4A0CD

Structure of the cand1-cul4b-rbx1 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CULLIN-ASSOCIATED NEDD8-DISSOCIATED PROTEIN 1
publication title The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4a0cD00
2EODA 3C6WA 1V87A 3ZPV1 1WILA 3LQIA 4WZ3B 3O33A 4R7EA 4YAXA 4B7YC 2LN0A 2RSDA 4PTBA 2KIZA 5I3LA 2M6MA 5TDWA 3V43A 3O70A 2YU4A 2NAAA 2KREA 2CKLB 4S3OC 3T7LA 3N9MA 2ECJA 5D1LB 5TRBA 4BHWA 3DPLR 2IDAA 2AN6A 4FIPA 1WIMA 3KV6A 3N9OA 2LV9A 2DX8A 4XI1A 5B78A 2ECWA 2VPGA 4QF2A 4AYCA 1E4UA 5LKZA 4YC9A 2MD8C 5JG6A 2YQLA 4A49A 4YATA 5AIUA 3HCSA 5H9MA 2LGGA 4F52B 3L1ZB 2KWNA 5G05B 4MSXA 2Y1MA 4IC3A 4O64A 1BORA 2MA5A 1WGMA 5C11A 2L0BA 4LK9A 1XWHA 2VPBA 2LQ6A 1WEVA 4V3KC 2YUCA 2YW8A 4FJCA 1HYIA 5LKUA 4C9ZA 2YSMA 4WA6A 1WEEA 2F6JA 2K4DA 1DVPA 1WEOA 3IHPA 3M99A 2VPDA 4ZUXU 2LGLA 2VP7A 2CSYA 2XB1A 1LDJB 3ZYQA 2YHNA 2H0DA 2M1RA 4WZ2A 3L1XA 1CHCA 5DKAA 3N9PA 1WEQA 3N9QA 2MIQA 2XEUA 3O7AA 5H1VA 4Q6FA 2YREA 4TKPB 3ZTGA 2JMDA 2D8SA 4FO9A 2QJ0A 3ZPVE 5LKTA 4BBQA 2I50A 2HDPA 5B8DA 2YYRA 1N87A 2VNFA 3LQJA 5AITA 2ECVA 5B79A 4CCGX 2PUYA 1U6GB 5B75A 4N3WA 3PHDA 5EYAF 5KH9A 4QF3A 2YT5A 2UZGA 2K16A 3MHSA 1WFKA 2KR4A 4P5OB 2QICA 1HYJA 2E6RA 4R8PK 2ECGA 4ZQLA 2YURA 3SHBA 3O37A 2VJFA 2L80A 5H1UA 2KGGA 2VJEA 5G0FA 1X4JA 1Z60A 3KNVA 4L58A 1VYXA 1WENA 4GNFA 2KE1A 3ZVZB 2L5UA 1WE9A 5LCWB 1T1HA 2M3HA 2JMIA 3LRQA 2MNYA 3I2DA 4LADB 4MVTA 4N4FA 4AVXA 3DQVR 3VK6A 3O36A 4AP4A 2HYED 1WEPA 2G6QA 5TBNA 1F62A 3N9LA 1MM3A 1MM2A 5FEYA 2VJEB 4AYCB 3RPGB 1FBVA 2JRJA 3SOWA 2KU3A 4LJNA 2Y1NA 2ECNA 1VFYA 1WEUA 1JM7A 2QIZA 3RPGC 2MUMA 3N9NA 3L11A 1VD4A 4GNGA 5D1MB 2YHOA 1JOCA 2KGIA 2KWOA 1Z6UA 3ASLA 2K1JA 2M85A 4PPEA 1X4UA 1WESA 4GNDA 3C5KA 4L7XA 4W4UA 4A4BA 3M62A 3EB6A 2KYUA 4X3GA 1G25A 4AUQB 2CSZA 2MA6A 4YADA 2K17A 2EA6A 3ZNIA 4YABA 2KFTA 1FP0A 2E6SA 5C13A 2CKLA 4R2YA 2OXQC 5H1TA 4B86C 3GV4A 2H0DB 4YBTA 4I7BA 2ECIA 4I7CA 4UI9B 3LQHA 2F42A 2ZETC 2LXHC 2C2VS 2YSJA 3HCTA 1K2FA 2VPEA 4S3OB 4ZDTA 2RI7A 5J3XA 3ZVYA 2MD7B 4NN2A 4UP5A 2G43A 2LGKA 3NG2A 4LKAA 2F6NA 4WZ0A 1LDKC 3PURA 2LGVA 2KWJA 3O34A 3KV5A 3MHHA 2KWKA 1RMDA 5KH7A 2MT5A 5FB1A 4GNEA 2EGPA 4A4CA 5G04B 2JMJA 2FSAA 2YQMA 3U5NA 5FERA 5D1KB 2Y43A 2VJFB 2CT2A 4YBSA 3SOUA 3QZVA 3RTRB 5DINA 2PNXA 5B76A 2FUUA 3U5PA 5FB0A 4GB0A 2ECTA 4UP0A 1ZBDB 4YBMA 3HTKC 2LXPC 3FL2A 4IC2A 2L75A 1WEWA 2BAYA 1IYMA 1WEMA 3O35A 5B77A 2MNZA 2G45A 2LRIC 4V3LC 1JM7B 5KH3A 4LLBA 3M63A 5TDRA 3SOXA 2LDRA 3U5OA 3T6RA 4A0CD 3HCUA 1X4IA 3EB5A 4I7DA 1Z2QA 2FUIA 2L43A 5LKXA 3U5MA 3KQIA 2C2LA 4CA1A 4FK5A 3GL6A 5TABA 3PUQA
chains in the Genus database with same CATH superfamily
2EODA 3C6WA 1V87A 3ZPV1 1WILA 3LQIA 4R7EA 3O33A 4WZ3B 4YAXA 4B7YC 2LN0A 2RSDA 4PTBA 2KIZA 5I3LA 2M6MA 5TDWA 3V43A 2EXUA 3LVQE 3O70A 2YU4A 2NAAA 2KREA 2CKLB 4S3OC 2D8UA 3T7LA 3N9MA 2YVRA 2ECJA 5D1LB 5TRBA 2LAUA 4BHWA 1MBMA 3DPLR 3JUEA 2IDAA 2AN6A 4FIPA 1WIMA 3KV6A 2DSMA 3N9OA 2LV9A 2DX8A 4XI1A 5B78A 2ECWA 2VPGA 4QF2A 3FAOA 4AYCA 1E4UA 5LKZA 4YC9A 2MD8C 2EGMA 5JG6A 2YQLA 4A49A 2P57A 4YATA 5AIUA 2KKXA 3HCSA 5H9MA 2LGGA 4F52B 3L1ZB 5K3QA 2KWNA 5G05B 3H7HA 4MSXA 2Y1MA 4IC3A 2JM3A 4O64A 3DDTA 1BORA 2MA5A 1WGMA 5C11A 4Z0OA 2L0BA 4O62A 4LK9A 1XWHA 2VPBA 2LQ6A 1WEVA 4V3KC 2YUCA 2YW8A 4F1PA 2E61A 4FJCA 2XOYA 1HYIA 5LKUA 4C9ZA 2YSMA 4WA6A 1WEEA 2F6JA 2K4DA 1DVPA 1WEOA 3IHPA 3M99A 2VPDA 4ZUXU 2LGLA 2VP7A 2CSYA 2XB1A 1LDJB 3ZYQA 2YHNA 2H0DA 2M1RA 2XOCA 4WZ2A 3L1XA 1CHCA 5DKAA 3N9PA 4Z0RA 1WEQA 3N9QA 2MIQA 2XEUA 3O7AA 3M7KA 5H1VA 4Q6FA 2YREA 4TKPB 5SVIA 3ZTGA 2JMDA 2D8SA 2DJAA 4FO9A 2QJ0A 3ZPVE 5LKTA 4BBQA 2I50A 2FD4A 2HDPA 5B8DA 2YYRA 1N87A 2VNFA 3LQJA 5AITA 2ECVA 5B79A 4CCGX 4OGCA 2PUYA 1U6GB 5B75A 3FJUB 4N3WA 3PHDA 5EYAF 5KH9A 3DWDA 2YT5A 4QF3A 2UZGA 2K16A 3MHSA 1WFKA 2KR4A 4P5OB 2QICA 1HYJA 2E6RA 2B0OE 4R8PK 2ECGA 2JUNA 2YURA 4ZQLA 3SHBA 3O37A 3MDBC 2VJFA 2L80A 5H1UA 2KGGA 2VJEA 5G0FA 1X4JA 2CRRA 1Z60A 3KNVA 4L58A 1VYXA 3LJUX 1WENA 4GNFA 2KE1A 3ZVZB 2L5UA 1WE9A 5LCWB 1T1HA 2M3HA 2JMIA 3LRQA 2MNYA 3I2DA 4LADB 4MVTA 4N4FA 4AVXA 3DQVR 3FM8C 3VK6A 3O36A 4AP4A 2HYED 3FANA 1WEPA 2G6QA 5TBNA 1F62A 3N9LA 5SVXA 1MM3A 1MM2A 5FEYA 2VJEB 4AYCB 3RPGB 1FBVA 2JRJA 3SOWA 2KU3A 4LJNA 2Y1NA 2ECNA 1VFYA 1WEUA 1JM7A 2QIZA 4OGEA 2L7PA 3RPGC 2KKYA 2MUMA 3N9NA 3L11A 1VD4A 4GNGA 5D1MB 2YHOA 1JOCA 2KGIA 2KWOA 3KDEC 2RR4A 2OWAA 2MKEA 1Z6UA 3ASLA 2K1JA 2M85A 4PPEA 5SVYA 1X4UA 1WESA 4GNDA 3C5KA 4L7XA 4W4UA 4A4BA 3M62A 3EB6A 2KYUA 4X3GA 3Q1DA 1G25A 4AUQB 3E2DA 2CSZA 2MA6A 4YADA 2K17A 2EA6A 3ZNIA 4YABA 2KFTA 1FP0A 2E6SA 5C13A 2CKLA 4R2YA 2OXQC 5H1TA 4B86C 3GV4A 2H0DB 4YBTA 4I7BA 2ECIA 4I7CA 2CONA 4UI9B 3LQHA 2F42A 2ZETC 2LXHC 2C2VS 2YSJA 3HCTA 1K2FA 2VPEA 4S3OB 5SVIB 4ZDTA 2RI7A 5J3XA 3ZVYA 2M13A 2MD7B 4NN2A 4UP5A 2G43A 2LGKA 3LDYA 3NG2A 4LKAA 2F6NA 4WZ0A 1LDKC 3PURA 2LGVA 2KWJA 3O34A 3KV5A 3MHHA 1DCQA 3LVRE 2KWKA 2XP0A 1RMDA 5KH7A 2MT5A 5FB1A 4H9DA 4GNEA 2EGPA 4A4CA 5G04B 2XOZA 2JMJA 2IQJA 2FSAA 2YQMA 3U5NA 5FERA 5D1KB 2Y43A 3SUBA 2VJFB 2CT2A 4YBSA 2CRWA 3SOUA 3QZVA 3RTRB 5DINA 2PNXA 5B76A 2FUUA 3T9KA 3U5PA 5FB0A 4GB0A 2ECTA 4UP0A 1ZBDB 4YBMA 3HTKC 2LXPC 3FL2A 4IC2A 2L75A 1WEWA 2BAYA 3PLWA 1IYMA 1WEMA 3O35A 5B77A 2MNZA 2G45A 2FFWA 2LRIC 4V3LC 1JM7B 5KH3A 4LLBA 3M63A 5TDRA 3SOXA 2LDRA 3U5OA 3T6RA 4A0CD 3HCUA 1X4IA 3EB5A 4I7DA 1Z2QA 2FUIA 2L43A 5LKXA 3U5MA 3KQIA 2C2LA 4CA1A 4FK5A 3O47A 3GL6A 4QQ4A 3FEHA 5TABA 2CSVA 3PUQA
chains in the Genus database with same CATH topology
2EODA 3C6WA 1V87A 3ZPV1 1WILA 3LQIA 4WZ3B 3O33A 4R7EA 4YAXA 4B7YC 2LN0A 2RSDA 4PTBA 2KIZA 5I3LA 2M6MA 5TDWA 3V43A 3O70A 2YU4A 2NAAA 2KREA 2CKLB 4S3OC 3T7LA 3N9MA 2ECJA 5D1LB 5TRBA 4BHWA 3DPLR 2IDAA 2AN6A 4FIPA 1WIMA 3KV6A 3N9OA 2LV9A 2DX8A 4XI1A 5B78A 2ECWA 2VPGA 4QF2A 4AYCA 1E4UA 5LKZA 4YC9A 2MD8C 5JG6A 2YQLA 4A49A 4YATA 5AIUA 3HCSA 5H9MA 2LGGA 4F52B 3L1ZB 2KWNA 5G05B 4MSXA 2Y1MA 4IC3A 4O64A 1BORA 2MA5A 1WGMA 5C11A 2L0BA 4LK9A 1XWHA 2VPBA 2LQ6A 1WEVA 4V3KC 2YUCA 2YW8A 4FJCA 1HYIA 5LKUA 4C9ZA 2YSMA 4WA6A 1WEEA 2F6JA 2K4DA 1DVPA 1WEOA 3IHPA 3M99A 2VPDA 4ZUXU 2LGLA 2VP7A 2CSYA 2XB1A 1LDJB 3ZYQA 2YHNA 2H0DA 2M1RA 4WZ2A 3L1XA 1CHCA 5DKAA 3N9PA 1WEQA 3N9QA 2MIQA 2XEUA 3O7AA 5H1VA 4Q6FA 2YREA 4TKPB 3ZTGA 2JMDA 2D8SA 4FO9A 2QJ0A 3ZPVE 5LKTA 4BBQA 2I50A 2HDPA 5B8DA 2YYRA 1N87A 2VNFA 3LQJA 5AITA 2ECVA 5B79A 4CCGX 2PUYA 1U6GB 5B75A 4N3WA 3PHDA 5EYAF 5KH9A 4QF3A 2YT5A 2UZGA 2K16A 3MHSA 1WFKA 2KR4A 4P5OB 2QICA 1HYJA 2E6RA 4R8PK 2ECGA 4ZQLA 2YURA 3SHBA 3O37A 2VJFA 2L80A 5H1UA 2KGGA 2VJEA 5G0FA 1X4JA 1Z60A 3KNVA 4L58A 1VYXA 1WENA 4GNFA 2KE1A 3ZVZB 2L5UA 1WE9A 5LCWB 1T1HA 2M3HA 2JMIA 3LRQA 2MNYA 3I2DA 4LADB 4MVTA 4N4FA 4AVXA 3DQVR 3VK6A 3O36A 4AP4A 2HYED 1WEPA 2G6QA 5TBNA 1F62A 3N9LA 1MM3A 1MM2A 5FEYA 2VJEB 4AYCB 3RPGB 1FBVA 2JRJA 3SOWA 2KU3A 4LJNA 2Y1NA 2ECNA 1VFYA 1WEUA 1JM7A 2QIZA 3RPGC 2MUMA 3N9NA 3L11A 1VD4A 4GNGA 5D1MB 2YHOA 1JOCA 2KGIA 2KWOA 1Z6UA 3ASLA 2K1JA 2M85A 4PPEA 1X4UA 1WESA 4GNDA 3C5KA 4L7XA 4W4UA 4A4BA 3M62A 3EB6A 2KYUA 4X3GA 1G25A 4AUQB 2CSZA 2MA6A 4YADA 2K17A 2EA6A 3ZNIA 4YABA 2KFTA 1FP0A 2E6SA 5C13A 2CKLA 4R2YA 2OXQC 5H1TA 4B86C 3GV4A 2H0DB 4YBTA 4I7BA 2ECIA 4I7CA 4UI9B 3LQHA 2F42A 2ZETC 2LXHC 2C2VS 2YSJA 3HCTA 1K2FA 2VPEA 4S3OB 4ZDTA 2RI7A 5J3XA 3ZVYA 2MD7B 4NN2A 4UP5A 2G43A 2LGKA 3NG2A 4LKAA 2F6NA 4WZ0A 1LDKC 3PURA 2LGVA 2KWJA 3O34A 3KV5A 3MHHA 2KWKA 1RMDA 5KH7A 2MT5A 5FB1A 4GNEA 2EGPA 4A4CA 5G04B 2JMJA 2FSAA 2YQMA 3U5NA 5FERA 5D1KB 2Y43A 2VJFB 2CT2A 4YBSA 3SOUA 3QZVA 3RTRB 5DINA 2PNXA 5B76A 2FUUA 3U5PA 5FB0A 4GB0A 2ECTA 4UP0A 1ZBDB 4YBMA 3HTKC 2LXPC 3FL2A 4IC2A 2L75A 1WEWA 2BAYA 1IYMA 1WEMA 3O35A 5B77A 2MNZA 2G45A 2LRIC 4V3LC 1JM7B 5KH3A 4LLBA 3M63A 5TDRA 3SOXA 2LDRA 3U5OA 3T6RA 4A0CD 3HCUA 1X4IA 3EB5A 4I7DA 1Z2QA 2FUIA 2L43A 5LKXA 3U5MA 3KQIA 2C2LA 4CA1A 4FK5A 3GL6A 5TABA 3PUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOD A;  3C6W A;  1V87 A;  3ZPV 1;  1WIL A;  3LQI A;  4WZ3 B;  3O33 A;  4R7E A;  4YAX A;  4B7Y C;  2LN0 A;  2RSD A;  4PTB A;  2KIZ A;  5I3L A;  2M6M A;  5TDW A;  3V43 A;  3O70 A;  2YU4 A;  2NAA A;  2KRE A;  2CKL B;  4S3O C;  3T7L A;  3N9M A;  2ECJ A;  5D1L B;  5TRB A;  4BHW A;  3DPL R;  2IDA A;  2AN6 A;  4FIP A;  1WIM A;  3KV6 A;  3N9O A;  2LV9 A;  2DX8 A;  4XI1 A;  5B78 A;  2ECW A;  2VPG A;  4QF2 A;  4AYC A;  1E4U A;  5LKZ A;  4YC9 A;  2MD8 C;  5JG6 A;  2YQL A;  4A49 A;  4YAT A;  5AIU A;  3HCS A;  5H9M A;  2LGG A;  4F52 B;  3L1Z B;  2KWN A;  5G05 B;  4MSX A;  2Y1M A;  4IC3 A;  4O64 A;  1BOR A;  2MA5 A;  1WGM A;  5C11 A;  2L0B A;  4LK9 A;  1XWH A;  2VPB A;  2LQ6 A;  1WEV A;  4V3K C;  2YUC A;  2YW8 A;  4FJC A;  1HYI A;  5LKU A;  4C9Z A;  2YSM A;  4WA6 A;  1WEE A;  2F6J A;  2K4D A;  1DVP A;  1WEO A;  3IHP A;  3M99 A;  2VPD A;  4ZUX U;  2LGL A;  2VP7 A;  2CSY A;  2XB1 A;  1LDJ B;  3ZYQ A;  2YHN A;  2H0D A;  2M1R A;  4WZ2 A;  3L1X A;  1CHC A;  5DKA A;  3N9P A;  1WEQ A;  3N9Q A;  2MIQ A;  2XEU A;  3O7A A;  5H1V A;  4Q6F A;  2YRE A;  4TKP B;  3ZTG A;  2JMD A;  2D8S A;  4FO9 A;  2QJ0 A;  3ZPV E;  5LKT A;  4BBQ A;  2I50 A;  2HDP A;  5B8D A;  2YYR A;  1N87 A;  2VNF A;  3LQJ A;  5AIT A;  2ECV A;  5B79 A;  4CCG X;  2PUY A;  1U6G B;  5B75 A;  4N3W A;  3PHD A;  5EYA F;  5KH9 A;  4QF3 A;  2YT5 A;  2UZG A;  2K16 A;  3MHS A;  1WFK A;  2KR4 A;  4P5O B;  2QIC A;  1HYJ A;  2E6R A;  4R8P K;  2ECG A;  4ZQL A;  2YUR A;  3SHB A;  3O37 A;  2VJF A;  2L80 A;  5H1U A;  2KGG A;  2VJE A;  5G0F A;  1X4J A;  1Z60 A;  3KNV A;  4L58 A;  1VYX A;  1WEN A;  4GNF A;  2KE1 A;  3ZVZ B;  2L5U A;  1WE9 A;  5LCW B;  1T1H A;  2M3H A;  2JMI A;  3LRQ A;  2MNY A;  3I2D A;  4LAD B;  4MVT A;  4N4F A;  4AVX A;  3DQV R;  3VK6 A;  3O36 A;  4AP4 A;  2HYE D;  1WEP A;  2G6Q A;  5TBN A;  1F62 A;  3N9L A;  1MM3 A;  1MM2 A;  5FEY A;  2VJE B;  4AYC B;  3RPG B;  1FBV A;  2JRJ A;  3SOW A;  2KU3 A;  4LJN A;  2Y1N A;  2ECN A;  1VFY A;  1WEU A;  1JM7 A;  2QIZ A;  3RPG C;  2MUM A;  3N9N A;  3L11 A;  1VD4 A;  4GNG A;  5D1M B;  2YHO A;  1JOC A;  2KGI A;  2KWO A;  1Z6U A;  3ASL A;  2K1J A;  2M85 A;  4PPE A;  1X4U A;  1WES A;  4GND A;  3C5K A;  4L7X A;  4W4U A;  4A4B A;  3M62 A;  3EB6 A;  2KYU A;  4X3G A;  1G25 A;  4AUQ B;  2CSZ A;  2MA6 A;  4YAD A;  2K17 A;  2EA6 A;  3ZNI A;  4YAB A;  2KFT A;  1FP0 A;  2E6S A;  5C13 A;  2CKL A;  4R2Y A;  2OXQ C;  5H1T A;  4B86 C;  3GV4 A;  2H0D B;  4YBT A;  4I7B A;  2ECI A;  4I7C A;  4UI9 B;  3LQH A;  2F42 A;  2ZET C;  2LXH C;  2C2V S;  2YSJ A;  3HCT A;  1K2F A;  2VPE A;  4S3O B;  4ZDT A;  2RI7 A;  5J3X A;  3ZVY A;  2MD7 B;  4NN2 A;  4UP5 A;  2G43 A;  2LGK A;  3NG2 A;  4LKA A;  2F6N A;  4WZ0 A;  1LDK C;  3PUR A;  2LGV A;  2KWJ A;  3O34 A;  3KV5 A;  3MHH A;  2KWK A;  1RMD A;  5KH7 A;  2MT5 A;  5FB1 A;  4GNE A;  2EGP A;  4A4C A;  5G04 B;  2JMJ A;  2FSA A;  2YQM A;  3U5N A;  5FER A;  5D1K B;  2Y43 A;  2VJF B;  2CT2 A;  4YBS A;  3SOU A;  3QZV A;  3RTR B;  5DIN A;  2PNX A;  5B76 A;  2FUU A;  3U5P A;  5FB0 A;  4GB0 A;  2ECT A;  4UP0 A;  1ZBD B;  4YBM A;  3HTK C;  2LXP C;  3FL2 A;  4IC2 A;  2L75 A;  1WEW A;  2BAY A;  1IYM A;  1WEM A;  3O35 A;  5B77 A;  2MNZ A;  2G45 A;  2LRI C;  4V3L C;  1JM7 B;  5KH3 A;  4LLB A;  3M63 A;  5TDR A;  3SOX A;  2LDR A;  3U5O A;  3T6R A;  4A0C D;  3HCU A;  1X4I A;  3EB5 A;  4I7D A;  1Z2Q A;  2FUI A;  2L43 A;  5LKX A;  3U5M A;  3KQI A;  2C2L A;  4CA1 A;  4FK5 A;  3GL6 A;  5TAB A;  3PUQ A; 
#chains in the Genus database with same CATH topology
 2EOD A;  3C6W A;  1V87 A;  3ZPV 1;  1WIL A;  3LQI A;  4R7E A;  3O33 A;  4WZ3 B;  4YAX A;  4B7Y C;  2LN0 A;  2RSD A;  4PTB A;  2KIZ A;  5I3L A;  2M6M A;  5TDW A;  3V43 A;  2EXU A;  3LVQ E;  3O70 A;  2YU4 A;  2NAA A;  2KRE A;  2CKL B;  4S3O C;  2D8U A;  3T7L A;  3N9M A;  2YVR A;  2ECJ A;  5D1L B;  5TRB A;  2LAU A;  4BHW A;  1MBM A;  3DPL R;  3JUE A;  2IDA A;  2AN6 A;  4FIP A;  1WIM A;  3KV6 A;  2DSM A;  3N9O A;  2LV9 A;  2DX8 A;  4XI1 A;  5B78 A;  2ECW A;  2VPG A;  4QF2 A;  3FAO A;  4AYC A;  1E4U A;  5LKZ A;  4YC9 A;  2MD8 C;  2EGM A;  5JG6 A;  2YQL A;  4A49 A;  2P57 A;  4YAT A;  5AIU A;  2KKX A;  3HCS A;  5H9M A;  2LGG A;  4F52 B;  3L1Z B;  5K3Q A;  2KWN A;  5G05 B;  3H7H A;  4MSX A;  2Y1M A;  4IC3 A;  2JM3 A;  4O64 A;  3DDT A;  1BOR A;  2MA5 A;  1WGM A;  5C11 A;  4Z0O A;  2L0B A;  4O62 A;  4LK9 A;  1XWH A;  2VPB A;  2LQ6 A;  1WEV A;  4V3K C;  2YUC A;  2YW8 A;  4F1P A;  2E61 A;  4FJC A;  2XOY A;  1HYI A;  5LKU A;  4C9Z A;  2YSM A;  4WA6 A;  1WEE A;  2F6J A;  2K4D A;  1DVP A;  1WEO A;  3IHP A;  3M99 A;  2VPD A;  4ZUX U;  2LGL A;  2VP7 A;  2CSY A;  2XB1 A;  1LDJ B;  3ZYQ A;  2YHN A;  2H0D A;  2M1R A;  2XOC A;  4WZ2 A;  3L1X A;  1CHC A;  5DKA A;  3N9P A;  4Z0R A;  1WEQ A;  3N9Q A;  2MIQ A;  2XEU A;  3O7A A;  3M7K A;  5H1V A;  4Q6F A;  2YRE A;  4TKP B;  5SVI A;  3ZTG A;  2JMD A;  2D8S A;  2DJA A;  4FO9 A;  2QJ0 A;  3ZPV E;  5LKT A;  4BBQ A;  2I50 A;  2FD4 A;  2HDP A;  5B8D A;  2YYR A;  1N87 A;  2VNF A;  3LQJ A;  5AIT A;  2ECV A;  5B79 A;  4CCG X;  4OGC A;  2PUY A;  1U6G B;  5B75 A;  3FJU B;  4N3W A;  3PHD A;  5EYA F;  5KH9 A;  3DWD A;  2YT5 A;  4QF3 A;  2UZG A;  2K16 A;  3MHS A;  1WFK A;  2KR4 A;  4P5O B;  2QIC A;  1HYJ A;  2E6R A;  2B0O E;  4R8P K;  2ECG A;  2JUN A;  2YUR A;  4ZQL A;  3SHB A;  3O37 A;  3MDB C;  2VJF A;  2L80 A;  5H1U A;  2KGG A;  2VJE A;  5G0F A;  1X4J A;  2CRR A;  1Z60 A;  3KNV A;  4L58 A;  1VYX A;  3LJU X;  1WEN A;  4GNF A;  2KE1 A;  3ZVZ B;  2L5U A;  1WE9 A;  5LCW B;  1T1H A;  2M3H A;  2JMI A;  3LRQ A;  2MNY A;  3I2D A;  4LAD B;  4MVT A;  4N4F A;  4AVX A;  3DQV R;  3FM8 C;  3VK6 A;  3O36 A;  4AP4 A;  2HYE D;  3FAN A;  1WEP A;  2G6Q A;  5TBN A;  1F62 A;  3N9L A;  5SVX A;  1MM3 A;  1MM2 A;  5FEY A;  2VJE B;  4AYC B;  3RPG B;  1FBV A;  2JRJ A;  3SOW A;  2KU3 A;  4LJN A;  2Y1N A;  2ECN A;  1VFY A;  1WEU A;  1JM7 A;  2QIZ A;  4OGE A;  2L7P A;  3RPG C;  2KKY A;  2MUM A;  3N9N A;  3L11 A;  1VD4 A;  4GNG A;  5D1M B;  2YHO A;  1JOC A;  2KGI A;  2KWO A;  3KDE C;  2RR4 A;  2OWA A;  2MKE A;  1Z6U A;  3ASL A;  2K1J A;  2M85 A;  4PPE A;  5SVY A;  1X4U A;  1WES A;  4GND A;  3C5K A;  4L7X A;  4W4U A;  4A4B A;  3M62 A;  3EB6 A;  2KYU A;  4X3G A;  3Q1D A;  1G25 A;  4AUQ B;  3E2D A;  2CSZ A;  2MA6 A;  4YAD A;  2K17 A;  2EA6 A;  3ZNI A;  4YAB A;  2KFT A;  1FP0 A;  2E6S A;  5C13 A;  2CKL A;  4R2Y A;  2OXQ C;  5H1T A;  4B86 C;  3GV4 A;  2H0D B;  4YBT A;  4I7B A;  2ECI A;  4I7C A;  2CON A;  4UI9 B;  3LQH A;  2F42 A;  2ZET C;  2LXH C;  2C2V S;  2YSJ A;  3HCT A;  1K2F A;  2VPE A;  4S3O B;  5SVI B;  4ZDT A;  2RI7 A;  5J3X A;  3ZVY A;  2M13 A;  2MD7 B;  4NN2 A;  4UP5 A;  2G43 A;  2LGK A;  3LDY A;  3NG2 A;  4LKA A;  2F6N A;  4WZ0 A;  1LDK C;  3PUR A;  2LGV A;  2KWJ A;  3O34 A;  3KV5 A;  3MHH A;  1DCQ A;  3LVR E;  2KWK A;  2XP0 A;  1RMD A;  5KH7 A;  2MT5 A;  5FB1 A;  4H9D A;  4GNE A;  2EGP A;  4A4C A;  5G04 B;  2XOZ A;  2JMJ A;  2IQJ A;  2FSA A;  2YQM A;  3U5N A;  5FER A;  5D1K B;  2Y43 A;  3SUB A;  2VJF B;  2CT2 A;  4YBS A;  2CRW A;  3SOU A;  3QZV A;  3RTR B;  5DIN A;  2PNX A;  5B76 A;  2FUU A;  3T9K A;  3U5P A;  5FB0 A;  4GB0 A;  2ECT A;  4UP0 A;  1ZBD B;  4YBM A;  3HTK C;  2LXP C;  3FL2 A;  4IC2 A;  2L75 A;  1WEW A;  2BAY A;  3PLW A;  1IYM A;  1WEM A;  3O35 A;  5B77 A;  2MNZ A;  2G45 A;  2FFW A;  2LRI C;  4V3L C;  1JM7 B;  5KH3 A;  4LLB A;  3M63 A;  5TDR A;  3SOX A;  2LDR A;  3U5O A;  3T6R A;  4A0C D;  3HCU A;  1X4I A;  3EB5 A;  4I7D A;  1Z2Q A;  2FUI A;  2L43 A;  5LKX A;  3U5M A;  3KQI A;  2C2L A;  4CA1 A;  4FK5 A;  3O47 A;  3GL6 A;  4QQ4 A;  3FEH A;  5TAB A;  2CSV A;  3PUQ A; 
#chains in the Genus database with same CATH homology
 2EOD A;  3C6W A;  1V87 A;  3ZPV 1;  1WIL A;  3LQI A;  4WZ3 B;  3O33 A;  4R7E A;  4YAX A;  4B7Y C;  2LN0 A;  2RSD A;  4PTB A;  2KIZ A;  5I3L A;  2M6M A;  5TDW A;  3V43 A;  3O70 A;  2YU4 A;  2NAA A;  2KRE A;  2CKL B;  4S3O C;  3T7L A;  3N9M A;  2ECJ A;  5D1L B;  5TRB A;  4BHW A;  3DPL R;  2IDA A;  2AN6 A;  4FIP A;  1WIM A;  3KV6 A;  3N9O A;  2LV9 A;  2DX8 A;  4XI1 A;  5B78 A;  2ECW A;  2VPG A;  4QF2 A;  4AYC A;  1E4U A;  5LKZ A;  4YC9 A;  2MD8 C;  5JG6 A;  2YQL A;  4A49 A;  4YAT A;  5AIU A;  3HCS A;  5H9M A;  2LGG A;  4F52 B;  3L1Z B;  2KWN A;  5G05 B;  4MSX A;  2Y1M A;  4IC3 A;  4O64 A;  1BOR A;  2MA5 A;  1WGM A;  5C11 A;  2L0B A;  4LK9 A;  1XWH A;  2VPB A;  2LQ6 A;  1WEV A;  4V3K C;  2YUC A;  2YW8 A;  4FJC A;  1HYI A;  5LKU A;  4C9Z A;  2YSM A;  4WA6 A;  1WEE A;  2F6J A;  2K4D A;  1DVP A;  1WEO A;  3IHP A;  3M99 A;  2VPD A;  4ZUX U;  2LGL A;  2VP7 A;  2CSY A;  2XB1 A;  1LDJ B;  3ZYQ A;  2YHN A;  2H0D A;  2M1R A;  4WZ2 A;  3L1X A;  1CHC A;  5DKA A;  3N9P A;  1WEQ A;  3N9Q A;  2MIQ A;  2XEU A;  3O7A A;  5H1V A;  4Q6F A;  2YRE A;  4TKP B;  3ZTG A;  2JMD A;  2D8S A;  4FO9 A;  2QJ0 A;  3ZPV E;  5LKT A;  4BBQ A;  2I50 A;  2HDP A;  5B8D A;  2YYR A;  1N87 A;  2VNF A;  3LQJ A;  5AIT A;  2ECV A;  5B79 A;  4CCG X;  2PUY A;  1U6G B;  5B75 A;  4N3W A;  3PHD A;  5EYA F;  5KH9 A;  4QF3 A;  2YT5 A;  2UZG A;  2K16 A;  3MHS A;  1WFK A;  2KR4 A;  4P5O B;  2QIC A;  1HYJ A;  2E6R A;  4R8P K;  2ECG A;  4ZQL A;  2YUR A;  3SHB A;  3O37 A;  2VJF A;  2L80 A;  5H1U A;  2KGG A;  2VJE A;  5G0F A;  1X4J A;  1Z60 A;  3KNV A;  4L58 A;  1VYX A;  1WEN A;  4GNF A;  2KE1 A;  3ZVZ B;  2L5U A;  1WE9 A;  5LCW B;  1T1H A;  2M3H A;  2JMI A;  3LRQ A;  2MNY A;  3I2D A;  4LAD B;  4MVT A;  4N4F A;  4AVX A;  3DQV R;  3VK6 A;  3O36 A;  4AP4 A;  2HYE D;  1WEP A;  2G6Q A;  5TBN A;  1F62 A;  3N9L A;  1MM3 A;  1MM2 A;  5FEY A;  2VJE B;  4AYC B;  3RPG B;  1FBV A;  2JRJ A;  3SOW A;  2KU3 A;  4LJN A;  2Y1N A;  2ECN A;  1VFY A;  1WEU A;  1JM7 A;  2QIZ A;  3RPG C;  2MUM A;  3N9N A;  3L11 A;  1VD4 A;  4GNG A;  5D1M B;  2YHO A;  1JOC A;  2KGI A;  2KWO A;  1Z6U A;  3ASL A;  2K1J A;  2M85 A;  4PPE A;  1X4U A;  1WES A;  4GND A;  3C5K A;  4L7X A;  4W4U A;  4A4B A;  3M62 A;  3EB6 A;  2KYU A;  4X3G A;  1G25 A;  4AUQ B;  2CSZ A;  2MA6 A;  4YAD A;  2K17 A;  2EA6 A;  3ZNI A;  4YAB A;  2KFT A;  1FP0 A;  2E6S A;  5C13 A;  2CKL A;  4R2Y A;  2OXQ C;  5H1T A;  4B86 C;  3GV4 A;  2H0D B;  4YBT A;  4I7B A;  2ECI A;  4I7C A;  4UI9 B;  3LQH A;  2F42 A;  2ZET C;  2LXH C;  2C2V S;  2YSJ A;  3HCT A;  1K2F A;  2VPE A;  4S3O B;  4ZDT A;  2RI7 A;  5J3X A;  3ZVY A;  2MD7 B;  4NN2 A;  4UP5 A;  2G43 A;  2LGK A;  3NG2 A;  4LKA A;  2F6N A;  4WZ0 A;  1LDK C;  3PUR A;  2LGV A;  2KWJ A;  3O34 A;  3KV5 A;  3MHH A;  2KWK A;  1RMD A;  5KH7 A;  2MT5 A;  5FB1 A;  4GNE A;  2EGP A;  4A4C A;  5G04 B;  2JMJ A;  2FSA A;  2YQM A;  3U5N A;  5FER A;  5D1K B;  2Y43 A;  2VJF B;  2CT2 A;  4YBS A;  3SOU A;  3QZV A;  3RTR B;  5DIN A;  2PNX A;  5B76 A;  2FUU A;  3U5P A;  5FB0 A;  4GB0 A;  2ECT A;  4UP0 A;  1ZBD B;  4YBM A;  3HTK C;  2LXP C;  3FL2 A;  4IC2 A;  2L75 A;  1WEW A;  2BAY A;  1IYM A;  1WEM A;  3O35 A;  5B77 A;  2MNZ A;  2G45 A;  2LRI C;  4V3L C;  1JM7 B;  5KH3 A;  4LLB A;  3M63 A;  5TDR A;  3SOX A;  2LDR A;  3U5O A;  3T6R A;  4A0C D;  3HCU A;  1X4I A;  3EB5 A;  4I7D A;  1Z2Q A;  2FUI A;  2L43 A;  5LKX A;  3U5M A;  3KQI A;  2C2L A;  4CA1 A;  4FK5 A;  3GL6 A;  5TAB A;  3PUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...