4A0CD

Structure of the cand1-cul4b-rbx1 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CULLIN-ASSOCIATED NEDD8-DISSOCIATED PROTEIN 1
publication title The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 8
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4a0cD00
4S3OB 1VFYA 4V3LC 5LCWB 3O70A 4BHWA 2MD7B 3EB5A 2CKLB 3VK6A 4S3OC 4F52B 4YAXA 2ECVA 3L11A 2DX8A 2RI7A 3HCUA 2K1JA 2LGKA 2QICA 3L1XA 2LGGA 4CCGX 2ECJA 4N4FA 2FUUA 2I50A 2KWOA 5D1MB 2VP7A 4W4UA 4MVTA 2ECIA 5C11A 5B8DA 2CSYA 3NG2A 1T1HA 2KU3A 2F6JA 5KH3A 5I3LA 2QIZA 1FP0A 3N9OA 2VNFA 4LJNA 5KH7A 2H0DB 2LGLA 1WEEA 1X4JA 5B75A 1Z60A 2CT2A 2E6SA 1WESA 2L0BA 1WGMA 4AP4A 2LDRA 2YT5A 2CSZA 4R2YA 4MSXA 1HYJA 4FJCA 2KR4A 2VJFA 4WZ0A 1X4IA 3U5PA 1F62A 2YU4A 3RTRB 3ZVZB 3U5NA 1ZBDB 2MA6A 2YHOA 2FSAA 3O36A 2XEUA 3LQIA 2JMDA 4GNGA 2KGIA 2KYUA 2EA6A 3ZPV1 5AIUA 2JMJA 3LQJA 4IC3A 4A4CA 5DKAA 5LKUA 2L43A 1XWHA 5FERA 4ZUXU 2VJEB 3PHDA 2VPEA 2MD8C 4YC9A 4YBSA 2ECTA 1WEVA 4GB0A 4R8PK 3ASLA 1WE9A 2ZETC 2KWJA 1WENA 3ZVYA 4AYCA 1U6GB 3N9QA 2YUCA 2EODA 1VD4A 2VPDA 3RPGB 2M6MA 3RPGC 3QZVA 5H1UA 5AITA 5TDRA 1IYMA 1JM7A 2ECNA 2K17A 2YHNA 5B79A 2K16A 4LADB 3HCTA 3O7AA 3M63A 3MHSA 4YADA 4V3KC 2VPBA 2RSDA 1WEOA 2K4DA 4YATA 5G04B 3SOUA 1WEWA 2FUIA 3T6RA 1WILA 2D8SA 3KV5A 5G05B 1K2FA 3EB6A 3O34A 2LN0A 2G6QA 2KWKA 4FO9A 4LK9A 3U5MA 2L75A 1JOCA 5JG6A 2EGPA 4TKPB 3KNVA 4NN2A 2G45A 4B7YC 2M85A 4PPEA 3N9LA 2Y1NA 5FB1A 5FB0A 3N9NA 3L1ZB 4UI9B 4UP0A 3V43A 4I7BA 4L7XA 1HYIA 2C2LA 4YBMA 1WFKA 2PUYA 3O33A 1Z6UA 1X4UA 2L80A 2MNYA 3SOXA 5B77A 2KWNA 4A49A 5FEYA 2F42A 2HYED 1Z2QA 5KH9A 5B78A 1G25A 4X3GA 1WIMA 2KREA 3N9PA 5J3XA 2ECWA 4QF3A 2LXPC 3HTKC 2VJFB 5H9MA 4LLBA 4FIPA 4ZQLA 2CKLA 2ECGA 3PURA 4LKAA 2LV9A 1BORA 3ZPVE 2YREA 1WEUA 2NAAA 4YABA 4Q6FA 2JRJA 1CHCA 2KFTA 3ZNIA 5DINA 4B86C 1MM3A 2BAYA 5TRBA 5LKXA 2C2VS 1V87A 5D1KB 3U5OA 3LQHA 3KV6A 3N9MA 3DQVR 4YBTA 4PTBA 2MUMA 2YSMA 4WZ2A 4AYCB 2LGVA 2PNXA 2H0DA 2UZGA 1WEMA 4WZ3B 2XB1A 4WA6A 4BBQA 1RMDA 3M99A 1JM7B 2OXQC 3C6WA 5B76A 2IDAA 2KGGA 2G43A 1WEPA 2E6RA 3SHBA 2VPGA 2QJ0A 3KQIA 1E4UA 3DPLR 4P5OB 5TABA 4XI1A 2M3HA 4GNFA 4UP5A 3I2DA 3O37A 3LRQA 4ZDTA 4A4BA 5C13A 2YYRA 5LKZA 2YURA 4R7EA 1N87A 1VYXA 3SOWA 4GNEA 3HCSA 3T7LA 4A0CD 2MT5A 4FK5A 1LDJB 2VJEA 2MNZA 3M62A 3GV4A 3ZTGA 3PUQA 2M1RA 3IHPA 2LXHC 2MIQA 2Y43A 3ZYQA 4N3WA 1FBVA 1MM2A 2YSJA 2KIZA 3O35A 4CA1A 5TDWA 5D1LB 2LRIC 2AN6A 2JMIA 2L5UA 2HDPA 2YQLA 2Y1MA 2YW8A 3FL2A 3C5KA 4O64A 5G0FA 4L58A 5H1VA 2YQMA 4QF2A 5TBNA 4GNDA 5LKTA 1WEQA 4IC2A 2MA5A 3MHHA 4AVXA 2LQ6A 3GL6A 2KE1A 1DVPA 5EYAF 2F6NA 5H1TA 4I7DA 4I7CA 4C9ZA 1LDKC 4AUQB
chains in the Genus database with same CATH superfamily
4S3OB 1VFYA 4V3LC 5LCWB 3O70A 4BHWA 2MD7B 3EB5A 2CKLB 3VK6A 4S3OC 3LDYA 4F52B 4YAXA 2IQJA 2ECVA 3L11A 2DX8A 2RI7A 3HCUA 2K1JA 2KKYA 1DCQA 2LGKA 2QICA 3L1XA 2LGGA 4CCGX 2ECJA 4N4FA 2FUUA 2I50A 2KWOA 2MKEA 5D1MB 2CSVA 2VP7A 4W4UA 4MVTA 2ECIA 5C11A 5B8DA 2CSYA 3NG2A 1T1HA 2KU3A 2JM3A 2F6JA 3DWDA 5KH3A 5I3LA 2QIZA 1FP0A 3N9OA 2VNFA 4LJNA 5KH7A 2H0DB 2LGLA 1WEEA 1X4JA 5B75A 1Z60A 2CT2A 2E6SA 1WESA 2L0BA 1WGMA 3M7KA 4AP4A 2LDRA 2YT5A 2CSZA 4R2YA 4MSXA 1HYJA 4FJCA 2KR4A 3PLWA 2VJFA 2KKXA 2XOZA 3LVQE 4WZ0A 1X4IA 3U5PA 1F62A 3O47A 2YU4A 3RTRB 3ZVZB 3U5NA 1ZBDB 2MA6A 2YHOA 2FSAA 3O36A 2XOYA 2XEUA 3LQIA 2JMDA 4GNGA 2KGIA 2KYUA 2EA6A 3ZPV1 4F1PA 5AIUA 2JMJA 3LQJA 4IC3A 4A4CA 5DKAA 3FAOA 5LKUA 2FFWA 2L43A 1XWHA 5FERA 4ZUXU 2XOCA 2VJEB 3PHDA 2VPEA 2MD8C 4YC9A 4YBSA 2ECTA 1WEVA 3FJUB 4GB0A 4R8PK 3ASLA 1WE9A 2ZETC 2KWJA 2D8UA 1WENA 3ZVYA 2LAUA 4AYCA 1U6GB 3N9QA 2YUCA 2EODA 1VD4A 2RR4A 2VPDA 3RPGB 2M6MA 3RPGC 3QZVA 5H1UA 5AITA 5TDRA 1IYMA 1JM7A 2ECNA 2K17A 2YHNA 5B79A 2K16A 4LADB 3HCTA 2CRRA 3O7AA 3M63A 2E61A 3MHSA 4O62A 4YADA 4V3KC 2VPBA 2RSDA 1WEOA 2K4DA 4YATA 5G04B 3SOUA 1WEWA 2FUIA 3T6RA 2P57A 4OGCA 2CRWA 1WILA 4Z0RA 5SVIB 2D8SA 3KV5A 5G05B 1K2FA 3EB6A 3O34A 2LN0A 2G6QA 2KWKA 4QQ4A 4FO9A 4LK9A 3FM8C 3U5MA 2L75A 1JOCA 2EGMA 5JG6A 2EGPA 4TKPB 3KNVA 4NN2A 2G45A 4B7YC 3DDTA 2M85A 4PPEA 3N9LA 2Y1NA 5FB1A 5FB0A 3N9NA 3L1ZB 4UI9B 3E2DA 4UP0A 3Q1DA 3JUEA 3V43A 4I7BA 4Z0OA 4L7XA 1HYIA 2C2LA 4YBMA 1WFKA 2PUYA 3FEHA 3O33A 1Z6UA 1X4UA 2L80A 2MNYA 3MDBC 3SOXA 5B77A 2KWNA 3SUBA 4A49A 5FEYA 2F42A 2HYED 1Z2QA 5KH9A 5B78A 1G25A 4X3GA 1WIMA 2KREA 4H9DA 3N9PA 5J3XA 2B0OE 2ECWA 2FD4A 4QF3A 2LXPC 5SVYA 2DJAA 3HTKC 2VJFB 5H9MA 4LLBA 4FIPA 2YVRA 4ZQLA 2CKLA 2ECGA 2M13A 3PURA 4LKAA 2LV9A 1BORA 3ZPVE 2YREA 1WEUA 2NAAA 4YABA 4Q6FA 2JRJA 1CHCA 2KFTA 3ZNIA 5DINA 4B86C 1MM3A 2BAYA 5TRBA 5LKXA 2C2VS 1V87A 5D1KB 3U5OA 3LQHA 3KV6A 3N9MA 3DQVR 4YBTA 4PTBA 2MUMA 2YSMA 4WZ2A 4AYCB 2LGVA 2PNXA 2H0DA 2UZGA 2L7PA 1WEMA 4WZ3B 2XB1A 2EXUA 4WA6A 3FANA 4BBQA 1RMDA 3M99A 1JM7B 3LVRE 2OXQC 3C6WA 5B76A 2IDAA 2KGGA 2G43A 1WEPA 2E6RA 3SHBA 2VPGA 2QJ0A 2JUNA 3KQIA 1E4UA 3DPLR 4P5OB 5TABA 4XI1A 2M3HA 4GNFA 4UP5A 2CONA 3I2DA 3O37A 3LRQA 4ZDTA 4A4BA 5C13A 2YYRA 3LJUX 5K3QA 2OWAA 5LKZA 2YURA 4R7EA 1N87A 1VYXA 3SOWA 4GNEA 3HCSA 3T7LA 4A0CD 2MT5A 4FK5A 2XP0A 1LDJB 3H7HA 2VJEA 2MNZA 3M62A 3GV4A 3ZTGA 3PUQA 2M1RA 3IHPA 2LXHC 2MIQA 5SVXA 4OGEA 2Y43A 3ZYQA 4N3WA 1FBVA 1MM2A 2YSJA 3KDEC 2KIZA 3O35A 4CA1A 5TDWA 5D1LB 2LRIC 2AN6A 2JMIA 2L5UA 2DSMA 2HDPA 2YQLA 2Y1MA 2YW8A 1MBMA 3T9KA 3FL2A 3C5KA 4O64A 5G0FA 4L58A 5H1VA 2YQMA 4QF2A 5TBNA 4GNDA 5LKTA 1WEQA 4IC2A 2MA5A 3MHHA 4AVXA 2LQ6A 3GL6A 2KE1A 1DVPA 5EYAF 2F6NA 5H1TA 5SVIA 4I7DA 4I7CA 4C9ZA 1LDKC 4AUQB
chains in the Genus database with same CATH topology
4S3OB 1VFYA 4V3LC 5LCWB 3O70A 4BHWA 2MD7B 3EB5A 2CKLB 3VK6A 4S3OC 4F52B 4YAXA 2ECVA 3L11A 2DX8A 2RI7A 3HCUA 2K1JA 2LGKA 2QICA 3L1XA 2LGGA 4CCGX 2ECJA 4N4FA 2FUUA 2I50A 2KWOA 5D1MB 2VP7A 4W4UA 4MVTA 2ECIA 5C11A 5B8DA 2CSYA 3NG2A 1T1HA 2KU3A 2F6JA 5KH3A 5I3LA 2QIZA 1FP0A 3N9OA 2VNFA 4LJNA 5KH7A 2H0DB 2LGLA 1WEEA 1X4JA 5B75A 1Z60A 2CT2A 2E6SA 1WESA 2L0BA 1WGMA 4AP4A 2LDRA 2YT5A 2CSZA 4R2YA 4MSXA 1HYJA 4FJCA 2KR4A 2VJFA 4WZ0A 1X4IA 3U5PA 1F62A 2YU4A 3RTRB 3ZVZB 3U5NA 1ZBDB 2MA6A 2YHOA 2FSAA 3O36A 2XEUA 3LQIA 2JMDA 4GNGA 2KGIA 2KYUA 2EA6A 3ZPV1 5AIUA 2JMJA 3LQJA 4IC3A 4A4CA 5DKAA 5LKUA 2L43A 1XWHA 5FERA 4ZUXU 2VJEB 3PHDA 2VPEA 2MD8C 4YC9A 4YBSA 2ECTA 1WEVA 4GB0A 4R8PK 3ASLA 1WE9A 2ZETC 2KWJA 1WENA 3ZVYA 4AYCA 1U6GB 3N9QA 2YUCA 2EODA 1VD4A 2VPDA 3RPGB 2M6MA 3RPGC 3QZVA 5H1UA 5AITA 5TDRA 1IYMA 1JM7A 2ECNA 2K17A 2YHNA 5B79A 2K16A 4LADB 3HCTA 3O7AA 3M63A 3MHSA 4YADA 4V3KC 2VPBA 2RSDA 1WEOA 2K4DA 4YATA 5G04B 3SOUA 1WEWA 2FUIA 3T6RA 1WILA 2D8SA 3KV5A 5G05B 1K2FA 3EB6A 3O34A 2LN0A 2G6QA 2KWKA 4FO9A 4LK9A 3U5MA 2L75A 1JOCA 5JG6A 2EGPA 4TKPB 3KNVA 4NN2A 2G45A 4B7YC 2M85A 4PPEA 3N9LA 2Y1NA 5FB1A 5FB0A 3N9NA 3L1ZB 4UI9B 4UP0A 3V43A 4I7BA 4L7XA 1HYIA 2C2LA 4YBMA 1WFKA 2PUYA 3O33A 1Z6UA 1X4UA 2L80A 2MNYA 3SOXA 5B77A 2KWNA 4A49A 5FEYA 2F42A 2HYED 1Z2QA 5KH9A 5B78A 1G25A 4X3GA 1WIMA 2KREA 3N9PA 5J3XA 2ECWA 4QF3A 2LXPC 3HTKC 2VJFB 5H9MA 4LLBA 4FIPA 4ZQLA 2CKLA 2ECGA 3PURA 4LKAA 2LV9A 1BORA 3ZPVE 2YREA 1WEUA 2NAAA 4YABA 4Q6FA 2JRJA 1CHCA 2KFTA 3ZNIA 5DINA 4B86C 1MM3A 2BAYA 5TRBA 5LKXA 2C2VS 1V87A 5D1KB 3U5OA 3LQHA 3KV6A 3N9MA 3DQVR 4YBTA 4PTBA 2MUMA 2YSMA 4WZ2A 4AYCB 2LGVA 2PNXA 2H0DA 2UZGA 1WEMA 4WZ3B 2XB1A 4WA6A 4BBQA 1RMDA 3M99A 1JM7B 2OXQC 3C6WA 5B76A 2IDAA 2KGGA 2G43A 1WEPA 2E6RA 3SHBA 2VPGA 2QJ0A 3KQIA 1E4UA 3DPLR 4P5OB 5TABA 4XI1A 2M3HA 4GNFA 4UP5A 3I2DA 3O37A 3LRQA 4ZDTA 4A4BA 5C13A 2YYRA 5LKZA 2YURA 4R7EA 1N87A 1VYXA 3SOWA 4GNEA 3HCSA 3T7LA 4A0CD 2MT5A 4FK5A 1LDJB 2VJEA 2MNZA 3M62A 3GV4A 3ZTGA 3PUQA 2M1RA 3IHPA 2LXHC 2MIQA 2Y43A 3ZYQA 4N3WA 1FBVA 1MM2A 2YSJA 2KIZA 3O35A 4CA1A 5TDWA 5D1LB 2LRIC 2AN6A 2JMIA 2L5UA 2HDPA 2YQLA 2Y1MA 2YW8A 3FL2A 3C5KA 4O64A 5G0FA 4L58A 5H1VA 2YQMA 4QF2A 5TBNA 4GNDA 5LKTA 1WEQA 4IC2A 2MA5A 3MHHA 4AVXA 2LQ6A 3GL6A 2KE1A 1DVPA 5EYAF 2F6NA 5H1TA 4I7DA 4I7CA 4C9ZA 1LDKC 4AUQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3O B;  1VFY A;  4V3L C;  5LCW B;  3O70 A;  4BHW A;  2MD7 B;  3EB5 A;  2CKL B;  3VK6 A;  4S3O C;  4F52 B;  4YAX A;  2ECV A;  3L11 A;  2DX8 A;  2RI7 A;  3HCU A;  2K1J A;  2LGK A;  2QIC A;  3L1X A;  2LGG A;  4CCG X;  2ECJ A;  4N4F A;  2FUU A;  2I50 A;  2KWO A;  5D1M B;  2VP7 A;  4W4U A;  4MVT A;  2ECI A;  5C11 A;  5B8D A;  2CSY A;  3NG2 A;  1T1H A;  2KU3 A;  2F6J A;  5KH3 A;  5I3L A;  2QIZ A;  1FP0 A;  3N9O A;  2VNF A;  4LJN A;  5KH7 A;  2H0D B;  2LGL A;  1WEE A;  1X4J A;  5B75 A;  1Z60 A;  2CT2 A;  2E6S A;  1WES A;  2L0B A;  1WGM A;  4AP4 A;  2LDR A;  2YT5 A;  2CSZ A;  4R2Y A;  4MSX A;  1HYJ A;  4FJC A;  2KR4 A;  2VJF A;  4WZ0 A;  1X4I A;  3U5P A;  1F62 A;  2YU4 A;  3RTR B;  3ZVZ B;  3U5N A;  1ZBD B;  2MA6 A;  2YHO A;  2FSA A;  3O36 A;  2XEU A;  3LQI A;  2JMD A;  4GNG A;  2KGI A;  2KYU A;  2EA6 A;  3ZPV 1;  5AIU A;  2JMJ A;  3LQJ A;  4IC3 A;  4A4C A;  5DKA A;  5LKU A;  2L43 A;  1XWH A;  5FER A;  4ZUX U;  2VJE B;  3PHD A;  2VPE A;  2MD8 C;  4YC9 A;  4YBS A;  2ECT A;  1WEV A;  4GB0 A;  4R8P K;  3ASL A;  1WE9 A;  2ZET C;  2KWJ A;  1WEN A;  3ZVY A;  4AYC A;  1U6G B;  3N9Q A;  2YUC A;  2EOD A;  1VD4 A;  2VPD A;  3RPG B;  2M6M A;  3RPG C;  3QZV A;  5H1U A;  5AIT A;  5TDR A;  1IYM A;  1JM7 A;  2ECN A;  2K17 A;  2YHN A;  5B79 A;  2K16 A;  4LAD B;  3HCT A;  3O7A A;  3M63 A;  3MHS A;  4YAD A;  4V3K C;  2VPB A;  2RSD A;  1WEO A;  2K4D A;  4YAT A;  5G04 B;  3SOU A;  1WEW A;  2FUI A;  3T6R A;  1WIL A;  2D8S A;  3KV5 A;  5G05 B;  1K2F A;  3EB6 A;  3O34 A;  2LN0 A;  2G6Q A;  2KWK A;  4FO9 A;  4LK9 A;  3U5M A;  2L75 A;  1JOC A;  5JG6 A;  2EGP A;  4TKP B;  3KNV A;  4NN2 A;  2G45 A;  4B7Y C;  2M85 A;  4PPE A;  3N9L A;  2Y1N A;  5FB1 A;  5FB0 A;  3N9N A;  3L1Z B;  4UI9 B;  4UP0 A;  3V43 A;  4I7B A;  4L7X A;  1HYI A;  2C2L A;  4YBM A;  1WFK A;  2PUY A;  3O33 A;  1Z6U A;  1X4U A;  2L80 A;  2MNY A;  3SOX A;  5B77 A;  2KWN A;  4A49 A;  5FEY A;  2F42 A;  2HYE D;  1Z2Q A;  5KH9 A;  5B78 A;  1G25 A;  4X3G A;  1WIM A;  2KRE A;  3N9P A;  5J3X A;  2ECW A;  4QF3 A;  2LXP C;  3HTK C;  2VJF B;  5H9M A;  4LLB A;  4FIP A;  4ZQL A;  2CKL A;  2ECG A;  3PUR A;  4LKA A;  2LV9 A;  1BOR A;  3ZPV E;  2YRE A;  1WEU A;  2NAA A;  4YAB A;  4Q6F A;  2JRJ A;  1CHC A;  2KFT A;  3ZNI A;  5DIN A;  4B86 C;  1MM3 A;  2BAY A;  5TRB A;  5LKX A;  2C2V S;  1V87 A;  5D1K B;  3U5O A;  3LQH A;  3KV6 A;  3N9M A;  3DQV R;  4YBT A;  4PTB A;  2MUM A;  2YSM A;  4WZ2 A;  4AYC B;  2LGV A;  2PNX A;  2H0D A;  2UZG A;  1WEM A;  4WZ3 B;  2XB1 A;  4WA6 A;  4BBQ A;  1RMD A;  3M99 A;  1JM7 B;  2OXQ C;  3C6W A;  5B76 A;  2IDA A;  2KGG A;  2G43 A;  1WEP A;  2E6R A;  3SHB A;  2VPG A;  2QJ0 A;  3KQI A;  1E4U A;  3DPL R;  4P5O B;  5TAB A;  4XI1 A;  2M3H A;  4GNF A;  4UP5 A;  3I2D A;  3O37 A;  3LRQ A;  4ZDT A;  4A4B A;  5C13 A;  2YYR A;  5LKZ A;  2YUR A;  4R7E A;  1N87 A;  1VYX A;  3SOW A;  4GNE A;  3HCS A;  3T7L A;  4A0C D;  2MT5 A;  4FK5 A;  1LDJ B;  2VJE A;  2MNZ A;  3M62 A;  3GV4 A;  3ZTG A;  3PUQ A;  2M1R A;  3IHP A;  2LXH C;  2MIQ A;  2Y43 A;  3ZYQ A;  4N3W A;  1FBV A;  1MM2 A;  2YSJ A;  2KIZ A;  3O35 A;  4CA1 A;  5TDW A;  5D1L B;  2LRI C;  2AN6 A;  2JMI A;  2L5U A;  2HDP A;  2YQL A;  2Y1M A;  2YW8 A;  3FL2 A;  3C5K A;  4O64 A;  5G0F A;  4L58 A;  5H1V A;  2YQM A;  4QF2 A;  5TBN A;  4GND A;  5LKT A;  1WEQ A;  4IC2 A;  2MA5 A;  3MHH A;  4AVX A;  2LQ6 A;  3GL6 A;  2KE1 A;  1DVP A;  5EYA F;  2F6N A;  5H1T A;  4I7D A;  4I7C A;  4C9Z A;  1LDK C;  4AUQ B; 
#chains in the Genus database with same CATH topology
 4S3O B;  1VFY A;  4V3L C;  5LCW B;  3O70 A;  4BHW A;  2MD7 B;  3EB5 A;  2CKL B;  3VK6 A;  4S3O C;  3LDY A;  4F52 B;  4YAX A;  2IQJ A;  2ECV A;  3L11 A;  2DX8 A;  2RI7 A;  3HCU A;  2K1J A;  2KKY A;  1DCQ A;  2LGK A;  2QIC A;  3L1X A;  2LGG A;  4CCG X;  2ECJ A;  4N4F A;  2FUU A;  2I50 A;  2KWO A;  2MKE A;  5D1M B;  2CSV A;  2VP7 A;  4W4U A;  4MVT A;  2ECI A;  5C11 A;  5B8D A;  2CSY A;  3NG2 A;  1T1H A;  2KU3 A;  2JM3 A;  2F6J A;  3DWD A;  5KH3 A;  5I3L A;  2QIZ A;  1FP0 A;  3N9O A;  2VNF A;  4LJN A;  5KH7 A;  2H0D B;  2LGL A;  1WEE A;  1X4J A;  5B75 A;  1Z60 A;  2CT2 A;  2E6S A;  1WES A;  2L0B A;  1WGM A;  3M7K A;  4AP4 A;  2LDR A;  2YT5 A;  2CSZ A;  4R2Y A;  4MSX A;  1HYJ A;  4FJC A;  2KR4 A;  3PLW A;  2VJF A;  2KKX A;  2XOZ A;  3LVQ E;  4WZ0 A;  1X4I A;  3U5P A;  1F62 A;  3O47 A;  2YU4 A;  3RTR B;  3ZVZ B;  3U5N A;  1ZBD B;  2MA6 A;  2YHO A;  2FSA A;  3O36 A;  2XOY A;  2XEU A;  3LQI A;  2JMD A;  4GNG A;  2KGI A;  2KYU A;  2EA6 A;  3ZPV 1;  4F1P A;  5AIU A;  2JMJ A;  3LQJ A;  4IC3 A;  4A4C A;  5DKA A;  3FAO A;  5LKU A;  2FFW A;  2L43 A;  1XWH A;  5FER A;  4ZUX U;  2XOC A;  2VJE B;  3PHD A;  2VPE A;  2MD8 C;  4YC9 A;  4YBS A;  2ECT A;  1WEV A;  3FJU B;  4GB0 A;  4R8P K;  3ASL A;  1WE9 A;  2ZET C;  2KWJ A;  2D8U A;  1WEN A;  3ZVY A;  2LAU A;  4AYC A;  1U6G B;  3N9Q A;  2YUC A;  2EOD A;  1VD4 A;  2RR4 A;  2VPD A;  3RPG B;  2M6M A;  3RPG C;  3QZV A;  5H1U A;  5AIT A;  5TDR A;  1IYM A;  1JM7 A;  2ECN A;  2K17 A;  2YHN A;  5B79 A;  2K16 A;  4LAD B;  3HCT A;  2CRR A;  3O7A A;  3M63 A;  2E61 A;  3MHS A;  4O62 A;  4YAD A;  4V3K C;  2VPB A;  2RSD A;  1WEO A;  2K4D A;  4YAT A;  5G04 B;  3SOU A;  1WEW A;  2FUI A;  3T6R A;  2P57 A;  4OGC A;  2CRW A;  1WIL A;  4Z0R A;  5SVI B;  2D8S A;  3KV5 A;  5G05 B;  1K2F A;  3EB6 A;  3O34 A;  2LN0 A;  2G6Q A;  2KWK A;  4QQ4 A;  4FO9 A;  4LK9 A;  3FM8 C;  3U5M A;  2L75 A;  1JOC A;  2EGM A;  5JG6 A;  2EGP A;  4TKP B;  3KNV A;  4NN2 A;  2G45 A;  4B7Y C;  3DDT A;  2M85 A;  4PPE A;  3N9L A;  2Y1N A;  5FB1 A;  5FB0 A;  3N9N A;  3L1Z B;  4UI9 B;  3E2D A;  4UP0 A;  3Q1D A;  3JUE A;  3V43 A;  4I7B A;  4Z0O A;  4L7X A;  1HYI A;  2C2L A;  4YBM A;  1WFK A;  2PUY A;  3FEH A;  3O33 A;  1Z6U A;  1X4U A;  2L80 A;  2MNY A;  3MDB C;  3SOX A;  5B77 A;  2KWN A;  3SUB A;  4A49 A;  5FEY A;  2F42 A;  2HYE D;  1Z2Q A;  5KH9 A;  5B78 A;  1G25 A;  4X3G A;  1WIM A;  2KRE A;  4H9D A;  3N9P A;  5J3X A;  2B0O E;  2ECW A;  2FD4 A;  4QF3 A;  2LXP C;  5SVY A;  2DJA A;  3HTK C;  2VJF B;  5H9M A;  4LLB A;  4FIP A;  2YVR A;  4ZQL A;  2CKL A;  2ECG A;  2M13 A;  3PUR A;  4LKA A;  2LV9 A;  1BOR A;  3ZPV E;  2YRE A;  1WEU A;  2NAA A;  4YAB A;  4Q6F A;  2JRJ A;  1CHC A;  2KFT A;  3ZNI A;  5DIN A;  4B86 C;  1MM3 A;  2BAY A;  5TRB A;  5LKX A;  2C2V S;  1V87 A;  5D1K B;  3U5O A;  3LQH A;  3KV6 A;  3N9M A;  3DQV R;  4YBT A;  4PTB A;  2MUM A;  2YSM A;  4WZ2 A;  4AYC B;  2LGV A;  2PNX A;  2H0D A;  2UZG A;  2L7P A;  1WEM A;  4WZ3 B;  2XB1 A;  2EXU A;  4WA6 A;  3FAN A;  4BBQ A;  1RMD A;  3M99 A;  1JM7 B;  3LVR E;  2OXQ C;  3C6W A;  5B76 A;  2IDA A;  2KGG A;  2G43 A;  1WEP A;  2E6R A;  3SHB A;  2VPG A;  2QJ0 A;  2JUN A;  3KQI A;  1E4U A;  3DPL R;  4P5O B;  5TAB A;  4XI1 A;  2M3H A;  4GNF A;  4UP5 A;  2CON A;  3I2D A;  3O37 A;  3LRQ A;  4ZDT A;  4A4B A;  5C13 A;  2YYR A;  3LJU X;  5K3Q A;  2OWA A;  5LKZ A;  2YUR A;  4R7E A;  1N87 A;  1VYX A;  3SOW A;  4GNE A;  3HCS A;  3T7L A;  4A0C D;  2MT5 A;  4FK5 A;  2XP0 A;  1LDJ B;  3H7H A;  2VJE A;  2MNZ A;  3M62 A;  3GV4 A;  3ZTG A;  3PUQ A;  2M1R A;  3IHP A;  2LXH C;  2MIQ A;  5SVX A;  4OGE A;  2Y43 A;  3ZYQ A;  4N3W A;  1FBV A;  1MM2 A;  2YSJ A;  3KDE C;  2KIZ A;  3O35 A;  4CA1 A;  5TDW A;  5D1L B;  2LRI C;  2AN6 A;  2JMI A;  2L5U A;  2DSM A;  2HDP A;  2YQL A;  2Y1M A;  2YW8 A;  1MBM A;  3T9K A;  3FL2 A;  3C5K A;  4O64 A;  5G0F A;  4L58 A;  5H1V A;  2YQM A;  4QF2 A;  5TBN A;  4GND A;  5LKT A;  1WEQ A;  4IC2 A;  2MA5 A;  3MHH A;  4AVX A;  2LQ6 A;  3GL6 A;  2KE1 A;  1DVP A;  5EYA F;  2F6N A;  5H1T A;  5SVI A;  4I7D A;  4I7C A;  4C9Z A;  1LDK C;  4AUQ B; 
#chains in the Genus database with same CATH homology
 4S3O B;  1VFY A;  4V3L C;  5LCW B;  3O70 A;  4BHW A;  2MD7 B;  3EB5 A;  2CKL B;  3VK6 A;  4S3O C;  4F52 B;  4YAX A;  2ECV A;  3L11 A;  2DX8 A;  2RI7 A;  3HCU A;  2K1J A;  2LGK A;  2QIC A;  3L1X A;  2LGG A;  4CCG X;  2ECJ A;  4N4F A;  2FUU A;  2I50 A;  2KWO A;  5D1M B;  2VP7 A;  4W4U A;  4MVT A;  2ECI A;  5C11 A;  5B8D A;  2CSY A;  3NG2 A;  1T1H A;  2KU3 A;  2F6J A;  5KH3 A;  5I3L A;  2QIZ A;  1FP0 A;  3N9O A;  2VNF A;  4LJN A;  5KH7 A;  2H0D B;  2LGL A;  1WEE A;  1X4J A;  5B75 A;  1Z60 A;  2CT2 A;  2E6S A;  1WES A;  2L0B A;  1WGM A;  4AP4 A;  2LDR A;  2YT5 A;  2CSZ A;  4R2Y A;  4MSX A;  1HYJ A;  4FJC A;  2KR4 A;  2VJF A;  4WZ0 A;  1X4I A;  3U5P A;  1F62 A;  2YU4 A;  3RTR B;  3ZVZ B;  3U5N A;  1ZBD B;  2MA6 A;  2YHO A;  2FSA A;  3O36 A;  2XEU A;  3LQI A;  2JMD A;  4GNG A;  2KGI A;  2KYU A;  2EA6 A;  3ZPV 1;  5AIU A;  2JMJ A;  3LQJ A;  4IC3 A;  4A4C A;  5DKA A;  5LKU A;  2L43 A;  1XWH A;  5FER A;  4ZUX U;  2VJE B;  3PHD A;  2VPE A;  2MD8 C;  4YC9 A;  4YBS A;  2ECT A;  1WEV A;  4GB0 A;  4R8P K;  3ASL A;  1WE9 A;  2ZET C;  2KWJ A;  1WEN A;  3ZVY A;  4AYC A;  1U6G B;  3N9Q A;  2YUC A;  2EOD A;  1VD4 A;  2VPD A;  3RPG B;  2M6M A;  3RPG C;  3QZV A;  5H1U A;  5AIT A;  5TDR A;  1IYM A;  1JM7 A;  2ECN A;  2K17 A;  2YHN A;  5B79 A;  2K16 A;  4LAD B;  3HCT A;  3O7A A;  3M63 A;  3MHS A;  4YAD A;  4V3K C;  2VPB A;  2RSD A;  1WEO A;  2K4D A;  4YAT A;  5G04 B;  3SOU A;  1WEW A;  2FUI A;  3T6R A;  1WIL A;  2D8S A;  3KV5 A;  5G05 B;  1K2F A;  3EB6 A;  3O34 A;  2LN0 A;  2G6Q A;  2KWK A;  4FO9 A;  4LK9 A;  3U5M A;  2L75 A;  1JOC A;  5JG6 A;  2EGP A;  4TKP B;  3KNV A;  4NN2 A;  2G45 A;  4B7Y C;  2M85 A;  4PPE A;  3N9L A;  2Y1N A;  5FB1 A;  5FB0 A;  3N9N A;  3L1Z B;  4UI9 B;  4UP0 A;  3V43 A;  4I7B A;  4L7X A;  1HYI A;  2C2L A;  4YBM A;  1WFK A;  2PUY A;  3O33 A;  1Z6U A;  1X4U A;  2L80 A;  2MNY A;  3SOX A;  5B77 A;  2KWN A;  4A49 A;  5FEY A;  2F42 A;  2HYE D;  1Z2Q A;  5KH9 A;  5B78 A;  1G25 A;  4X3G A;  1WIM A;  2KRE A;  3N9P A;  5J3X A;  2ECW A;  4QF3 A;  2LXP C;  3HTK C;  2VJF B;  5H9M A;  4LLB A;  4FIP A;  4ZQL A;  2CKL A;  2ECG A;  3PUR A;  4LKA A;  2LV9 A;  1BOR A;  3ZPV E;  2YRE A;  1WEU A;  2NAA A;  4YAB A;  4Q6F A;  2JRJ A;  1CHC A;  2KFT A;  3ZNI A;  5DIN A;  4B86 C;  1MM3 A;  2BAY A;  5TRB A;  5LKX A;  2C2V S;  1V87 A;  5D1K B;  3U5O A;  3LQH A;  3KV6 A;  3N9M A;  3DQV R;  4YBT A;  4PTB A;  2MUM A;  2YSM A;  4WZ2 A;  4AYC B;  2LGV A;  2PNX A;  2H0D A;  2UZG A;  1WEM A;  4WZ3 B;  2XB1 A;  4WA6 A;  4BBQ A;  1RMD A;  3M99 A;  1JM7 B;  2OXQ C;  3C6W A;  5B76 A;  2IDA A;  2KGG A;  2G43 A;  1WEP A;  2E6R A;  3SHB A;  2VPG A;  2QJ0 A;  3KQI A;  1E4U A;  3DPL R;  4P5O B;  5TAB A;  4XI1 A;  2M3H A;  4GNF A;  4UP5 A;  3I2D A;  3O37 A;  3LRQ A;  4ZDT A;  4A4B A;  5C13 A;  2YYR A;  5LKZ A;  2YUR A;  4R7E A;  1N87 A;  1VYX A;  3SOW A;  4GNE A;  3HCS A;  3T7L A;  4A0C D;  2MT5 A;  4FK5 A;  1LDJ B;  2VJE A;  2MNZ A;  3M62 A;  3GV4 A;  3ZTG A;  3PUQ A;  2M1R A;  3IHP A;  2LXH C;  2MIQ A;  2Y43 A;  3ZYQ A;  4N3W A;  1FBV A;  1MM2 A;  2YSJ A;  2KIZ A;  3O35 A;  4CA1 A;  5TDW A;  5D1L B;  2LRI C;  2AN6 A;  2JMI A;  2L5U A;  2HDP A;  2YQL A;  2Y1M A;  2YW8 A;  3FL2 A;  3C5K A;  4O64 A;  5G0F A;  4L58 A;  5H1V A;  2YQM A;  4QF2 A;  5TBN A;  4GND A;  5LKT A;  1WEQ A;  4IC2 A;  2MA5 A;  3MHH A;  4AVX A;  2LQ6 A;  3GL6 A;  2KE1 A;  1DVP A;  5EYA F;  2F6N A;  5H1T A;  4I7D A;  4I7C A;  4C9Z A;  1LDK C;  4AUQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...