  1IYM A;  3GV4 A;  4CA1 A;  2KFT A;  5B78 A;  4YAX A;  2YQM A;  4A4C A;  4BHW A;  4I7C A;  2OWA A;  4AYC B;  1MM3 A;  2YSM A;  2HYE D;  1BOR A;  3DDT A;  5G04 B;  2MD8 C;  1JM7 B;  2ECV A;  5EYA F;  1WIL A;  4FIP A;  2F6J A;  2DX8 A;  5H9M A;  5LKT A;  4YAT A;  2KWK A;  5TAB A;  3O37 A;  4ZQL A;  2LGK A;  2YQL A;  1F62 A;  3LQI A;  3O47 A;  2MT5 A;  1FBV A;  1WEV A;  3PUR A;  2CKL A;  1MBM A;  2JUN A;  2VJE B;  2CRW A;  4FO9 A;  2LRI C;  2DSM A;  5B79 A;  3U5O A;  3HCS A;  4A0C D;  2VPB A;  2RI7 A;  3M99 A;  2JMD A;  4OGE A;  4IC2 A;  3ASL A;  3PHD A;  4LKA A;  2ECG A;  3V43 A;  4NN2 A;  1Z2Q A;  2Y1M A;  5FB0 A;  3LJU X;  5KH9 A;  3C6W A;  5DIN A;  2RR4 A;  2LGV A;  4YAD A;  2CSZ A;  4S3O B;  2JRJ A;  2L0B A;  5KH3 A;  1ZBD B;  2G6Q A;  3U5P A;  2MA6 A;  1LDK C;  3H7H A;  2EA6 A;  2G43 A;  3T6R A;  2I50 A;  4X3G A;  1WEW A;  5LKX A;  4AVX A;  2K1J A;  4F52 B;  5B77 A;  2KKY A;  2F6N A;  5K3Q A;  2XB1 A;  4LK9 A;  3MHH A;  1WEE A;  4O64 A;  4XI1 A;  1HYJ A;  3FAN A;  1WFK A;  3N9L A;  3DPL R;  2JM3 A;  2FFW A;  2MNZ A;  3SOX A;  3EB6 A;  3T9K A;  3ZYQ A;  3ZVZ B;  4WZ2 A; 
#chains in the Genus database with same CATH homology
 2XEU A;  2LGL A;  3RPG C;  3GL6 A;  2VJF B;  4I7D A;  3DQV R;  2JMI A;  2QJ0 A;  1WEO A;  2M3H A;  4R8P K;  2YUR A;  4BBQ A;  4A4B A;  2Y1N A;  5C11 A;  2EOD A;  1VFY A;  2KYU A;  1E4U A;  2KIZ A;  1WES A;  2YSJ A;  3FL2 A;  3EB5 A;  3IHP A;  5C13 A;  2VPE A;  1CHC A;  2YUC A;  2EGP A;  2ECT A;  1WEU A;  5D1M B;  2C2V S;  2IDA A;  4WZ0 A;  1FP0 A;  1N87 A;  3T7L A;  2D8S A;  2VPG A;  2KU3 A;  2G45 A;  3N9N A;  5B76 A;  1X4I A;  2F42 A;  5H1V A;  2JMJ A;  1WEM A;  2L75 A;  4L7X A;  4C9Z A;  3KV6 A;  3I2D A;  4QF3 A;  2YHN A;  2ECI A;  4IC3 A;  3U5M A;  2YRE A;  5TDW A;  5B8D A;  2CT2 A;  3SOW A;  4FK5 A;  4LJN A;  2LQ6 A;  5JG6 A;  5TRB A;  3KV5 A;  4TKP B;  3KQI A;  2H0D A;  4B7Y C;  3ZPV E;  2L5U A;  2AN6 A;  2LN0 A;  5TBN A;  1K2F A;  2ECW A;  3LQH A;  2M85 A;  1LDJ B;  2CSY A;  2PNX A;  1X4J A;  4YBS A;  1WGM A;  5AIT A;  4Q6F A;  3ZNI A;  4S3O C;  2KWO A;  3LQJ A;  1X4U A;  2KWJ A;  4AYC A;  1WEP A;  5LCW B;  5FEY A;  4N4F A;  1VD4 A;  2L43 A;  2M6M A;  2YT5 A;  2E6S A;  4MVT A;  3L1X A;  5B75 A;  2LXP C;  2RSD A;  2L80 A;  3N9Q A;  3HCT A;  4LLB A;  2KE1 A;  2PUY A;  5FB1 A;  2YW8 A;  4CCG X;  2CKL B;  4FJC A;  3O34 A;  4MSX A;  1V87 A;  2YU4 A;  4QF2 A;  3O36 A;  4PPE A;  2MUM A;  2VJE A;  3RPG B;  4N3W A;  2VNF A;  2LXH C;  3N9M A;  1T1H A;  2K16 A;  3M62 A;  3O33 A;  4W4U A;  2K17 A;  5G05 B;  4UP0 A;  2FSA A;  4UI9 B;  2FUI A;  2NAA A;  2FUU A;  3L1Z B;  4AUQ B;  5H1U A;  2KWN A;  2YHO A;  3HCU A;  3ZPV 1;  4B86 C;  5KH7 A;  4YC9 A;  5LKZ A;  2MNY A;  1Z60 A;  3HTK C;  5FER A;  2VPD A;  2KGG A;  3ZTG A;  3O35 A;  1WEN A;  3M63 A;  5LKU A;  2QIC A;  4A49 A;  2ECJ A;  2ECN A;  4WZ3 B;  2E6R A;  3NG2 A;  4P5O B;  4ZUX U;  2LGG A;  2MA5 A;  2M1R A;  4AP4 A;  3VK6 A;  3C5K A;  2BAY A;  3L11 A;  2KR4 A;  3U5N A;  4GNF A;  2YYR A;  4PTB A;  3PUQ A;  1XWH A;  3LRQ A;  5G0F A;  4YBT A;  2OXQ C;  2VP7 A;  2VJF A;  3ZVY A;  4GNE A;  2MD7 B;  3N9O A;  1RMD A;  4LAD B;  3O70 A;  4UP5 A;  4I7B A;  2LDR A;  2UZG A;  5D1L B;  5J3X A;  1VYX A;  1G25 A;  4R2Y A;  4ZDT A;  4V3L C;  5D1K B;  3QZV A;  4GNG A;  1Z6U A;  1JM7 A;  2C2L A;  1JOC A;  1MM2 A;  4GND A;  1WIM A;  5TDR A;  4YBM A;  5I3L A;  2MIQ A;  4GB0 A;  5H1T A;  4L58 A;  1U6G B;  1WEQ A;  5AIU A;  2Y43 A;  2QIZ A;  4WA6 A;  2K4D A;  3MHS A;  3SHB A;  1HYI A;  2KGI A;  2HDP A;  4R7E A;  2H0D B;  3N9P A;  5DKA A;  1DVP A;  3RTR B;  3KNV A;  3O7A A;  2KRE A;  1WE9 A;  4V3K C;  3SOU A;  4YAB A;  2ZET C;  2LV9 A;  1IYM A;  3GV4 A;  4CA1 A;  2KFT A;  5B78 A;  4YAX A;  2YQM A;  4A4C A;  4BHW A;  4I7C A;  4AYC B;  1MM3 A;  2YSM A;  2HYE D;  1BOR A;  2MD8 C;  5G04 B;  1JM7 B;  2ECV A;  5EYA F;  1WIL A;  4FIP A;  2F6J A;  2DX8 A;  5H9M A;  5LKT A;  4YAT A;  2KWK A;  5TAB A;  3O37 A;  4ZQL A;  2LGK A;  2YQL A;  1F62 A;  3LQI A;  2MT5 A;  1FBV A;  1WEV A;  3PUR A;  2CKL A;  2VJE B;  4FO9 A;  2LRI C;  5B79 A;  3U5O A;  3HCS A;  4A0C D;  2VPB A;  2RI7 A;  3M99 A;  2JMD A;  4IC2 A;  3ASL A;  3PHD A;  4LKA A;  2ECG A;  3V43 A;  4NN2 A;  1Z2Q A;  2Y1M A;  5FB0 A;  5KH9 A;  3C6W A;  5DIN A;  2LGV A;  4YAD A;  2CSZ A;  4S3O B;  2JRJ A;  2L0B A;  5KH3 A;  1ZBD B;  2G6Q A;  3U5P A;  2MA6 A;  1LDK C;  2EA6 A;  2G43 A;  3T6R A;  2I50 A;  4X3G A;  1WEW A;  5LKX A;  4AVX A;  2K1J A;  4F52 B;  5B77 A;  2F6N A;  2XB1 A;  4LK9 A;  3MHH A;  1WEE A;  4O64 A;  4XI1 A;  1HYJ A;  1WFK A;  3N9L A;  3DPL R;  2MNZ A;  3SOX A;  3ZYQ A;  3EB6 A;  3ZVZ B;  4WZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...