1WE9A

Solution structure of phd domain in nucleic acid binding protein-like np_197993
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
64
structure length
64
Chain Sequence
GSSGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in nucleic acid binding protein-like NP_197993
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords PHD finger family protein
total genus 6
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1we9A00
1ZBDB 1Z6UA 4YBSA 2ECGA 4AUQB 2VNFA 1VFYA 1VYXA 2MA6A 3QZVA 5DKAA 4AP4A 2KE1A 3ASLA 2KGIA 4I7CA 1WEQA 4L58A 2FSAA 2FUIA 3O37A 2VJFB 4FJCA 5I3LA 5DINA 2PNXA 2F6JA 2LGKA 2LXHC 4L7XA 3I2DA 2CKLB 4B7YC 2K17A 2K1JA 2PUYA 3PUQA 2LGGA 3U5MA 1X4UA 2XB1A 1U6GB 2KREA 4QF3A 5KH9A 2DX8A 2YW8A 2E6SA 3SHBA 2RSDA 3ZVYA 5AIUA 2VPDA 2KWOA 2CSYA 2YREA 2G43A 1XWHA 4GNDA 5B77A 3RTRB 4YADA 2MD8C 2L75A 2ECIA 2JMIA 5D1KB 1WE9A 1WEOA 4O64A 3O36A 2EGPA 3IHPA 3LQJA 1X4JA 4R2YA 4BHWA 3U5OA 1RMDA 1WEPA 1BORA 2ECVA 1JM7B 3EB6A 2MNYA 5H1VA 2MUMA 3V43A 4LK9A 5KH7A 4GB0A 4ZDTA 4TKPB 2LXPC 3LQIA 4ZQLA 2FUUA 4LKAA 3LQHA 4MSXA 3T7LA 2LV9A 4I7DA 3C5KA 2RI7A 2G6QA 4YATA 1Z60A 2YQMA 4A4CA 4BBQA 4N4FA 2C2VS 5TDRA 5G04B 3O33A 4AVXA 2KWKA 2H0DB 2LQ6A 4NN2A 3ZNIA 4AYCB 2KU3A 4P5OB 4FIPA 3ZPV1 2LRIC 2LGVA 4S3OC 2M6MA 5LKTA 2M85A 3N9LA 2K16A 5B79A 2YHNA 5C11A 5FB1A 3O35A 4PPEA 3HCUA 3ZVZB 4UP0A 1X4IA 2ECNA 3ZYQA 5LKZA 1FBVA 2UZGA 2MD7B 4R7EA 5TDWA 4YABA 2YQLA 2YURA 3SOUA 3C6WA 2C2LA 5TBNA 2KWJA 2KYUA 3U5PA 2VPEA 2ZETC 1CHCA 3L11A 3O7AA 5TRBA 4IC2A 1WIMA 1WEUA 2VJEB 4A49A 4WA6A 5LKXA 2L5UA 2Y1NA 1HYJA 3U5NA 2M3HA 2QIZA 5B8DA 5H9MA 3SOXA 4YAXA 2AN6A 5LKUA 1E4UA 5KH3A 3VK6A 4ZUXU 3NG2A 4WZ0A 5TABA 4N3WA 2CT2A 3M62A 3M99A 1WENA 1DVPA 2QICA 4CCGX 4W4UA 1WFKA 4YC9A 2Y43A 3GL6A 3L1XA 3FL2A 1Z2QA 3KNVA 3N9PA 4LJNA 1K2FA 5C13A 2JMJA 1WEMA 3SOWA 1MM3A 4R8PK 4C9ZA 3HTKC 2VJEA 4MVTA 4X3GA 5D1LB 1HYIA 5FB0A 2HDPA 3PURA 2EA6A 2YUCA 3EB5A 4V3KC 1T1HA 4F52B 2Y1MA 5H1UA 4YBMA 1IYMA 4WZ2A 2EODA 3HCTA 4QF2A 4I7BA 4LLBA 2OXQC 2KIZA 2I50A 1MM2A 1FP0A 2IDAA 1VD4A 2YSMA 4FK5A 3N9OA 2KR4A 3GV4A 5FERA 5G05B 4Q6FA 3MHSA 1LDJB 2JMDA 4XI1A 4AYCA 3KV6A 4S3OB 2K4DA 3KV5A 3O34A 4UP5A 2VPBA 5EYAF 2YT5A 1V87A 2G45A 3N9MA 4YBTA 1G25A 5D1MB 2YU4A 4PTBA 2KGGA 2MIQA 3T6RA 2L80A 2QJ0A 5B78A 2H0DA 2L43A 1LDKC 1WILA 2YHOA 5J3XA 2BAYA 1WEVA 2MNZA 2KFTA 5JG6A 5B75A 2CSZA 3KQIA 1JOCA 5H1TA 1WEWA 2YYRA 4UI9B 5FEYA 5LCWB 2JRJA 3ZPVE 1WGMA 1WEEA 4WZ3B 2VJFA 1WESA 2E6RA 3M63A 2YSJA 1N87A 4LADB 5B76A 3N9QA 3N9NA 3RPGB 2M1RA 3HCSA 2F42A 2L0BA 2MA5A 4GNEA 2LGLA 3L1ZB 2VPGA 5AITA 2CKLA 2XEUA 1F62A 2ECWA 2F6NA 2ECTA 2HYED 4FO9A 4GNGA 2NAAA 3MHHA 4A0CD 3RPGC 4V3LC 3DQVR 1JM7A 2KWNA 3DPLR 2LN0A 4CA1A 2VP7A 2D8SA 2MT5A 2ECJA 5G0FA 3ZTGA 3LRQA 4GNFA 3O70A 4IC3A 2LDRA 4B86C 4A4BA 3PHDA
chains in the Genus database with same CATH superfamily
3FJUB 1ZBDB 3PLWA 1Z6UA 4YBSA 2ECGA 2CSVA 3E2DA 4AUQB 2VNFA 2D8UA 1VFYA 1VYXA 2MA6A 3QZVA 5DKAA 4AP4A 2KE1A 3ASLA 2KGIA 2EGMA 3LJUX 4I7CA 1WEQA 4L58A 2FSAA 2FUIA 2JM3A 3O37A 2VJFB 4FJCA 5I3LA 5DINA 2PNXA 2F6JA 2LGKA 2LXHC 2XP0A 4L7XA 3I2DA 2CKLB 4B7YC 2K17A 2K1JA 2PUYA 3PUQA 2LGGA 3U5MA 1X4UA 2XB1A 1U6GB 2KREA 4QF3A 5KH9A 2DX8A 2YW8A 2E6SA 3SHBA 2RSDA 5SVIA 3ZVYA 5AIUA 2VPDA 2KWOA 2CSYA 2YREA 2LAUA 2G43A 2KKYA 1XWHA 4GNDA 5B77A 3RTRB 4YADA 2CONA 2MD8C 2L75A 2ECIA 2JMIA 5D1KB 1WE9A 1WEOA 3FEHA 4O64A 3O36A 2EGPA 3IHPA 4QQ4A 3LQJA 1X4JA 4R2YA 4BHWA 3U5OA 1RMDA 1WEPA 1BORA 2ECVA 1JM7B 3EB6A 2MNYA 5H1VA 2MUMA 3V43A 4LK9A 5KH7A 4GB0A 4ZDTA 2CRWA 4TKPB 2RR4A 2LXPC 2DSMA 3LQIA 4ZQLA 2FUUA 2FFWA 4LKAA 3LVRE 3DDTA 3LQHA 4MSXA 3T7LA 2LV9A 4I7DA 3C5KA 2RI7A 2G6QA 4YATA 1Z60A 2YQMA 4A4CA 4BBQA 4N4FA 2C2VS 5TDRA 5G04B 3O33A 4AVXA 2KWKA 3DWDA 2H0DB 2LQ6A 4NN2A 3ZNIA 4AYCB 2KU3A 4P5OB 4FIPA 3ZPV1 2LRIC 2LGVA 4S3OC 2M6MA 5LKTA 2M85A 3N9LA 4Z0OA 2K16A 5B79A 3LVQE 2YHNA 5C11A 5FB1A 3O35A 4PPEA 3HCUA 3ZVZB 4UP0A 1X4IA 2ECNA 3ZYQA 5LKZA 1FBVA 2UZGA 2MKEA 2MD7B 4R7EA 5TDWA 4YABA 2YQLA 2YURA 3SOUA 3C6WA 2C2LA 5TBNA 4OGEA 2FD4A 2KWJA 2KYUA 2XOZA 3U5PA 2VPEA 2ZETC 1CHCA 3L11A 3O7AA 5TRBA 1DCQA 4IC2A 1WIMA 1WEUA 2VJEB 4O62A 4A49A 4WA6A 5LKXA 2L5UA 2Y1NA 1HYJA 3U5NA 2M3HA 2QIZA 5B8DA 5H9MA 3SOXA 4YAXA 2AN6A 5LKUA 1E4UA 4H9DA 5KH3A 3VK6A 4ZUXU 3NG2A 4WZ0A 5TABA 4N3WA 2CRRA 2CT2A 3M62A 3M99A 1WENA 1DVPA 2QICA 4CCGX 4Z0RA 4W4UA 1WFKA 4YC9A 2Y43A 3GL6A 3L1XA 3FL2A 1Z2QA 3KNVA 3N9PA 4LJNA 5SVXA 1K2FA 5C13A 2JMJA 1WEMA 3H7HA 3SOWA 1MM3A 4R8PK 1MBMA 4C9ZA 3HTKC 2VJEA 4MVTA 4X3GA 5D1LB 2JUNA 1HYIA 5FB0A 2HDPA 3PURA 2B0OE 2EA6A 2YUCA 3EB5A 2YVRA 4V3KC 1T1HA 3SUBA 4F52B 3KDEC 2P57A 2Y1MA 5H1UA 2OWAA 2XOCA 4YBMA 1IYMA 4WZ2A 2EODA 3HCTA 4QF2A 4I7BA 4LLBA 2OXQC 2KIZA 2I50A 1MM2A 1FP0A 2IDAA 1VD4A 2YSMA 3FM8C 2M13A 4FK5A 3N9OA 2KR4A 3GV4A 5FERA 5G05B 4Q6FA 3MHSA 1LDJB 2JMDA 5SVIB 4XI1A 3JUEA 4AYCA 3KV6A 4S3OB 3MDBC 2K4DA 3KV5A 3O34A 4UP5A 2VPBA 5EYAF 2YT5A 2E61A 1V87A 2G45A 3N9MA 4YBTA 1G25A 5D1MB 2YU4A 4PTBA 2KGGA 2IQJA 2MIQA 3T6RA 2L80A 2QJ0A 5B78A 2H0DA 2KKXA 2L43A 1LDKC 1WILA 2YHOA 5J3XA 2BAYA 1WEVA 2MNZA 3M7KA 2DJAA 2KFTA 5JG6A 5B75A 2CSZA 3KQIA 1JOCA 3T9KA 5H1TA 1WEWA 2YYRA 4UI9B 5FEYA 3FAOA 5LCWB 2JRJA 3ZPVE 1WGMA 4F1PA 1WEEA 4WZ3B 4OGCA 2VJFA 1WESA 2E6RA 3M63A 2YSJA 1N87A 4LADB 5B76A 3LDYA 2XOYA 3N9QA 3N9NA 3RPGB 2M1RA 3HCSA 2F42A 2L7PA 2L0BA 2MA5A 4GNEA 2LGLA 3L1ZB 2VPGA 5AITA 2CKLA 2XEUA 1F62A 2EXUA 5K3QA 2ECWA 2F6NA 2ECTA 2HYED 4FO9A 4GNGA 2NAAA 3MHHA 4A0CD 3FANA 3RPGC 4V3LC 3DQVR 1JM7A 2KWNA 3DPLR 2LN0A 4CA1A 2VP7A 2D8SA 2MT5A 2ECJA 5G0FA 5SVYA 3ZTGA 3LRQA 3Q1DA 4GNFA 3O70A 4IC3A 2LDRA 4B86C 3O47A 4A4BA 3PHDA
chains in the Genus database with same CATH topology
1ZBDB 1Z6UA 4YBSA 2ECGA 4AUQB 2VNFA 1VFYA 1VYXA 2MA6A 3QZVA 5DKAA 4AP4A 2KE1A 3ASLA 2KGIA 4I7CA 1WEQA 4L58A 2FSAA 2FUIA 3O37A 2VJFB 4FJCA 5I3LA 5DINA 2PNXA 2F6JA 2LGKA 2LXHC 4L7XA 3I2DA 2CKLB 4B7YC 2K17A 2K1JA 2PUYA 3PUQA 2LGGA 3U5MA 1X4UA 2XB1A 1U6GB 2KREA 4QF3A 5KH9A 2DX8A 2YW8A 2E6SA 3SHBA 2RSDA 3ZVYA 5AIUA 2VPDA 2KWOA 2CSYA 2YREA 2G43A 1XWHA 4GNDA 5B77A 3RTRB 4YADA 2MD8C 2L75A 2ECIA 2JMIA 5D1KB 1WE9A 1WEOA 4O64A 3O36A 2EGPA 3IHPA 3LQJA 1X4JA 4R2YA 4BHWA 3U5OA 1RMDA 1WEPA 1BORA 2ECVA 1JM7B 3EB6A 2MNYA 5H1VA 2MUMA 3V43A 4LK9A 5KH7A 4GB0A 4ZDTA 4TKPB 2LXPC 3LQIA 4ZQLA 2FUUA 4LKAA 3LQHA 4MSXA 3T7LA 2LV9A 4I7DA 3C5KA 2RI7A 2G6QA 4YATA 1Z60A 2YQMA 4A4CA 4BBQA 4N4FA 2C2VS 5TDRA 5G04B 3O33A 4AVXA 2KWKA 2H0DB 2LQ6A 4NN2A 3ZNIA 4AYCB 2KU3A 4P5OB 4FIPA 3ZPV1 2LRIC 2LGVA 4S3OC 2M6MA 5LKTA 2M85A 3N9LA 2K16A 5B79A 2YHNA 5C11A 5FB1A 3O35A 4PPEA 3HCUA 3ZVZB 4UP0A 1X4IA 2ECNA 3ZYQA 5LKZA 1FBVA 2UZGA 2MD7B 4R7EA 5TDWA 4YABA 2YQLA 2YURA 3SOUA 3C6WA 2C2LA 5TBNA 2KWJA 2KYUA 3U5PA 2VPEA 2ZETC 1CHCA 3L11A 3O7AA 5TRBA 4IC2A 1WIMA 1WEUA 2VJEB 4A49A 4WA6A 5LKXA 2L5UA 2Y1NA 1HYJA 3U5NA 2M3HA 2QIZA 5B8DA 5H9MA 3SOXA 4YAXA 2AN6A 5LKUA 1E4UA 5KH3A 3VK6A 4ZUXU 3NG2A 4WZ0A 5TABA 4N3WA 2CT2A 3M62A 3M99A 1WENA 1DVPA 2QICA 4CCGX 4W4UA 1WFKA 4YC9A 2Y43A 3GL6A 3L1XA 3FL2A 1Z2QA 3KNVA 3N9PA 4LJNA 1K2FA 5C13A 2JMJA 1WEMA 3SOWA 1MM3A 4R8PK 4C9ZA 3HTKC 2VJEA 4MVTA 4X3GA 5D1LB 1HYIA 5FB0A 2HDPA 3PURA 2EA6A 2YUCA 3EB5A 4V3KC 1T1HA 4F52B 2Y1MA 5H1UA 4YBMA 1IYMA 4WZ2A 2EODA 3HCTA 4QF2A 4I7BA 4LLBA 2OXQC 2KIZA 2I50A 1MM2A 1FP0A 2IDAA 1VD4A 2YSMA 4FK5A 3N9OA 2KR4A 3GV4A 5FERA 5G05B 4Q6FA 3MHSA 1LDJB 2JMDA 4XI1A 4AYCA 3KV6A 4S3OB 2K4DA 3KV5A 3O34A 4UP5A 2VPBA 5EYAF 2YT5A 1V87A 2G45A 3N9MA 4YBTA 1G25A 5D1MB 2YU4A 4PTBA 2KGGA 2MIQA 3T6RA 2L80A 2QJ0A 5B78A 2H0DA 2L43A 1LDKC 1WILA 2YHOA 5J3XA 2BAYA 1WEVA 2MNZA 2KFTA 5JG6A 5B75A 2CSZA 3KQIA 1JOCA 5H1TA 1WEWA 2YYRA 4UI9B 5FEYA 5LCWB 2JRJA 3ZPVE 1WGMA 1WEEA 4WZ3B 2VJFA 1WESA 2E6RA 3M63A 2YSJA 1N87A 4LADB 5B76A 3N9QA 3N9NA 3RPGB 2M1RA 3HCSA 2F42A 2L0BA 2MA5A 4GNEA 2LGLA 3L1ZB 2VPGA 5AITA 2CKLA 2XEUA 1F62A 2ECWA 2F6NA 2ECTA 2HYED 4FO9A 4GNGA 2NAAA 3MHHA 4A0CD 3RPGC 4V3LC 3DQVR 1JM7A 2KWNA 3DPLR 2LN0A 4CA1A 2VP7A 2D8SA 2MT5A 2ECJA 5G0FA 3ZTGA 3LRQA 4GNFA 3O70A 4IC3A 2LDRA 4B86C 4A4BA 3PHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBD B;  1Z6U A;  4YBS A;  2ECG A;  4AUQ B;  2VNF A;  1VFY A;  1VYX A;  2MA6 A;  3QZV A;  5DKA A;  4AP4 A;  2KE1 A;  3ASL A;  2KGI A;  4I7C A;  1WEQ A;  4L58 A;  2FSA A;  2FUI A;  3O37 A;  2VJF B;  4FJC A;  5I3L A;  5DIN A;  2PNX A;  2F6J A;  2LGK A;  2LXH C;  4L7X A;  3I2D A;  2CKL B;  4B7Y C;  2K17 A;  2K1J A;  2PUY A;  3PUQ A;  2LGG A;  3U5M A;  1X4U A;  2XB1 A;  1U6G B;  2KRE A;  4QF3 A;  5KH9 A;  2DX8 A;  2YW8 A;  2E6S A;  3SHB A;  2RSD A;  3ZVY A;  5AIU A;  2VPD A;  2KWO A;  2CSY A;  2YRE A;  2G43 A;  1XWH A;  4GND A;  5B77 A;  3RTR B;  4YAD A;  2MD8 C;  2L75 A;  2ECI A;  2JMI A;  5D1K B;  1WE9 A;  1WEO A;  4O64 A;  3O36 A;  2EGP A;  3IHP A;  3LQJ A;  1X4J A;  4R2Y A;  4BHW A;  3U5O A;  1RMD A;  1WEP A;  1BOR A;  2ECV A;  1JM7 B;  3EB6 A;  2MNY A;  5H1V A;  2MUM A;  3V43 A;  4LK9 A;  5KH7 A;  4GB0 A;  4ZDT A;  4TKP B;  2LXP C;  3LQI A;  4ZQL A;  2FUU A;  4LKA A;  3LQH A;  4MSX A;  3T7L A;  2LV9 A;  4I7D A;  3C5K A;  2RI7 A;  2G6Q A;  4YAT A;  1Z60 A;  2YQM A;  4A4C A;  4BBQ A;  4N4F A;  2C2V S;  5TDR A;  5G04 B;  3O33 A;  4AVX A;  2KWK A;  2H0D B;  2LQ6 A;  4NN2 A;  3ZNI A;  4AYC B;  2KU3 A;  4P5O B;  4FIP A;  3ZPV 1;  2LRI C;  2LGV A;  4S3O C;  2M6M A;  5LKT A;  2M85 A;  3N9L A;  2K16 A;  5B79 A;  2YHN A;  5C11 A;  5FB1 A;  3O35 A;  4PPE A;  3HCU A;  3ZVZ B;  4UP0 A;  1X4I A;  2ECN A;  3ZYQ A;  5LKZ A;  1FBV A;  2UZG A;  2MD7 B;  4R7E A;  5TDW A;  4YAB A;  2YQL A;  2YUR A;  3SOU A;  3C6W A;  2C2L A;  5TBN A;  2KWJ A;  2KYU A;  3U5P A;  2VPE A;  2ZET C;  1CHC A;  3L11 A;  3O7A A;  5TRB A;  4IC2 A;  1WIM A;  1WEU A;  2VJE B;  4A49 A;  4WA6 A;  5LKX A;  2L5U A;  2Y1N A;  1HYJ A;  3U5N A;  2M3H A;  2QIZ A;  5B8D A;  5H9M A;  3SOX A;  4YAX A;  2AN6 A;  5LKU A;  1E4U A;  5KH3 A;  3VK6 A;  4ZUX U;  3NG2 A;  4WZ0 A;  5TAB A;  4N3W A;  2CT2 A;  3M62 A;  3M99 A;  1WEN A;  1DVP A;  2QIC A;  4CCG X;  4W4U A;  1WFK A;  4YC9 A;  2Y43 A;  3GL6 A;  3L1X A;  3FL2 A;  1Z2Q A;  3KNV A;  3N9P A;  4LJN A;  1K2F A;  5C13 A;  2JMJ A;  1WEM A;  3SOW A;  1MM3 A;  4R8P K;  4C9Z A;  3HTK C;  2VJE A;  4MVT A;  4X3G A;  5D1L B;  1HYI A;  5FB0 A;  2HDP A;  3PUR A;  2EA6 A;  2YUC A;  3EB5 A;  4V3K C;  1T1H A;  4F52 B;  2Y1M A;  5H1U A;  4YBM A;  1IYM A;  4WZ2 A;  2EOD A;  3HCT A;  4QF2 A;  4I7B A;  4LLB A;  2OXQ C;  2KIZ A;  2I50 A;  1MM2 A;  1FP0 A;  2IDA A;  1VD4 A;  2YSM A;  4FK5 A;  3N9O A;  2KR4 A;  3GV4 A;  5FER A;  5G05 B;  4Q6F A;  3MHS A;  1LDJ B;  2JMD A;  4XI1 A;  4AYC A;  3KV6 A;  4S3O B;  2K4D A;  3KV5 A;  3O34 A;  4UP5 A;  2VPB A;  5EYA F;  2YT5 A;  1V87 A;  2G45 A;  3N9M A;  4YBT A;  1G25 A;  5D1M B;  2YU4 A;  4PTB A;  2KGG A;  2MIQ A;  3T6R A;  2L80 A;  2QJ0 A;  5B78 A;  2H0D A;  2L43 A;  1LDK C;  1WIL A;  2YHO A;  5J3X A;  2BAY A;  1WEV A;  2MNZ A;  2KFT A;  5JG6 A;  5B75 A;  2CSZ A;  3KQI A;  1JOC A;  5H1T A;  1WEW A;  2YYR A;  4UI9 B;  5FEY A;  5LCW B;  2JRJ A;  3ZPV E;  1WGM A;  1WEE A;  4WZ3 B;  2VJF A;  1WES A;  2E6R A;  3M63 A;  2YSJ A;  1N87 A;  4LAD B;  5B76 A;  3N9Q A;  3N9N A;  3RPG B;  2M1R A;  3HCS A;  2F42 A;  2L0B A;  2MA5 A;  4GNE A;  2LGL A;  3L1Z B;  2VPG A;  5AIT A;  2CKL A;  2XEU A;  1F62 A;  2ECW A;  2F6N A;  2ECT A;  2HYE D;  4FO9 A;  4GNG A;  2NAA A;  3MHH A;  4A0C D;  3RPG C;  4V3L C;  3DQV R;  1JM7 A;  2KWN A;  3DPL R;  2LN0 A;  4CA1 A;  2VP7 A;  2D8S A;  2MT5 A;  2ECJ A;  5G0F A;  3ZTG A;  3LRQ A;  4GNF A;  3O70 A;  4IC3 A;  2LDR A;  4B86 C;  4A4B A;  3PHD A; 
#chains in the Genus database with same CATH topology
 3FJU B;  1ZBD B;  3PLW A;  1Z6U A;  4YBS A;  2ECG A;  2CSV A;  3E2D A;  4AUQ B;  2VNF A;  2D8U A;  1VFY A;  1VYX A;  2MA6 A;  3QZV A;  5DKA A;  4AP4 A;  2KE1 A;  3ASL A;  2KGI A;  2EGM A;  3LJU X;  4I7C A;  1WEQ A;  4L58 A;  2FSA A;  2FUI A;  2JM3 A;  3O37 A;  2VJF B;  4FJC A;  5I3L A;  5DIN A;  2PNX A;  2F6J A;  2LGK A;  2LXH C;  2XP0 A;  4L7X A;  3I2D A;  2CKL B;  4B7Y C;  2K17 A;  2K1J A;  2PUY A;  3PUQ A;  2LGG A;  3U5M A;  1X4U A;  2XB1 A;  1U6G B;  2KRE A;  4QF3 A;  5KH9 A;  2DX8 A;  2YW8 A;  2E6S A;  3SHB A;  2RSD A;  5SVI A;  3ZVY A;  5AIU A;  2VPD A;  2KWO A;  2CSY A;  2YRE A;  2LAU A;  2G43 A;  2KKY A;  1XWH A;  4GND A;  5B77 A;  3RTR B;  4YAD A;  2CON A;  2MD8 C;  2L75 A;  2ECI A;  2JMI A;  5D1K B;  1WE9 A;  1WEO A;  3FEH A;  4O64 A;  3O36 A;  2EGP A;  3IHP A;  4QQ4 A;  3LQJ A;  1X4J A;  4R2Y A;  4BHW A;  3U5O A;  1RMD A;  1WEP A;  1BOR A;  2ECV A;  1JM7 B;  3EB6 A;  2MNY A;  5H1V A;  2MUM A;  3V43 A;  4LK9 A;  5KH7 A;  4GB0 A;  4ZDT A;  2CRW A;  4TKP B;  2RR4 A;  2LXP C;  2DSM A;  3LQI A;  4ZQL A;  2FUU A;  2FFW A;  4LKA A;  3LVR E;  3DDT A;  3LQH A;  4MSX A;  3T7L A;  2LV9 A;  4I7D A;  3C5K A;  2RI7 A;  2G6Q A;  4YAT A;  1Z60 A;  2YQM A;  4A4C A;  4BBQ A;  4N4F A;  2C2V S;  5TDR A;  5G04 B;  3O33 A;  4AVX A;  2KWK A;  3DWD A;  2H0D B;  2LQ6 A;  4NN2 A;  3ZNI A;  4AYC B;  2KU3 A;  4P5O B;  4FIP A;  3ZPV 1;  2LRI C;  2LGV A;  4S3O C;  2M6M A;  5LKT A;  2M85 A;  3N9L A;  4Z0O A;  2K16 A;  5B79 A;  3LVQ E;  2YHN A;  5C11 A;  5FB1 A;  3O35 A;  4PPE A;  3HCU A;  3ZVZ B;  4UP0 A;  1X4I A;  2ECN A;  3ZYQ A;  5LKZ A;  1FBV A;  2UZG A;  2MKE A;  2MD7 B;  4R7E A;  5TDW A;  4YAB A;  2YQL A;  2YUR A;  3SOU A;  3C6W A;  2C2L A;  5TBN A;  4OGE A;  2FD4 A;  2KWJ A;  2KYU A;  2XOZ A;  3U5P A;  2VPE A;  2ZET C;  1CHC A;  3L11 A;  3O7A A;  5TRB A;  1DCQ A;  4IC2 A;  1WIM A;  1WEU A;  2VJE B;  4O62 A;  4A49 A;  4WA6 A;  5LKX A;  2L5U A;  2Y1N A;  1HYJ A;  3U5N A;  2M3H A;  2QIZ A;  5B8D A;  5H9M A;  3SOX A;  4YAX A;  2AN6 A;  5LKU A;  1E4U A;  4H9D A;  5KH3 A;  3VK6 A;  4ZUX U;  3NG2 A;  4WZ0 A;  5TAB A;  4N3W A;  2CRR A;  2CT2 A;  3M62 A;  3M99 A;  1WEN A;  1DVP A;  2QIC A;  4CCG X;  4Z0R A;  4W4U A;  1WFK A;  4YC9 A;  2Y43 A;  3GL6 A;  3L1X A;  3FL2 A;  1Z2Q A;  3KNV A;  3N9P A;  4LJN A;  5SVX A;  1K2F A;  5C13 A;  2JMJ A;  1WEM A;  3H7H A;  3SOW A;  1MM3 A;  4R8P K;  1MBM A;  4C9Z A;  3HTK C;  2VJE A;  4MVT A;  4X3G A;  5D1L B;  2JUN A;  1HYI A;  5FB0 A;  2HDP A;  3PUR A;  2B0O E;  2EA6 A;  2YUC A;  3EB5 A;  2YVR A;  4V3K C;  1T1H A;  3SUB A;  4F52 B;  3KDE C;  2P57 A;  2Y1M A;  5H1U A;  2OWA A;  2XOC A;  4YBM A;  1IYM A;  4WZ2 A;  2EOD A;  3HCT A;  4QF2 A;  4I7B A;  4LLB A;  2OXQ C;  2KIZ A;  2I50 A;  1MM2 A;  1FP0 A;  2IDA A;  1VD4 A;  2YSM A;  3FM8 C;  2M13 A;  4FK5 A;  3N9O A;  2KR4 A;  3GV4 A;  5FER A;  5G05 B;  4Q6F A;  3MHS A;  1LDJ B;  2JMD A;  5SVI B;  4XI1 A;  3JUE A;  4AYC A;  3KV6 A;  4S3O B;  3MDB C;  2K4D A;  3KV5 A;  3O34 A;  4UP5 A;  2VPB A;  5EYA F;  2YT5 A;  2E61 A;  1V87 A;  2G45 A;  3N9M A;  4YBT A;  1G25 A;  5D1M B;  2YU4 A;  4PTB A;  2KGG A;  2IQJ A;  2MIQ A;  3T6R A;  2L80 A;  2QJ0 A;  5B78 A;  2H0D A;  2KKX A;  2L43 A;  1LDK C;  1WIL A;  2YHO A;  5J3X A;  2BAY A;  1WEV A;  2MNZ A;  3M7K A;  2DJA A;  2KFT A;  5JG6 A;  5B75 A;  2CSZ A;  3KQI A;  1JOC A;  3T9K A;  5H1T A;  1WEW A;  2YYR A;  4UI9 B;  5FEY A;  3FAO A;  5LCW B;  2JRJ A;  3ZPV E;  1WGM A;  4F1P A;  1WEE A;  4WZ3 B;  4OGC A;  2VJF A;  1WES A;  2E6R A;  3M63 A;  2YSJ A;  1N87 A;  4LAD B;  5B76 A;  3LDY A;  2XOY A;  3N9Q A;  3N9N A;  3RPG B;  2M1R A;  3HCS A;  2F42 A;  2L7P A;  2L0B A;  2MA5 A;  4GNE A;  2LGL A;  3L1Z B;  2VPG A;  5AIT A;  2CKL A;  2XEU A;  1F62 A;  2EXU A;  5K3Q A;  2ECW A;  2F6N A;  2ECT A;  2HYE D;  4FO9 A;  4GNG A;  2NAA A;  3MHH A;  4A0C D;  3FAN A;  3RPG C;  4V3L C;  3DQV R;  1JM7 A;  2KWN A;  3DPL R;  2LN0 A;  4CA1 A;  2VP7 A;  2D8S A;  2MT5 A;  2ECJ A;  5G0F A;  5SVY A;  3ZTG A;  3LRQ A;  3Q1D A;  4GNF A;  3O70 A;  4IC3 A;  2LDR A;  4B86 C;  3O47 A;  4A4B A;  3PHD A; 
#chains in the Genus database with same CATH homology
 1ZBD B;  1Z6U A;  4YBS A;  2ECG A;  4AUQ B;  2VNF A;  1VFY A;  1VYX A;  2MA6 A;  3QZV A;  5DKA A;  4AP4 A;  2KE1 A;  3ASL A;  2KGI A;  4I7C A;  1WEQ A;  4L58 A;  2FSA A;  2FUI A;  3O37 A;  2VJF B;  4FJC A;  5I3L A;  5DIN A;  2PNX A;  2F6J A;  2LGK A;  2LXH C;  4L7X A;  3I2D A;  2CKL B;  4B7Y C;  2K17 A;  2K1J A;  2PUY A;  3PUQ A;  2LGG A;  3U5M A;  1X4U A;  2XB1 A;  1U6G B;  2KRE A;  4QF3 A;  5KH9 A;  2DX8 A;  2YW8 A;  2E6S A;  3SHB A;  2RSD A;  3ZVY A;  5AIU A;  2VPD A;  2KWO A;  2CSY A;  2YRE A;  2G43 A;  1XWH A;  4GND A;  5B77 A;  3RTR B;  4YAD A;  2MD8 C;  2L75 A;  2ECI A;  2JMI A;  5D1K B;  1WE9 A;  1WEO A;  4O64 A;  3O36 A;  2EGP A;  3IHP A;  3LQJ A;  1X4J A;  4R2Y A;  4BHW A;  3U5O A;  1RMD A;  1WEP A;  1BOR A;  2ECV A;  1JM7 B;  3EB6 A;  2MNY A;  5H1V A;  2MUM A;  3V43 A;  4LK9 A;  5KH7 A;  4GB0 A;  4ZDT A;  4TKP B;  2LXP C;  3LQI A;  4ZQL A;  2FUU A;  4LKA A;  3LQH A;  4MSX A;  3T7L A;  2LV9 A;  4I7D A;  3C5K A;  2RI7 A;  2G6Q A;  4YAT A;  1Z60 A;  2YQM A;  4A4C A;  4BBQ A;  4N4F A;  2C2V S;  5TDR A;  5G04 B;  3O33 A;  4AVX A;  2KWK A;  2H0D B;  2LQ6 A;  4NN2 A;  3ZNI A;  4AYC B;  2KU3 A;  4P5O B;  4FIP A;  3ZPV 1;  2LRI C;  2LGV A;  4S3O C;  2M6M A;  5LKT A;  2M85 A;  3N9L A;  2K16 A;  5B79 A;  2YHN A;  5C11 A;  5FB1 A;  3O35 A;  4PPE A;  3HCU A;  3ZVZ B;  4UP0 A;  1X4I A;  2ECN A;  3ZYQ A;  5LKZ A;  1FBV A;  2UZG A;  2MD7 B;  4R7E A;  5TDW A;  4YAB A;  2YQL A;  2YUR A;  3SOU A;  3C6W A;  2C2L A;  5TBN A;  2KWJ A;  2KYU A;  3U5P A;  2VPE A;  2ZET C;  1CHC A;  3L11 A;  3O7A A;  5TRB A;  4IC2 A;  1WIM A;  1WEU A;  2VJE B;  4A49 A;  4WA6 A;  5LKX A;  2L5U A;  2Y1N A;  1HYJ A;  3U5N A;  2M3H A;  2QIZ A;  5B8D A;  5H9M A;  3SOX A;  4YAX A;  2AN6 A;  5LKU A;  1E4U A;  5KH3 A;  3VK6 A;  4ZUX U;  3NG2 A;  4WZ0 A;  5TAB A;  4N3W A;  2CT2 A;  3M62 A;  3M99 A;  1WEN A;  1DVP A;  2QIC A;  4CCG X;  4W4U A;  1WFK A;  4YC9 A;  2Y43 A;  3GL6 A;  3L1X A;  3FL2 A;  1Z2Q A;  3KNV A;  3N9P A;  4LJN A;  1K2F A;  5C13 A;  2JMJ A;  1WEM A;  3SOW A;  1MM3 A;  4R8P K;  4C9Z A;  3HTK C;  2VJE A;  4MVT A;  4X3G A;  5D1L B;  1HYI A;  5FB0 A;  2HDP A;  3PUR A;  2EA6 A;  2YUC A;  3EB5 A;  4V3K C;  1T1H A;  4F52 B;  2Y1M A;  5H1U A;  4YBM A;  1IYM A;  4WZ2 A;  2EOD A;  3HCT A;  4QF2 A;  4I7B A;  4LLB A;  2OXQ C;  2KIZ A;  2I50 A;  1MM2 A;  1FP0 A;  2IDA A;  1VD4 A;  2YSM A;  4FK5 A;  3N9O A;  2KR4 A;  3GV4 A;  5FER A;  5G05 B;  4Q6F A;  3MHS A;  1LDJ B;  2JMD A;  4XI1 A;  4AYC A;  3KV6 A;  4S3O B;  2K4D A;  3KV5 A;  3O34 A;  4UP5 A;  2VPB A;  5EYA F;  2YT5 A;  1V87 A;  2G45 A;  3N9M A;  4YBT A;  1G25 A;  5D1M B;  2YU4 A;  4PTB A;  2KGG A;  2MIQ A;  3T6R A;  2L80 A;  2QJ0 A;  5B78 A;  2H0D A;  2L43 A;  1LDK C;  1WIL A;  2YHO A;  5J3X A;  2BAY A;  1WEV A;  2MNZ A;  2KFT A;  5JG6 A;  5B75 A;  2CSZ A;  3KQI A;  1JOC A;  5H1T A;  1WEW A;  2YYR A;  4UI9 B;  5FEY A;  5LCW B;  2JRJ A;  3ZPV E;  1WGM A;  1WEE A;  4WZ3 B;  2VJF A;  1WES A;  2E6R A;  3M63 A;  2YSJ A;  1N87 A;  4LAD B;  5B76 A;  3N9Q A;  3N9N A;  3RPG B;  2M1R A;  3HCS A;  2F42 A;  2L0B A;  2MA5 A;  4GNE A;  2LGL A;  3L1Z B;  2VPG A;  5AIT A;  2CKL A;  2XEU A;  1F62 A;  2ECW A;  2F6N A;  2ECT A;  2HYE D;  4FO9 A;  4GNG A;  2NAA A;  3MHH A;  4A0C D;  3RPG C;  4V3L C;  3DQV R;  1JM7 A;  2KWN A;  3DPL R;  2LN0 A;  4CA1 A;  2VP7 A;  2D8S A;  2MT5 A;  2ECJ A;  5G0F A;  3ZTG A;  3LRQ A;  4GNF A;  3O70 A;  4IC3 A;  2LDR A;  4B86 C;  4A4B A;  3PHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...