1WE9A

Solution structure of phd domain in nucleic acid binding protein-like np_197993
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
64
structure length
64
Chain Sequence
GSSGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger family protein
publication title Solution structure of PHD domain in nucleic acid binding protein-like NP_197993
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 6
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1we9A00
3L11A 4MSXA 2LGLA 1F62A 1CHCA 2CSZA 1WFKA 2ECVA 2F6JA 2FUIA 4AUQB 4C9ZA 3N9LA 2DX8A 5FB0A 4I7DA 4YATA 2MUMA 3ZVZB 4LLBA 4FIPA 1FBVA 2JMIA 1JOCA 1G25A 3MHHA 5H1TA 2D8SA 3ZYQA 5J3XA 5KH9A 3T7LA 1WENA 2H0DB 1MM2A 4A4CA 2EA6A 2CSYA 2ECWA 3ZPVE 2KGIA 5EYAF 1LDKC 1ZBDB 2YQMA 3SHBA 4WA6A 2JMDA 3FL2A 2HDPA 2KGGA 4R7EA 4WZ3B 3IHPA 3M62A 3O35A 2M6MA 5C11A 2MNYA 5H1VA 4WZ2A 1Z2QA 3PURA 3O36A 2MD8C 2MNZA 2YSMA 4AP4A 3HCSA 4AYCB 3N9PA 4A4BA 4BHWA 5B77A 2MIQA 4FJCA 5FEYA 3LQHA 2LN0A 4A0CD 1BORA 4CA1A 2L0BA 2LV9A 3O7AA 3HCTA 5TDRA 2QJ0A 5H1UA 3U5PA 2LXHC 1Z6UA 3M63A 4IC2A 2KREA 2VJFB 1MM3A 4GB0A 2QIZA 2F42A 3N9OA 2NAAA 2MA5A 3VK6A 2KFTA 5LKZA 1K2FA 1WEEA 4UI9B 1U6GB 2YU4A 4MVTA 3RPGB 2ECNA 3U5MA 5JG6A 2MA6A 2YREA 2VJEB 5AITA 2YHNA 3NG2A 2CT2A 1VD4A 2M1RA 2KYUA 1X4IA 1WEQA 2H0DA 5LKUA 1JM7B 2E6SA 2L43A 4LKAA 3SOUA 2KU3A 3ZNIA 4NN2A 4YBTA 2G43A 2UZGA 2QICA 2VPBA 3ZVYA 5LCWB 2CKLB 3GL6A 4YBSA 3HTKC 1Z60A 5TRBA 2ECTA 3N9NA 4XI1A 2G45A 3LQIA 2RI7A 3L1XA 1X4UA 2KWOA 2VPEA 5FB1A 4N4FA 3C5KA 3KV6A 2LDRA 3KQIA 2VJFA 4ZQLA 1X4JA 4UP0A 2K1JA 1V87A 3T6RA 2VNFA 4GNFA 4B86C 2C2LA 2LXPC 2KWKA 1DVPA 5TDWA 2KR4A 3KV5A 1WEPA 4QF2A 5B78A 2MT5A 5I3LA 1WEOA 3QZVA 5FERA 3N9MA 1WEMA 2VJEA 2OXQC 3PHDA 4QF3A 4R2YA 3O34A 4Q6FA 5B8DA 2K17A 2L5UA 3M99A 4I7BA 2Y43A 4FO9A 2M3HA 1HYIA 4ZDTA 2YURA 5KH3A 4ZUXU 3LQJA 1WE9A 5DKAA 5B75A 2FSAA 2Y1MA 4S3OB 4AVXA 4YABA 3ZTGA 3MHSA 3O70A 3O33A 4O64A 2AN6A 4PPEA 3SOWA 3KNVA 2Y1NA 2G6QA 4F52B 2LGGA 5D1KB 3RTRB 3DQVR 1WGMA 2RSDA 2YUCA 1FP0A 5G0FA 4LJNA 2PNXA 3I2DA 4N3WA 1WEWA 3O37A 4R8PK 5TABA 3LRQA 4I7CA 3PUQA 2LRIC 4L58A 4V3LC 1WEUA 2L80A 2XEUA 4X3GA 4W4UA 3RPGC 3ZPV1 5TBNA 4YADA 2VPGA 4YBMA 4P5OB 4AYCA 2L75A 4A49A 4L7XA 2K16A 2VPDA 2YYRA 4B7YC 2ECJA 1VYXA 2YQLA 3U5OA 2C2VS 5B79A 5G04B 2KE1A 2YSJA 4UP5A 5LKTA 2K4DA 4GNDA 2EODA 2BAYA 1HYJA 3N9QA 2YW8A 2M85A 4YAXA 3GV4A 4CCGX 4TKPB 2ZETC 3HCUA 3EB5A 3EB6A 3U5NA 3SOXA 2F6NA 4BBQA 1WIMA 4PTBA 5D1MB 5D1LB 2VP7A 3ASLA 1LDJB 2FUUA 2KIZA 1T1HA 4YC9A 4GNGA 5G05B 1VFYA 1WILA 2ECIA 5B76A 1JM7A 2KWNA 2LGKA 1IYMA 3V43A 2ECGA 2JRJA 5LKXA 4GNEA 2LQ6A 4FK5A 4IC3A 3L1ZB 5KH7A 3C6WA 5DINA 1XWHA 2CKLA 4LK9A 2XB1A 2PUYA 5H9MA 2JMJA 2YT5A 2YHOA 5C13A 2KWJA 2MD7B 2HYED 1WESA 4WZ0A 4S3OC 1N87A 3DPLR 4V3KC 1WEVA 2EGPA 2E6RA 2I50A 2IDAA 1RMDA 1E4UA 4LADB 2LGVA 5AIUA
chains in the Genus database with same CATH superfamily
2P57A 4F1PA 3L11A 4MSXA 2LGLA 3SUBA 1F62A 1CHCA 5K3QA 2CSZA 1WFKA 2ECVA 2F6JA 2FUIA 4AUQB 4C9ZA 3O47A 3N9LA 2DX8A 3LDYA 5FB0A 4I7DA 4YATA 2KKXA 2MUMA 3ZVZB 4LLBA 2DSMA 4FIPA 1FBVA 2JMIA 1JOCA 1G25A 3MHHA 3DWDA 5H1TA 2D8SA 3ZYQA 5J3XA 5SVXA 5KH9A 3T7LA 1WENA 2H0DB 1MM2A 4A4CA 2EA6A 2CSYA 2ECWA 3ZPVE 2KGIA 5EYAF 1LDKC 2XOZA 1ZBDB 3MDBC 2YQMA 3SHBA 4WA6A 2JMDA 3FL2A 2HDPA 2KGGA 4R7EA 4WZ3B 4Z0OA 2XP0A 2M13A 3IHPA 3LVRE 3M62A 3O35A 2M6MA 2EXUA 5C11A 2MNYA 5H1VA 4WZ2A 1Z2QA 3PURA 4OGCA 3O36A 2MD8C 2MNZA 2YSMA 4AP4A 3HCSA 2FFWA 4AYCB 3N9PA 4A4BA 4BHWA 5B77A 2MIQA 4FJCA 5FEYA 3LQHA 2LN0A 4A0CD 1BORA 2CRRA 4CA1A 2L0BA 2LV9A 3O7AA 3HCTA 5TDRA 2QJ0A 5H1UA 3U5PA 2LXHC 2DJAA 1Z6UA 3M63A 4IC2A 2KREA 2VJFB 3LVQE 3FJUB 1MM3A 4GB0A 2QIZA 2F42A 3N9OA 2NAAA 2MA5A 3VK6A 2KFTA 5LKZA 1K2FA 1WEEA 4UI9B 1U6GB 2YU4A 4MVTA 3RPGB 2ECNA 3U5MA 5JG6A 2MA6A 2YREA 3E2DA 2VJEB 5AITA 2YHNA 3NG2A 2CT2A 4OGEA 1VD4A 3FM8C 2M1RA 2KYUA 1X4IA 1WEQA 2E61A 2H0DA 3T9KA 5LKUA 1JM7B 2E6SA 2L43A 4LKAA 3SOUA 2MKEA 2KU3A 2KKYA 3ZNIA 3JUEA 4NN2A 4YBTA 2G43A 2UZGA 3FANA 2QICA 3FAOA 2VPBA 3ZVYA 5LCWB 2CKLB 3GL6A 4YBSA 3HTKC 1Z60A 5TRBA 2ECTA 5SVIB 3N9NA 4XI1A 2G45A 3LQIA 2RI7A 3L1XA 1X4UA 2KWOA 2VPEA 5FB1A 4N4FA 3C5KA 3KV6A 3LJUX 2LDRA 3KQIA 2VJFA 4ZQLA 1X4JA 4UP0A 2K1JA 1V87A 3T6RA 2VNFA 4GNFA 2IQJA 4B86C 2C2LA 2LXPC 2KWKA 2CONA 1DVPA 5TDWA 2KR4A 3KV5A 2RR4A 1WEPA 4QF2A 5B78A 2MT5A 5I3LA 1WEOA 3QZVA 5FERA 2JM3A 3M7KA 3N9MA 4Z0RA 1WEMA 2VJEA 2OXQC 3PHDA 4QF3A 4R2YA 3O34A 4Q6FA 5B8DA 2K17A 2YVRA 2L5UA 3M99A 4I7BA 2Y43A 4FO9A 2M3HA 1HYIA 4ZDTA 2YURA 5KH3A 4ZUXU 3LQJA 1WE9A 1DCQA 5DKAA 5B75A 2FSAA 3KDEC 2Y1MA 4S3OB 3PLWA 4AVXA 4YABA 3ZTGA 3MHSA 3O70A 3O33A 4O64A 2AN6A 1MBMA 4PPEA 2JUNA 3SOWA 3KNVA 2Y1NA 2G6QA 4F52B 5SVIA 2LGGA 5D1KB 3RTRB 2CRWA 3DQVR 1WGMA 2RSDA 2YUCA 1FP0A 5G0FA 4LJNA 2PNXA 3I2DA 4N3WA 1WEWA 3O37A 4R8PK 5TABA 3LRQA 4I7CA 3PUQA 2LRIC 4L58A 4V3LC 1WEUA 2L80A 2XEUA 4X3GA 4W4UA 3DDTA 3RPGC 3Q1DA 3ZPV1 5TBNA 4YADA 2XOCA 2VPGA 4YBMA 4P5OB 4AYCA 2L75A 4A49A 2D8UA 4L7XA 2K16A 2VPDA 2YYRA 4H9DA 4B7YC 2ECJA 1VYXA 2YQLA 3U5OA 3FEHA 2C2VS 5B79A 5G04B 2KE1A 2YSJA 4UP5A 3H7HA 5LKTA 2K4DA 4GNDA 5SVYA 2EODA 2BAYA 1HYJA 3N9QA 2YW8A 2CSVA 2M85A 4YAXA 3GV4A 4CCGX 4TKPB 2XOYA 2ZETC 3HCUA 3EB5A 3EB6A 3U5NA 3SOXA 2F6NA 4BBQA 1WIMA 2B0OE 4PTBA 5D1MB 5D1LB 2VP7A 3ASLA 1LDJB 2FUUA 2KIZA 1T1HA 4YC9A 4GNGA 5G05B 1VFYA 1WILA 2ECIA 5B76A 1JM7A 2KWNA 4QQ4A 2LGKA 1IYMA 3V43A 2ECGA 2JRJA 5LKXA 4GNEA 2LQ6A 4FK5A 4IC3A 2LAUA 3L1ZB 5KH7A 3C6WA 5DINA 1XWHA 2CKLA 4LK9A 2XB1A 2PUYA 5H9MA 2JMJA 2YT5A 2EGMA 2YHOA 5C13A 2KWJA 4O62A 2MD7B 2HYED 2FD4A 1WESA 4WZ0A 4S3OC 1N87A 3DPLR 4V3KC 1WEVA 2EGPA 2E6RA 2I50A 2IDAA 2OWAA 1RMDA 1E4UA 2L7PA 4LADB 2LGVA 5AIUA
chains in the Genus database with same CATH topology
3L11A 4MSXA 2LGLA 1F62A 1CHCA 2CSZA 1WFKA 2ECVA 2F6JA 2FUIA 4AUQB 4C9ZA 3N9LA 2DX8A 5FB0A 4I7DA 4YATA 2MUMA 3ZVZB 4LLBA 4FIPA 1FBVA 2JMIA 1JOCA 1G25A 3MHHA 5H1TA 2D8SA 3ZYQA 5J3XA 5KH9A 3T7LA 1WENA 2H0DB 1MM2A 4A4CA 2EA6A 2CSYA 2ECWA 3ZPVE 2KGIA 5EYAF 1LDKC 1ZBDB 2YQMA 3SHBA 4WA6A 2JMDA 3FL2A 2HDPA 2KGGA 4R7EA 4WZ3B 3IHPA 3M62A 3O35A 2M6MA 5C11A 2MNYA 5H1VA 4WZ2A 1Z2QA 3PURA 3O36A 2MD8C 2MNZA 2YSMA 4AP4A 3HCSA 4AYCB 3N9PA 4A4BA 4BHWA 5B77A 2MIQA 4FJCA 5FEYA 3LQHA 2LN0A 4A0CD 1BORA 4CA1A 2L0BA 2LV9A 3O7AA 3HCTA 5TDRA 2QJ0A 5H1UA 3U5PA 2LXHC 1Z6UA 3M63A 4IC2A 2KREA 2VJFB 1MM3A 4GB0A 2QIZA 2F42A 3N9OA 2NAAA 2MA5A 3VK6A 2KFTA 5LKZA 1K2FA 1WEEA 4UI9B 1U6GB 2YU4A 4MVTA 3RPGB 2ECNA 3U5MA 5JG6A 2MA6A 2YREA 2VJEB 5AITA 2YHNA 3NG2A 2CT2A 1VD4A 2M1RA 2KYUA 1X4IA 1WEQA 2H0DA 5LKUA 1JM7B 2E6SA 2L43A 4LKAA 3SOUA 2KU3A 3ZNIA 4NN2A 4YBTA 2G43A 2UZGA 2QICA 2VPBA 3ZVYA 5LCWB 2CKLB 3GL6A 4YBSA 3HTKC 1Z60A 5TRBA 2ECTA 3N9NA 4XI1A 2G45A 3LQIA 2RI7A 3L1XA 1X4UA 2KWOA 2VPEA 5FB1A 4N4FA 3C5KA 3KV6A 2LDRA 3KQIA 2VJFA 4ZQLA 1X4JA 4UP0A 2K1JA 1V87A 3T6RA 2VNFA 4GNFA 4B86C 2C2LA 2LXPC 2KWKA 1DVPA 5TDWA 2KR4A 3KV5A 1WEPA 4QF2A 5B78A 2MT5A 5I3LA 1WEOA 3QZVA 5FERA 3N9MA 1WEMA 2VJEA 2OXQC 3PHDA 4QF3A 4R2YA 3O34A 4Q6FA 5B8DA 2K17A 2L5UA 3M99A 4I7BA 2Y43A 4FO9A 2M3HA 1HYIA 4ZDTA 2YURA 5KH3A 4ZUXU 3LQJA 1WE9A 5DKAA 5B75A 2FSAA 2Y1MA 4S3OB 4AVXA 4YABA 3ZTGA 3MHSA 3O70A 3O33A 4O64A 2AN6A 4PPEA 3SOWA 3KNVA 2Y1NA 2G6QA 4F52B 2LGGA 5D1KB 3RTRB 3DQVR 1WGMA 2RSDA 2YUCA 1FP0A 5G0FA 4LJNA 2PNXA 3I2DA 4N3WA 1WEWA 3O37A 4R8PK 5TABA 3LRQA 4I7CA 3PUQA 2LRIC 4L58A 4V3LC 1WEUA 2L80A 2XEUA 4X3GA 4W4UA 3RPGC 3ZPV1 5TBNA 4YADA 2VPGA 4YBMA 4P5OB 4AYCA 2L75A 4A49A 4L7XA 2K16A 2VPDA 2YYRA 4B7YC 2ECJA 1VYXA 2YQLA 3U5OA 2C2VS 5B79A 5G04B 2KE1A 2YSJA 4UP5A 5LKTA 2K4DA 4GNDA 2EODA 2BAYA 1HYJA 3N9QA 2YW8A 2M85A 4YAXA 3GV4A 4CCGX 4TKPB 2ZETC 3HCUA 3EB5A 3EB6A 3U5NA 3SOXA 2F6NA 4BBQA 1WIMA 4PTBA 5D1MB 5D1LB 2VP7A 3ASLA 1LDJB 2FUUA 2KIZA 1T1HA 4YC9A 4GNGA 5G05B 1VFYA 1WILA 2ECIA 5B76A 1JM7A 2KWNA 2LGKA 1IYMA 3V43A 2ECGA 2JRJA 5LKXA 4GNEA 2LQ6A 4FK5A 4IC3A 3L1ZB 5KH7A 3C6WA 5DINA 1XWHA 2CKLA 4LK9A 2XB1A 2PUYA 5H9MA 2JMJA 2YT5A 2YHOA 5C13A 2KWJA 2MD7B 2HYED 1WESA 4WZ0A 4S3OC 1N87A 3DPLR 4V3KC 1WEVA 2EGPA 2E6RA 2I50A 2IDAA 1RMDA 1E4UA 4LADB 2LGVA 5AIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  4MSX A;  2LGL A;  1F62 A;  1CHC A;  2CSZ A;  1WFK A;  2ECV A;  2F6J A;  2FUI A;  4AUQ B;  4C9Z A;  3N9L A;  2DX8 A;  5FB0 A;  4I7D A;  4YAT A;  2MUM A;  3ZVZ B;  4LLB A;  4FIP A;  1FBV A;  2JMI A;  1JOC A;  1G25 A;  3MHH A;  5H1T A;  2D8S A;  3ZYQ A;  5J3X A;  5KH9 A;  3T7L A;  1WEN A;  2H0D B;  1MM2 A;  4A4C A;  2EA6 A;  2CSY A;  2ECW A;  3ZPV E;  2KGI A;  5EYA F;  1LDK C;  1ZBD B;  2YQM A;  3SHB A;  4WA6 A;  2JMD A;  3FL2 A;  2HDP A;  2KGG A;  4R7E A;  4WZ3 B;  3IHP A;  3M62 A;  3O35 A;  2M6M A;  5C11 A;  2MNY A;  5H1V A;  4WZ2 A;  1Z2Q A;  3PUR A;  3O36 A;  2MD8 C;  2MNZ A;  2YSM A;  4AP4 A;  3HCS A;  4AYC B;  3N9P A;  4A4B A;  4BHW A;  5B77 A;  2MIQ A;  4FJC A;  5FEY A;  3LQH A;  2LN0 A;  4A0C D;  1BOR A;  4CA1 A;  2L0B A;  2LV9 A;  3O7A A;  3HCT A;  5TDR A;  2QJ0 A;  5H1U A;  3U5P A;  2LXH C;  1Z6U A;  3M63 A;  4IC2 A;  2KRE A;  2VJF B;  1MM3 A;  4GB0 A;  2QIZ A;  2F42 A;  3N9O A;  2NAA A;  2MA5 A;  3VK6 A;  2KFT A;  5LKZ A;  1K2F A;  1WEE A;  4UI9 B;  1U6G B;  2YU4 A;  4MVT A;  3RPG B;  2ECN A;  3U5M A;  5JG6 A;  2MA6 A;  2YRE A;  2VJE B;  5AIT A;  2YHN A;  3NG2 A;  2CT2 A;  1VD4 A;  2M1R A;  2KYU A;  1X4I A;  1WEQ A;  2H0D A;  5LKU A;  1JM7 B;  2E6S A;  2L43 A;  4LKA A;  3SOU A;  2KU3 A;  3ZNI A;  4NN2 A;  4YBT A;  2G43 A;  2UZG A;  2QIC A;  2VPB A;  3ZVY A;  5LCW B;  2CKL B;  3GL6 A;  4YBS A;  3HTK C;  1Z60 A;  5TRB A;  2ECT A;  3N9N A;  4XI1 A;  2G45 A;  3LQI A;  2RI7 A;  3L1X A;  1X4U A;  2KWO A;  2VPE A;  5FB1 A;  4N4F A;  3C5K A;  3KV6 A;  2LDR A;  3KQI A;  2VJF A;  4ZQL A;  1X4J A;  4UP0 A;  2K1J A;  1V87 A;  3T6R A;  2VNF A;  4GNF A;  4B86 C;  2C2L A;  2LXP C;  2KWK A;  1DVP A;  5TDW A;  2KR4 A;  3KV5 A;  1WEP A;  4QF2 A;  5B78 A;  2MT5 A;  5I3L A;  1WEO A;  3QZV A;  5FER A;  3N9M A;  1WEM A;  2VJE A;  2OXQ C;  3PHD A;  4QF3 A;  4R2Y A;  3O34 A;  4Q6F A;  5B8D A;  2K17 A;  2L5U A;  3M99 A;  4I7B A;  2Y43 A;  4FO9 A;  2M3H A;  1HYI A;  4ZDT A;  2YUR A;  5KH3 A;  4ZUX U;  3LQJ A;  1WE9 A;  5DKA A;  5B75 A;  2FSA A;  2Y1M A;  4S3O B;  4AVX A;  4YAB A;  3ZTG A;  3MHS A;  3O70 A;  3O33 A;  4O64 A;  2AN6 A;  4PPE A;  3SOW A;  3KNV A;  2Y1N A;  2G6Q A;  4F52 B;  2LGG A;  5D1K B;  3RTR B;  3DQV R;  1WGM A;  2RSD A;  2YUC A;  1FP0 A;  5G0F A;  4LJN A;  2PNX A;  3I2D A;  4N3W A;  1WEW A;  3O37 A;  4R8P K;  5TAB A;  3LRQ A;  4I7C A;  3PUQ A;  2LRI C;  4L58 A;  4V3L C;  1WEU A;  2L80 A;  2XEU A;  4X3G A;  4W4U A;  3RPG C;  3ZPV 1;  5TBN A;  4YAD A;  2VPG A;  4YBM A;  4P5O B;  4AYC A;  2L75 A;  4A49 A;  4L7X A;  2K16 A;  2VPD A;  2YYR A;  4B7Y C;  2ECJ A;  1VYX A;  2YQL A;  3U5O A;  2C2V S;  5B79 A;  5G04 B;  2KE1 A;  2YSJ A;  4UP5 A;  5LKT A;  2K4D A;  4GND A;  2EOD A;  2BAY A;  1HYJ A;  3N9Q A;  2YW8 A;  2M85 A;  4YAX A;  3GV4 A;  4CCG X;  4TKP B;  2ZET C;  3HCU A;  3EB5 A;  3EB6 A;  3U5N A;  3SOX A;  2F6N A;  4BBQ A;  1WIM A;  4PTB A;  5D1M B;  5D1L B;  2VP7 A;  3ASL A;  1LDJ B;  2FUU A;  2KIZ A;  1T1H A;  4YC9 A;  4GNG A;  5G05 B;  1VFY A;  1WIL A;  2ECI A;  5B76 A;  1JM7 A;  2KWN A;  2LGK A;  1IYM A;  3V43 A;  2ECG A;  2JRJ A;  5LKX A;  4GNE A;  2LQ6 A;  4FK5 A;  4IC3 A;  3L1Z B;  5KH7 A;  3C6W A;  5DIN A;  1XWH A;  2CKL A;  4LK9 A;  2XB1 A;  2PUY A;  5H9M A;  2JMJ A;  2YT5 A;  2YHO A;  5C13 A;  2KWJ A;  2MD7 B;  2HYE D;  1WES A;  4WZ0 A;  4S3O C;  1N87 A;  3DPL R;  4V3K C;  1WEV A;  2EGP A;  2E6R A;  2I50 A;  2IDA A;  1RMD A;  1E4U A;  4LAD B;  2LGV A;  5AIU A; 
#chains in the Genus database with same CATH topology
 2P57 A;  4F1P A;  3L11 A;  4MSX A;  2LGL A;  3SUB A;  1F62 A;  1CHC A;  5K3Q A;  2CSZ A;  1WFK A;  2ECV A;  2F6J A;  2FUI A;  4AUQ B;  4C9Z A;  3O47 A;  3N9L A;  2DX8 A;  3LDY A;  5FB0 A;  4I7D A;  4YAT A;  2KKX A;  2MUM A;  3ZVZ B;  4LLB A;  2DSM A;  4FIP A;  1FBV A;  2JMI A;  1JOC A;  1G25 A;  3MHH A;  3DWD A;  5H1T A;  2D8S A;  3ZYQ A;  5J3X A;  5SVX A;  5KH9 A;  3T7L A;  1WEN A;  2H0D B;  1MM2 A;  4A4C A;  2EA6 A;  2CSY A;  2ECW A;  3ZPV E;  2KGI A;  5EYA F;  1LDK C;  2XOZ A;  1ZBD B;  3MDB C;  2YQM A;  3SHB A;  4WA6 A;  2JMD A;  3FL2 A;  2HDP A;  2KGG A;  4R7E A;  4WZ3 B;  4Z0O A;  2XP0 A;  2M13 A;  3IHP A;  3LVR E;  3M62 A;  3O35 A;  2M6M A;  2EXU A;  5C11 A;  2MNY A;  5H1V A;  4WZ2 A;  1Z2Q A;  3PUR A;  4OGC A;  3O36 A;  2MD8 C;  2MNZ A;  2YSM A;  4AP4 A;  3HCS A;  2FFW A;  4AYC B;  3N9P A;  4A4B A;  4BHW A;  5B77 A;  2MIQ A;  4FJC A;  5FEY A;  3LQH A;  2LN0 A;  4A0C D;  1BOR A;  2CRR A;  4CA1 A;  2L0B A;  2LV9 A;  3O7A A;  3HCT A;  5TDR A;  2QJ0 A;  5H1U A;  3U5P A;  2LXH C;  2DJA A;  1Z6U A;  3M63 A;  4IC2 A;  2KRE A;  2VJF B;  3LVQ E;  3FJU B;  1MM3 A;  4GB0 A;  2QIZ A;  2F42 A;  3N9O A;  2NAA A;  2MA5 A;  3VK6 A;  2KFT A;  5LKZ A;  1K2F A;  1WEE A;  4UI9 B;  1U6G B;  2YU4 A;  4MVT A;  3RPG B;  2ECN A;  3U5M A;  5JG6 A;  2MA6 A;  2YRE A;  3E2D A;  2VJE B;  5AIT A;  2YHN A;  3NG2 A;  2CT2 A;  4OGE A;  1VD4 A;  3FM8 C;  2M1R A;  2KYU A;  1X4I A;  1WEQ A;  2E61 A;  2H0D A;  3T9K A;  5LKU A;  1JM7 B;  2E6S A;  2L43 A;  4LKA A;  3SOU A;  2MKE A;  2KU3 A;  2KKY A;  3ZNI A;  3JUE A;  4NN2 A;  4YBT A;  2G43 A;  2UZG A;  3FAN A;  2QIC A;  3FAO A;  2VPB A;  3ZVY A;  5LCW B;  2CKL B;  3GL6 A;  4YBS A;  3HTK C;  1Z60 A;  5TRB A;  2ECT A;  5SVI B;  3N9N A;  4XI1 A;  2G45 A;  3LQI A;  2RI7 A;  3L1X A;  1X4U A;  2KWO A;  2VPE A;  5FB1 A;  4N4F A;  3C5K A;  3KV6 A;  3LJU X;  2LDR A;  3KQI A;  2VJF A;  4ZQL A;  1X4J A;  4UP0 A;  2K1J A;  1V87 A;  3T6R A;  2VNF A;  4GNF A;  2IQJ A;  4B86 C;  2C2L A;  2LXP C;  2KWK A;  2CON A;  1DVP A;  5TDW A;  2KR4 A;  3KV5 A;  2RR4 A;  1WEP A;  4QF2 A;  5B78 A;  2MT5 A;  5I3L A;  1WEO A;  3QZV A;  5FER A;  2JM3 A;  3M7K A;  3N9M A;  4Z0R A;  1WEM A;  2VJE A;  2OXQ C;  3PHD A;  4QF3 A;  4R2Y A;  3O34 A;  4Q6F A;  5B8D A;  2K17 A;  2YVR A;  2L5U A;  3M99 A;  4I7B A;  2Y43 A;  4FO9 A;  2M3H A;  1HYI A;  4ZDT A;  2YUR A;  5KH3 A;  4ZUX U;  3LQJ A;  1WE9 A;  1DCQ A;  5DKA A;  5B75 A;  2FSA A;  3KDE C;  2Y1M A;  4S3O B;  3PLW A;  4AVX A;  4YAB A;  3ZTG A;  3MHS A;  3O70 A;  3O33 A;  4O64 A;  2AN6 A;  1MBM A;  4PPE A;  2JUN A;  3SOW A;  3KNV A;  2Y1N A;  2G6Q A;  4F52 B;  5SVI A;  2LGG A;  5D1K B;  3RTR B;  2CRW A;  3DQV R;  1WGM A;  2RSD A;  2YUC A;  1FP0 A;  5G0F A;  4LJN A;  2PNX A;  3I2D A;  4N3W A;  1WEW A;  3O37 A;  4R8P K;  5TAB A;  3LRQ A;  4I7C A;  3PUQ A;  2LRI C;  4L58 A;  4V3L C;  1WEU A;  2L80 A;  2XEU A;  4X3G A;  4W4U A;  3DDT A;  3RPG C;  3Q1D A;  3ZPV 1;  5TBN A;  4YAD A;  2XOC A;  2VPG A;  4YBM A;  4P5O B;  4AYC A;  2L75 A;  4A49 A;  2D8U A;  4L7X A;  2K16 A;  2VPD A;  2YYR A;  4H9D A;  4B7Y C;  2ECJ A;  1VYX A;  2YQL A;  3U5O A;  3FEH A;  2C2V S;  5B79 A;  5G04 B;  2KE1 A;  2YSJ A;  4UP5 A;  3H7H A;  5LKT A;  2K4D A;  4GND A;  5SVY A;  2EOD A;  2BAY A;  1HYJ A;  3N9Q A;  2YW8 A;  2CSV A;  2M85 A;  4YAX A;  3GV4 A;  4CCG X;  4TKP B;  2XOY A;  2ZET C;  3HCU A;  3EB5 A;  3EB6 A;  3U5N A;  3SOX A;  2F6N A;  4BBQ A;  1WIM A;  2B0O E;  4PTB A;  5D1M B;  5D1L B;  2VP7 A;  3ASL A;  1LDJ B;  2FUU A;  2KIZ A;  1T1H A;  4YC9 A;  4GNG A;  5G05 B;  1VFY A;  1WIL A;  2ECI A;  5B76 A;  1JM7 A;  2KWN A;  4QQ4 A;  2LGK A;  1IYM A;  3V43 A;  2ECG A;  2JRJ A;  5LKX A;  4GNE A;  2LQ6 A;  4FK5 A;  4IC3 A;  2LAU A;  3L1Z B;  5KH7 A;  3C6W A;  5DIN A;  1XWH A;  2CKL A;  4LK9 A;  2XB1 A;  2PUY A;  5H9M A;  2JMJ A;  2YT5 A;  2EGM A;  2YHO A;  5C13 A;  2KWJ A;  4O62 A;  2MD7 B;  2HYE D;  2FD4 A;  1WES A;  4WZ0 A;  4S3O C;  1N87 A;  3DPL R;  4V3K C;  1WEV A;  2EGP A;  2E6R A;  2I50 A;  2IDA A;  2OWA A;  1RMD A;  1E4U A;  2L7P A;  4LAD B;  2LGV A;  5AIU A; 
#chains in the Genus database with same CATH homology
 3L11 A;  4MSX A;  2LGL A;  1F62 A;  1CHC A;  2CSZ A;  1WFK A;  2ECV A;  2F6J A;  2FUI A;  4AUQ B;  4C9Z A;  3N9L A;  2DX8 A;  5FB0 A;  4I7D A;  4YAT A;  2MUM A;  3ZVZ B;  4LLB A;  4FIP A;  1FBV A;  2JMI A;  1JOC A;  1G25 A;  3MHH A;  5H1T A;  2D8S A;  3ZYQ A;  5J3X A;  5KH9 A;  3T7L A;  1WEN A;  2H0D B;  1MM2 A;  4A4C A;  2EA6 A;  2CSY A;  2ECW A;  3ZPV E;  2KGI A;  5EYA F;  1LDK C;  1ZBD B;  2YQM A;  3SHB A;  4WA6 A;  2JMD A;  3FL2 A;  2HDP A;  2KGG A;  4R7E A;  4WZ3 B;  3IHP A;  3M62 A;  3O35 A;  2M6M A;  5C11 A;  2MNY A;  5H1V A;  4WZ2 A;  1Z2Q A;  3PUR A;  3O36 A;  2MD8 C;  2MNZ A;  2YSM A;  4AP4 A;  3HCS A;  4AYC B;  3N9P A;  4A4B A;  4BHW A;  5B77 A;  2MIQ A;  4FJC A;  5FEY A;  3LQH A;  2LN0 A;  4A0C D;  1BOR A;  4CA1 A;  2L0B A;  2LV9 A;  3O7A A;  3HCT A;  5TDR A;  2QJ0 A;  5H1U A;  3U5P A;  2LXH C;  1Z6U A;  3M63 A;  4IC2 A;  2KRE A;  2VJF B;  1MM3 A;  4GB0 A;  2QIZ A;  2F42 A;  3N9O A;  2NAA A;  2MA5 A;  3VK6 A;  2KFT A;  5LKZ A;  1K2F A;  1WEE A;  4UI9 B;  1U6G B;  2YU4 A;  4MVT A;  3RPG B;  2ECN A;  3U5M A;  5JG6 A;  2MA6 A;  2YRE A;  2VJE B;  5AIT A;  2YHN A;  3NG2 A;  2CT2 A;  1VD4 A;  2M1R A;  2KYU A;  1X4I A;  1WEQ A;  2H0D A;  5LKU A;  1JM7 B;  2E6S A;  2L43 A;  4LKA A;  3SOU A;  2KU3 A;  3ZNI A;  4NN2 A;  4YBT A;  2G43 A;  2UZG A;  2QIC A;  2VPB A;  3ZVY A;  5LCW B;  2CKL B;  3GL6 A;  4YBS A;  3HTK C;  1Z60 A;  5TRB A;  2ECT A;  3N9N A;  4XI1 A;  2G45 A;  3LQI A;  2RI7 A;  3L1X A;  1X4U A;  2KWO A;  2VPE A;  5FB1 A;  4N4F A;  3C5K A;  3KV6 A;  2LDR A;  3KQI A;  2VJF A;  4ZQL A;  1X4J A;  4UP0 A;  2K1J A;  1V87 A;  3T6R A;  2VNF A;  4GNF A;  4B86 C;  2C2L A;  2LXP C;  2KWK A;  1DVP A;  5TDW A;  2KR4 A;  3KV5 A;  1WEP A;  4QF2 A;  5B78 A;  2MT5 A;  5I3L A;  1WEO A;  3QZV A;  5FER A;  3N9M A;  1WEM A;  2VJE A;  2OXQ C;  3PHD A;  4QF3 A;  4R2Y A;  3O34 A;  4Q6F A;  5B8D A;  2K17 A;  2L5U A;  3M99 A;  4I7B A;  2Y43 A;  4FO9 A;  2M3H A;  1HYI A;  4ZDT A;  2YUR A;  5KH3 A;  4ZUX U;  3LQJ A;  1WE9 A;  5DKA A;  5B75 A;  2FSA A;  2Y1M A;  4S3O B;  4AVX A;  4YAB A;  3ZTG A;  3MHS A;  3O70 A;  3O33 A;  4O64 A;  2AN6 A;  4PPE A;  3SOW A;  3KNV A;  2Y1N A;  2G6Q A;  4F52 B;  2LGG A;  5D1K B;  3RTR B;  3DQV R;  1WGM A;  2RSD A;  2YUC A;  1FP0 A;  5G0F A;  4LJN A;  2PNX A;  3I2D A;  4N3W A;  1WEW A;  3O37 A;  4R8P K;  5TAB A;  3LRQ A;  4I7C A;  3PUQ A;  2LRI C;  4L58 A;  4V3L C;  1WEU A;  2L80 A;  2XEU A;  4X3G A;  4W4U A;  3RPG C;  3ZPV 1;  5TBN A;  4YAD A;  2VPG A;  4YBM A;  4P5O B;  4AYC A;  2L75 A;  4A49 A;  4L7X A;  2K16 A;  2VPD A;  2YYR A;  4B7Y C;  2ECJ A;  1VYX A;  2YQL A;  3U5O A;  2C2V S;  5B79 A;  5G04 B;  2KE1 A;  2YSJ A;  4UP5 A;  5LKT A;  2K4D A;  4GND A;  2EOD A;  2BAY A;  1HYJ A;  3N9Q A;  2YW8 A;  2M85 A;  4YAX A;  3GV4 A;  4CCG X;  4TKP B;  2ZET C;  3HCU A;  3EB5 A;  3EB6 A;  3U5N A;  3SOX A;  2F6N A;  4BBQ A;  1WIM A;  4PTB A;  5D1M B;  5D1L B;  2VP7 A;  3ASL A;  1LDJ B;  2FUU A;  2KIZ A;  1T1H A;  4YC9 A;  4GNG A;  5G05 B;  1VFY A;  1WIL A;  2ECI A;  5B76 A;  1JM7 A;  2KWN A;  2LGK A;  1IYM A;  3V43 A;  2ECG A;  2JRJ A;  5LKX A;  4GNE A;  2LQ6 A;  4FK5 A;  4IC3 A;  3L1Z B;  5KH7 A;  3C6W A;  5DIN A;  1XWH A;  2CKL A;  4LK9 A;  2XB1 A;  2PUY A;  5H9M A;  2JMJ A;  2YT5 A;  2YHO A;  5C13 A;  2KWJ A;  2MD7 B;  2HYE D;  1WES A;  4WZ0 A;  4S3O C;  1N87 A;  3DPL R;  4V3K C;  1WEV A;  2EGP A;  2E6R A;  2I50 A;  2IDA A;  1RMD A;  1E4U A;  4LAD B;  2LGV A;  5AIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...