4A0CD

Structure of the cand1-cul4b-rbx1 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CULLIN-ASSOCIATED NEDD8-DISSOCIATED PROTEIN 1
total genus 8
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4a0cD00
5J3XA 2M85A 2LGGA 3RPGB 4BHWA 5LKUA 2EODA 1X4IA 3ZYQA 2FUUA 3ZNIA 3PUQA 2EGPA 4QF2A 4R7EA 2K17A 2I50A 2H0DA 3ZTGA 4WZ3B 4YBTA 3N9OA 3MHSA 3O35A 4YATA 4S3OC 4PPEA 4V3LC 1VFYA 2YURA 4O64A 2JMJA 3U5MA 5D1LB 2G45A 5H9MA 1FP0A 3N9MA 2VPDA 1LDKC 3N9QA 2KWNA 1FBVA 3HCSA 4V3KC 3LRQA 4Q6FA 2XEUA 4UP0A 4YBSA 3O36A 5LKTA 2MNYA 4B86C 2E6SA 1WIMA 4FJCA 2LGLA 2F6JA 1JM7A 3U5NA 3L11A 2H0DB 1BORA 1U6GB 4WZ2A 2MUMA 3C6WA 2LQ6A 2VJEB 4LKAA 3U5OA 2LV9A 5TRBA 3PHDA 4I7CA 3SHBA 2G43A 4LK9A 5FERA 3DPLR 1WILA 4LLBA 4X3GA 5AIUA 4CCGX 4A4BA 2YSJA 3GL6A 3O34A 2LDRA 3ZVZB 2OXQC 5D1MB 2MA6A 5B75A 2ECJA 4AYCB 2M6MA 3ASLA 5C13A 2AN6A 2MA5A 2NAAA 3KNVA 2HYED 5AITA 4AUQB 3O37A 5FEYA 3RTRB 3M63A 2IDAA 4FO9A 4GNGA 1HYIA 4MVTA 2Y1MA 1MM2A 2JMIA 4CA1A 3O70A 2FUIA 5G05B 4GNEA 2E6RA 2KFTA 2LGVA 3N9PA 1N87A 2LN0A 3HCTA 1T1HA 5LCWB 1RMDA 5JG6A 2JMDA 5DINA 4R2YA 2F42A 4L7XA 4AVXA 3EB6A 4AYCA 1WE9A 3MHHA 4GNDA 3SOXA 5B8DA 5FB0A 3T7LA 5B77A 1WEQA 1ZBDB 2YYRA 2VPGA 1WESA 2YU4A 4N4FA 2MIQA 2DX8A 1G25A 2BAYA 4NN2A 5B78A 4LJNA 4FK5A 1Z6UA 3O33A 1VYXA 1MM3A 3ZVYA 2L80A 2ECGA 1V87A 2L5UA 2LXHC 2KWJA 2M1RA 2CSYA 3IHPA 1Z60A 4ZDTA 2KWKA 4UI9B 4A49A 4BBQA 2JRJA 3HCUA 4A4CA 1JOCA 2MD8C 5LKZA 5TDRA 5TABA 5DKAA 2RSDA 1WEEA 3SOWA 1WEPA 4L58A 2ECTA 3PURA 3ZPVE 2ZETC 2CKLB 4ZQLA 2KU3A 3N9LA 4C9ZA 5TBNA 3LQIA 4LADB 3HTKC 2RI7A 4R8PK 2Y43A 3KV5A 2ECIA 4WA6A 2G6QA 4TKPB 4YBMA 2F6NA 3SOUA 1DVPA 1WEWA 3I2DA 4WZ0A 2YUCA 4YAXA 2M3HA 1LDJB 2QIZA 4S3OB 2YQLA 1WGMA 2MT5A 3LQHA 1X4JA 1F62A 5G0FA 3V43A 5B79A 2C2VS 2VJFA 4PTBA 3L1ZB 3KV6A 3O7AA 2C2LA 3NG2A 2HDPA 2KIZA 2PNXA 5KH3A 2KYUA 2QJ0A 2MD7B 2UZGA 3L1XA 2YSMA 1WEOA 4AP4A 1JM7B 2CT2A 2D8SA 2KWOA 5B76A 1VD4A 4YC9A 3DQVR 2PUYA 2YT5A 2ECVA 2KE1A 2XB1A 5D1KB 5H1VA 2LXPC 5EYAF 5G04B 2LGKA 1WEVA 1CHCA 4GNFA 5KH7A 3N9NA 1WEMA 4B7YC 1WENA 3GV4A 2YHNA 2VP7A 2LRIC 1Z2QA 1K2FA 4P5OB 5H1TA 4ZUXU 3LQJA 3T6RA 2L43A 3RPGC 3C5KA 4F52B 2VPBA 5LKXA 2CSZA 2VNFA 4YABA 1E4UA 2KGIA 3M62A 2YW8A 3QZVA 2ECWA 2K16A 5TDWA 2K4DA 1WEUA 1X4UA 4IC2A 2L75A 2QICA 3ZPV1 2YQMA 4YADA 3M99A 5C11A 2FSAA 2ECNA 2VJEA 5FB1A 5I3LA 1HYJA 3VK6A 4A0CD 3U5PA 2VPEA 3EB5A 4N3WA 2KREA 2CKLA 2K1JA 2YREA 5H1UA 2L0BA 4QF3A 3KQIA 1IYMA 5KH9A 4W4UA 1XWHA 4GB0A 4I7DA 2MNZA 2KGGA 2KR4A 3FL2A 4FIPA 2VJFB 2YHOA 4UP5A 2EA6A 4IC3A 1WFKA 4MSXA 2Y1NA 4I7BA 4XI1A
chains in the Genus database with same CATH superfamily
5J3XA 2M85A 3MDBC 2LGGA 3RPGB 4BHWA 5LKUA 3E2DA 2EODA 4F1PA 1DCQA 1X4IA 3ZYQA 2FUUA 3ZNIA 3PUQA 2EGPA 4QF2A 4R7EA 2K17A 2I50A 2H0DA 2KKYA 3DDTA 3T9KA 3ZTGA 2XOCA 4WZ3B 4YBTA 3N9OA 3MHSA 3O35A 4YATA 4S3OC 3FEHA 4PPEA 4V3LC 1VFYA 2YURA 2KKXA 4O64A 2JMJA 3U5MA 5D1LB 2G45A 5H9MA 1FP0A 3N9MA 5SVXA 2VPDA 1LDKC 2YVRA 3N9QA 2KWNA 1FBVA 3LVQE 3HCSA 3DWDA 4V3KC 3LRQA 4Q6FA 2XEUA 4UP0A 4YBSA 3O36A 2FD4A 2CONA 5LKTA 2MNYA 5SVYA 4B86C 3KDEC 2E6SA 1WIMA 4FJCA 2LGLA 2F6JA 1JM7A 3U5NA 3L11A 2H0DB 2DJAA 1BORA 1U6GB 4WZ2A 2MUMA 3C6WA 2LQ6A 2M13A 2VJEB 4LKAA 3U5OA 2LV9A 5TRBA 5SVIA 3PHDA 4I7CA 3SHBA 2G43A 4LK9A 5FERA 3DPLR 1WILA 4LLBA 4X3GA 5AIUA 4CCGX 4A4BA 2YSJA 3GL6A 3O34A 2B0OE 2LDRA 2MKEA 3ZVZB 2OXQC 5D1MB 2MA6A 5B75A 2ECJA 4AYCB 2M6MA 3ASLA 5C13A 2AN6A 2MA5A 2NAAA 3KNVA 2HYED 2CRRA 5AITA 4AUQB 2JM3A 3O37A 5FEYA 3RTRB 3M63A 2IDAA 4FO9A 4GNGA 1HYIA 4MVTA 2Y1MA 1MM2A 2JMIA 4CA1A 2E61A 3O70A 3FJUB 2FUIA 4QQ4A 5G05B 4GNEA 2OWAA 2E6RA 2KFTA 2LGVA 3N9PA 1N87A 2LN0A 3HCTA 1T1HA 5LCWB 1RMDA 5JG6A 2JMDA 5DINA 4R2YA 2F42A 4L7XA 4AVXA 3EB6A 4AYCA 1WE9A 3MHHA 4GNDA 3SOXA 5B8DA 3H7HA 5FB0A 3T7LA 3LJUX 5B77A 1WEQA 1ZBDB 2YYRA 3M7KA 2VPGA 1WESA 2YU4A 4N4FA 2MIQA 2DX8A 1G25A 2BAYA 4NN2A 5B78A 4LJNA 4FK5A 1Z6UA 3O33A 1VYXA 1MM3A 3ZVYA 2L80A 2ECGA 1V87A 2L5UA 2LXHC 2KWJA 2M1RA 2CSYA 3IHPA 1Z60A 4ZDTA 2KWKA 4UI9B 4A49A 4BBQA 2JRJA 3HCUA 4A4CA 1JOCA 2MD8C 5LKZA 5TDRA 5TABA 5DKAA 2RSDA 1WEEA 3SOWA 1WEPA 4L58A 2ECTA 3PURA 3ZPVE 3LDYA 2ZETC 2CKLB 4ZQLA 3LVRE 2KU3A 3N9LA 4C9ZA 5TBNA 3LQIA 4LADB 3HTKC 2RI7A 4R8PK 2Y43A 3KV5A 2DSMA 2EXUA 2ECIA 3O47A 4OGCA 4WA6A 2G6QA 4TKPB 4YBMA 2FFWA 2F6NA 3FAOA 3SOUA 1DVPA 1WEWA 3I2DA 2XP0A 2YUCA 4WZ0A 4YAXA 1MBMA 1LDJB 2M3HA 2QIZA 4S3OB 2YQLA 1WGMA 2MT5A 3LQHA 1X4JA 1F62A 5G0FA 4Z0OA 3V43A 5B79A 2C2VS 2VJFA 4PTBA 3L1ZB 3KV6A 3O7AA 2C2LA 3NG2A 2HDPA 2KIZA 2PNXA 5KH3A 2KYUA 2QJ0A 3JUEA 2MD7B 2UZGA 3L1XA 2YSMA 1WEOA 4AP4A 1JM7B 2CT2A 2D8SA 2KWOA 5B76A 1VD4A 4YC9A 3DQVR 2PUYA 2YT5A 3FANA 2ECVA 2KE1A 2XB1A 5D1KB 5K3QA 5H1VA 2LAUA 2LXPC 5EYAF 5G04B 2LGKA 1WEVA 1CHCA 4GNFA 2CSVA 2XOYA 2D8UA 5KH7A 3N9NA 3FM8C 1WEMA 4B7YC 1WENA 4H9DA 3GV4A 2YHNA 2VP7A 2LRIC 1Z2QA 1K2FA 4P5OB 5H1TA 4ZUXU 3LQJA 2IQJA 4O62A 3T6RA 2L43A 4OGEA 3RPGC 3C5KA 4Z0RA 2XOZA 4F52B 2VPBA 5LKXA 2CSZA 2VNFA 4YABA 2RR4A 1E4UA 2KGIA 3M62A 2YW8A 3QZVA 2ECWA 2K16A 5TDWA 2K4DA 1WEUA 1X4UA 4IC2A 2L75A 3SUBA 2QICA 3ZPV1 2YQMA 3PLWA 3M99A 4YADA 5C11A 2FSAA 5SVIB 2ECNA 2VJEA 2CRWA 5FB1A 5I3LA 1HYJA 3VK6A 4A0CD 3U5PA 2VPEA 3EB5A 4N3WA 2KREA 2EGMA 2CKLA 3Q1DA 2JUNA 2K1JA 2YREA 5H1UA 2L7PA 2L0BA 4QF3A 3KQIA 1IYMA 5KH9A 4W4UA 1XWHA 4GB0A 4I7DA 2MNZA 2KGGA 2KR4A 3FL2A 2P57A 4FIPA 2VJFB 2YHOA 4UP5A 2EA6A 4IC3A 1WFKA 4MSXA 2Y1NA 4I7BA 4XI1A
chains in the Genus database with same CATH topology
5J3XA 2M85A 2LGGA 3RPGB 4BHWA 5LKUA 2EODA 1X4IA 3ZYQA 2FUUA 3ZNIA 3PUQA 2EGPA 4QF2A 4R7EA 2K17A 2I50A 2H0DA 3ZTGA 4WZ3B 4YBTA 3N9OA 3MHSA 3O35A 4YATA 4S3OC 4PPEA 4V3LC 1VFYA 2YURA 4O64A 2JMJA 3U5MA 5D1LB 2G45A 5H9MA 1FP0A 3N9MA 2VPDA 1LDKC 3N9QA 2KWNA 1FBVA 3HCSA 4V3KC 3LRQA 4Q6FA 2XEUA 4UP0A 4YBSA 3O36A 5LKTA 2MNYA 4B86C 2E6SA 1WIMA 4FJCA 2LGLA 2F6JA 1JM7A 3U5NA 3L11A 2H0DB 1BORA 1U6GB 4WZ2A 2MUMA 3C6WA 2LQ6A 2VJEB 4LKAA 3U5OA 2LV9A 5TRBA 3PHDA 4I7CA 3SHBA 2G43A 4LK9A 5FERA 3DPLR 1WILA 4LLBA 4X3GA 5AIUA 4CCGX 4A4BA 2YSJA 3GL6A 3O34A 2LDRA 3ZVZB 2OXQC 5D1MB 2MA6A 5B75A 2ECJA 4AYCB 2M6MA 3ASLA 5C13A 2AN6A 2MA5A 2NAAA 3KNVA 2HYED 5AITA 4AUQB 3O37A 5FEYA 3RTRB 3M63A 2IDAA 4FO9A 4GNGA 1HYIA 4MVTA 2Y1MA 1MM2A 2JMIA 4CA1A 3O70A 2FUIA 5G05B 4GNEA 2E6RA 2KFTA 2LGVA 3N9PA 1N87A 2LN0A 3HCTA 1T1HA 5LCWB 1RMDA 5JG6A 2JMDA 5DINA 4R2YA 2F42A 4L7XA 4AVXA 3EB6A 4AYCA 1WE9A 3MHHA 4GNDA 3SOXA 5B8DA 5FB0A 3T7LA 5B77A 1WEQA 1ZBDB 2YYRA 2VPGA 1WESA 2YU4A 4N4FA 2MIQA 2DX8A 1G25A 2BAYA 4NN2A 5B78A 4LJNA 4FK5A 1Z6UA 3O33A 1VYXA 1MM3A 3ZVYA 2L80A 2ECGA 1V87A 2L5UA 2LXHC 2KWJA 2M1RA 2CSYA 3IHPA 1Z60A 4ZDTA 2KWKA 4UI9B 4A49A 4BBQA 2JRJA 3HCUA 4A4CA 1JOCA 2MD8C 5LKZA 5TDRA 5TABA 5DKAA 2RSDA 1WEEA 3SOWA 1WEPA 4L58A 2ECTA 3PURA 3ZPVE 2ZETC 2CKLB 4ZQLA 2KU3A 3N9LA 4C9ZA 5TBNA 3LQIA 4LADB 3HTKC 2RI7A 4R8PK 2Y43A 3KV5A 2ECIA 4WA6A 2G6QA 4TKPB 4YBMA 2F6NA 3SOUA 1DVPA 1WEWA 3I2DA 4WZ0A 2YUCA 4YAXA 2M3HA 1LDJB 2QIZA 4S3OB 2YQLA 1WGMA 2MT5A 3LQHA 1X4JA 1F62A 5G0FA 3V43A 5B79A 2C2VS 2VJFA 4PTBA 3L1ZB 3KV6A 3O7AA 2C2LA 3NG2A 2HDPA 2KIZA 2PNXA 5KH3A 2KYUA 2QJ0A 2MD7B 2UZGA 3L1XA 2YSMA 1WEOA 4AP4A 1JM7B 2CT2A 2D8SA 2KWOA 5B76A 1VD4A 4YC9A 3DQVR 2PUYA 2YT5A 2ECVA 2KE1A 2XB1A 5D1KB 5H1VA 2LXPC 5EYAF 5G04B 2LGKA 1WEVA 1CHCA 4GNFA 5KH7A 3N9NA 1WEMA 4B7YC 1WENA 3GV4A 2YHNA 2VP7A 2LRIC 1Z2QA 1K2FA 4P5OB 5H1TA 4ZUXU 3LQJA 3T6RA 2L43A 3RPGC 3C5KA 4F52B 2VPBA 5LKXA 2CSZA 2VNFA 4YABA 1E4UA 2KGIA 3M62A 2YW8A 3QZVA 2ECWA 2K16A 5TDWA 2K4DA 1WEUA 1X4UA 4IC2A 2L75A 2QICA 3ZPV1 2YQMA 4YADA 3M99A 5C11A 2FSAA 2ECNA 2VJEA 5FB1A 5I3LA 1HYJA 3VK6A 4A0CD 3U5PA 2VPEA 3EB5A 4N3WA 2KREA 2CKLA 2K1JA 2YREA 5H1UA 2L0BA 4QF3A 3KQIA 1IYMA 5KH9A 4W4UA 1XWHA 4GB0A 4I7DA 2MNZA 2KGGA 2KR4A 3FL2A 4FIPA 2VJFB 2YHOA 4UP5A 2EA6A 4IC3A 1WFKA 4MSXA 2Y1NA 4I7BA 4XI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3X A;  2M85 A;  2LGG A;  3RPG B;  4BHW A;  5LKU A;  2EOD A;  1X4I A;  3ZYQ A;  2FUU A;  3ZNI A;  3PUQ A;  2EGP A;  4QF2 A;  4R7E A;  2K17 A;  2I50 A;  2H0D A;  3ZTG A;  4WZ3 B;  4YBT A;  3N9O A;  3MHS A;  3O35 A;  4YAT A;  4S3O C;  4PPE A;  4V3L C;  1VFY A;  2YUR A;  4O64 A;  2JMJ A;  3U5M A;  5D1L B;  2G45 A;  5H9M A;  1FP0 A;  3N9M A;  2VPD A;  1LDK C;  3N9Q A;  2KWN A;  1FBV A;  3HCS A;  4V3K C;  3LRQ A;  4Q6F A;  2XEU A;  4UP0 A;  4YBS A;  3O36 A;  5LKT A;  2MNY A;  4B86 C;  2E6S A;  1WIM A;  4FJC A;  2LGL A;  2F6J A;  1JM7 A;  3U5N A;  3L11 A;  2H0D B;  1BOR A;  1U6G B;  4WZ2 A;  2MUM A;  3C6W A;  2LQ6 A;  2VJE B;  4LKA A;  3U5O A;  2LV9 A;  5TRB A;  3PHD A;  4I7C A;  3SHB A;  2G43 A;  4LK9 A;  5FER A;  3DPL R;  1WIL A;  4LLB A;  4X3G A;  5AIU A;  4CCG X;  4A4B A;  2YSJ A;  3GL6 A;  3O34 A;  2LDR A;  3ZVZ B;  2OXQ C;  5D1M B;  2MA6 A;  5B75 A;  2ECJ A;  4AYC B;  2M6M A;  3ASL A;  5C13 A;  2AN6 A;  2MA5 A;  2NAA A;  3KNV A;  2HYE D;  5AIT A;  4AUQ B;  3O37 A;  5FEY A;  3RTR B;  3M63 A;  2IDA A;  4FO9 A;  4GNG A;  1HYI A;  4MVT A;  2Y1M A;  1MM2 A;  2JMI A;  4CA1 A;  3O70 A;  2FUI A;  5G05 B;  4GNE A;  2E6R A;  2KFT A;  2LGV A;  3N9P A;  1N87 A;  2LN0 A;  3HCT A;  1T1H A;  5LCW B;  1RMD A;  5JG6 A;  2JMD A;  5DIN A;  4R2Y A;  2F42 A;  4L7X A;  4AVX A;  3EB6 A;  4AYC A;  1WE9 A;  3MHH A;  4GND A;  3SOX A;  5B8D A;  5FB0 A;  3T7L A;  5B77 A;  1WEQ A;  1ZBD B;  2YYR A;  2VPG A;  1WES A;  2YU4 A;  4N4F A;  2MIQ A;  2DX8 A;  1G25 A;  2BAY A;  4NN2 A;  5B78 A;  4LJN A;  4FK5 A;  1Z6U A;  3O33 A;  1VYX A;  1MM3 A;  3ZVY A;  2L80 A;  2ECG A;  1V87 A;  2L5U A;  2LXH C;  2KWJ A;  2M1R A;  2CSY A;  3IHP A;  1Z60 A;  4ZDT A;  2KWK A;  4UI9 B;  4A49 A;  4BBQ A;  2JRJ A;  3HCU A;  4A4C A;  1JOC A;  2MD8 C;  5LKZ A;  5TDR A;  5TAB A;  5DKA A;  2RSD A;  1WEE A;  3SOW A;  1WEP A;  4L58 A;  2ECT A;  3PUR A;  3ZPV E;  2ZET C;  2CKL B;  4ZQL A;  2KU3 A;  3N9L A;  4C9Z A;  5TBN A;  3LQI A;  4LAD B;  3HTK C;  2RI7 A;  4R8P K;  2Y43 A;  3KV5 A;  2ECI A;  4WA6 A;  2G6Q A;  4TKP B;  4YBM A;  2F6N A;  3SOU A;  1DVP A;  1WEW A;  3I2D A;  4WZ0 A;  2YUC A;  4YAX A;  2M3H A;  1LDJ B;  2QIZ A;  4S3O B;  2YQL A;  1WGM A;  2MT5 A;  3LQH A;  1X4J A;  1F62 A;  5G0F A;  3V43 A;  5B79 A;  2C2V S;  2VJF A;  4PTB A;  3L1Z B;  3KV6 A;  3O7A A;  2C2L A;  3NG2 A;  2HDP A;  2KIZ A;  2PNX A;  5KH3 A;  2KYU A;  2QJ0 A;  2MD7 B;  2UZG A;  3L1X A;  2YSM A;  1WEO A;  4AP4 A;  1JM7 B;  2CT2 A;  2D8S A;  2KWO A;  5B76 A;  1VD4 A;  4YC9 A;  3DQV R;  2PUY A;  2YT5 A;  2ECV A;  2KE1 A;  2XB1 A;  5D1K B;  5H1V A;  2LXP C;  5EYA F;  5G04 B;  2LGK A;  1WEV A;  1CHC A;  4GNF A;  5KH7 A;  3N9N A;  1WEM A;  4B7Y C;  1WEN A;  3GV4 A;  2YHN A;  2VP7 A;  2LRI C;  1Z2Q A;  1K2F A;  4P5O B;  5H1T A;  4ZUX U;  3LQJ A;  3T6R A;  2L43 A;  3RPG C;  3C5K A;  4F52 B;  2VPB A;  5LKX A;  2CSZ A;  2VNF A;  4YAB A;  1E4U A;  2KGI A;  3M62 A;  2YW8 A;  3QZV A;  2ECW A;  2K16 A;  5TDW A;  2K4D A;  1WEU A;  1X4U A;  4IC2 A;  2L75 A;  2QIC A;  3ZPV 1;  2YQM A;  4YAD A;  3M99 A;  5C11 A;  2FSA A;  2ECN A;  2VJE A;  5FB1 A;  5I3L A;  1HYJ A;  3VK6 A;  4A0C D;  3U5P A;  2VPE A;  3EB5 A;  4N3W A;  2KRE A;  2CKL A;  2K1J A;  2YRE A;  5H1U A;  2L0B A;  4QF3 A;  3KQI A;  1IYM A;  5KH9 A;  4W4U A;  1XWH A;  4GB0 A;  4I7D A;  2MNZ A;  2KGG A;  2KR4 A;  3FL2 A;  4FIP A;  2VJF B;  2YHO A;  4UP5 A;  2EA6 A;  4IC3 A;  1WFK A;  4MSX A;  2Y1N A;  4I7B A;  4XI1 A; 
#chains in the Genus database with same CATH topology
 5J3X A;  2M85 A;  3MDB C;  2LGG A;  3RPG B;  4BHW A;  5LKU A;  3E2D A;  2EOD A;  4F1P A;  1DCQ A;  1X4I A;  3ZYQ A;  2FUU A;  3ZNI A;  3PUQ A;  2EGP A;  4QF2 A;  4R7E A;  2K17 A;  2I50 A;  2H0D A;  2KKY A;  3DDT A;  3T9K A;  3ZTG A;  2XOC A;  4WZ3 B;  4YBT A;  3N9O A;  3MHS A;  3O35 A;  4YAT A;  4S3O C;  3FEH A;  4PPE A;  4V3L C;  1VFY A;  2YUR A;  2KKX A;  4O64 A;  2JMJ A;  3U5M A;  5D1L B;  2G45 A;  5H9M A;  1FP0 A;  3N9M A;  5SVX A;  2VPD A;  1LDK C;  2YVR A;  3N9Q A;  2KWN A;  1FBV A;  3LVQ E;  3HCS A;  3DWD A;  4V3K C;  3LRQ A;  4Q6F A;  2XEU A;  4UP0 A;  4YBS A;  3O36 A;  2FD4 A;  2CON A;  5LKT A;  2MNY A;  5SVY A;  4B86 C;  3KDE C;  2E6S A;  1WIM A;  4FJC A;  2LGL A;  2F6J A;  1JM7 A;  3U5N A;  3L11 A;  2H0D B;  2DJA A;  1BOR A;  1U6G B;  4WZ2 A;  2MUM A;  3C6W A;  2LQ6 A;  2M13 A;  2VJE B;  4LKA A;  3U5O A;  2LV9 A;  5TRB A;  5SVI A;  3PHD A;  4I7C A;  3SHB A;  2G43 A;  4LK9 A;  5FER A;  3DPL R;  1WIL A;  4LLB A;  4X3G A;  5AIU A;  4CCG X;  4A4B A;  2YSJ A;  3GL6 A;  3O34 A;  2B0O E;  2LDR A;  2MKE A;  3ZVZ B;  2OXQ C;  5D1M B;  2MA6 A;  5B75 A;  2ECJ A;  4AYC B;  2M6M A;  3ASL A;  5C13 A;  2AN6 A;  2MA5 A;  2NAA A;  3KNV A;  2HYE D;  2CRR A;  5AIT A;  4AUQ B;  2JM3 A;  3O37 A;  5FEY A;  3RTR B;  3M63 A;  2IDA A;  4FO9 A;  4GNG A;  1HYI A;  4MVT A;  2Y1M A;  1MM2 A;  2JMI A;  4CA1 A;  2E61 A;  3O70 A;  3FJU B;  2FUI A;  4QQ4 A;  5G05 B;  4GNE A;  2OWA A;  2E6R A;  2KFT A;  2LGV A;  3N9P A;  1N87 A;  2LN0 A;  3HCT A;  1T1H A;  5LCW B;  1RMD A;  5JG6 A;  2JMD A;  5DIN A;  4R2Y A;  2F42 A;  4L7X A;  4AVX A;  3EB6 A;  4AYC A;  1WE9 A;  3MHH A;  4GND A;  3SOX A;  5B8D A;  3H7H A;  5FB0 A;  3T7L A;  3LJU X;  5B77 A;  1WEQ A;  1ZBD B;  2YYR A;  3M7K A;  2VPG A;  1WES A;  2YU4 A;  4N4F A;  2MIQ A;  2DX8 A;  1G25 A;  2BAY A;  4NN2 A;  5B78 A;  4LJN A;  4FK5 A;  1Z6U A;  3O33 A;  1VYX A;  1MM3 A;  3ZVY A;  2L80 A;  2ECG A;  1V87 A;  2L5U A;  2LXH C;  2KWJ A;  2M1R A;  2CSY A;  3IHP A;  1Z60 A;  4ZDT A;  2KWK A;  4UI9 B;  4A49 A;  4BBQ A;  2JRJ A;  3HCU A;  4A4C A;  1JOC A;  2MD8 C;  5LKZ A;  5TDR A;  5TAB A;  5DKA A;  2RSD A;  1WEE A;  3SOW A;  1WEP A;  4L58 A;  2ECT A;  3PUR A;  3ZPV E;  3LDY A;  2ZET C;  2CKL B;  4ZQL A;  3LVR E;  2KU3 A;  3N9L A;  4C9Z A;  5TBN A;  3LQI A;  4LAD B;  3HTK C;  2RI7 A;  4R8P K;  2Y43 A;  3KV5 A;  2DSM A;  2EXU A;  2ECI A;  3O47 A;  4OGC A;  4WA6 A;  2G6Q A;  4TKP B;  4YBM A;  2FFW A;  2F6N A;  3FAO A;  3SOU A;  1DVP A;  1WEW A;  3I2D A;  2XP0 A;  2YUC A;  4WZ0 A;  4YAX A;  1MBM A;  1LDJ B;  2M3H A;  2QIZ A;  4S3O B;  2YQL A;  1WGM A;  2MT5 A;  3LQH A;  1X4J A;  1F62 A;  5G0F A;  4Z0O A;  3V43 A;  5B79 A;  2C2V S;  2VJF A;  4PTB A;  3L1Z B;  3KV6 A;  3O7A A;  2C2L A;  3NG2 A;  2HDP A;  2KIZ A;  2PNX A;  5KH3 A;  2KYU A;  2QJ0 A;  3JUE A;  2MD7 B;  2UZG A;  3L1X A;  2YSM A;  1WEO A;  4AP4 A;  1JM7 B;  2CT2 A;  2D8S A;  2KWO A;  5B76 A;  1VD4 A;  4YC9 A;  3DQV R;  2PUY A;  2YT5 A;  3FAN A;  2ECV A;  2KE1 A;  2XB1 A;  5D1K B;  5K3Q A;  5H1V A;  2LAU A;  2LXP C;  5EYA F;  5G04 B;  2LGK A;  1WEV A;  1CHC A;  4GNF A;  2CSV A;  2XOY A;  2D8U A;  5KH7 A;  3N9N A;  3FM8 C;  1WEM A;  4B7Y C;  1WEN A;  4H9D A;  3GV4 A;  2YHN A;  2VP7 A;  2LRI C;  1Z2Q A;  1K2F A;  4P5O B;  5H1T A;  4ZUX U;  3LQJ A;  2IQJ A;  4O62 A;  3T6R A;  2L43 A;  4OGE A;  3RPG C;  3C5K A;  4Z0R A;  2XOZ A;  4F52 B;  2VPB A;  5LKX A;  2CSZ A;  2VNF A;  4YAB A;  2RR4 A;  1E4U A;  2KGI A;  3M62 A;  2YW8 A;  3QZV A;  2ECW A;  2K16 A;  5TDW A;  2K4D A;  1WEU A;  1X4U A;  4IC2 A;  2L75 A;  3SUB A;  2QIC A;  3ZPV 1;  2YQM A;  3PLW A;  3M99 A;  4YAD A;  5C11 A;  2FSA A;  5SVI B;  2ECN A;  2VJE A;  2CRW A;  5FB1 A;  5I3L A;  1HYJ A;  3VK6 A;  4A0C D;  3U5P A;  2VPE A;  3EB5 A;  4N3W A;  2KRE A;  2EGM A;  2CKL A;  3Q1D A;  2JUN A;  2K1J A;  2YRE A;  5H1U A;  2L7P A;  2L0B A;  4QF3 A;  3KQI A;  1IYM A;  5KH9 A;  4W4U A;  1XWH A;  4GB0 A;  4I7D A;  2MNZ A;  2KGG A;  2KR4 A;  3FL2 A;  2P57 A;  4FIP A;  2VJF B;  2YHO A;  4UP5 A;  2EA6 A;  4IC3 A;  1WFK A;  4MSX A;  2Y1N A;  4I7B A;  4XI1 A; 
#chains in the Genus database with same CATH homology
 5J3X A;  2M85 A;  2LGG A;  3RPG B;  4BHW A;  5LKU A;  2EOD A;  1X4I A;  3ZYQ A;  2FUU A;  3ZNI A;  3PUQ A;  2EGP A;  4QF2 A;  4R7E A;  2K17 A;  2I50 A;  2H0D A;  3ZTG A;  4WZ3 B;  4YBT A;  3N9O A;  3MHS A;  3O35 A;  4YAT A;  4S3O C;  4PPE A;  4V3L C;  1VFY A;  2YUR A;  4O64 A;  2JMJ A;  3U5M A;  5D1L B;  2G45 A;  5H9M A;  1FP0 A;  3N9M A;  2VPD A;  1LDK C;  3N9Q A;  2KWN A;  1FBV A;  3HCS A;  4V3K C;  3LRQ A;  4Q6F A;  2XEU A;  4UP0 A;  4YBS A;  3O36 A;  5LKT A;  2MNY A;  4B86 C;  2E6S A;  1WIM A;  4FJC A;  2LGL A;  2F6J A;  1JM7 A;  3U5N A;  3L11 A;  2H0D B;  1BOR A;  1U6G B;  4WZ2 A;  2MUM A;  3C6W A;  2LQ6 A;  2VJE B;  4LKA A;  3U5O A;  2LV9 A;  5TRB A;  3PHD A;  4I7C A;  3SHB A;  2G43 A;  4LK9 A;  5FER A;  3DPL R;  1WIL A;  4LLB A;  4X3G A;  5AIU A;  4CCG X;  4A4B A;  2YSJ A;  3GL6 A;  3O34 A;  2LDR A;  3ZVZ B;  2OXQ C;  5D1M B;  2MA6 A;  5B75 A;  2ECJ A;  4AYC B;  2M6M A;  3ASL A;  5C13 A;  2AN6 A;  2MA5 A;  2NAA A;  3KNV A;  2HYE D;  5AIT A;  4AUQ B;  3O37 A;  5FEY A;  3RTR B;  3M63 A;  2IDA A;  4FO9 A;  4GNG A;  1HYI A;  4MVT A;  2Y1M A;  1MM2 A;  2JMI A;  4CA1 A;  3O70 A;  2FUI A;  5G05 B;  4GNE A;  2E6R A;  2KFT A;  2LGV A;  3N9P A;  1N87 A;  2LN0 A;  3HCT A;  1T1H A;  5LCW B;  1RMD A;  5JG6 A;  2JMD A;  5DIN A;  4R2Y A;  2F42 A;  4L7X A;  4AVX A;  3EB6 A;  4AYC A;  1WE9 A;  3MHH A;  4GND A;  3SOX A;  5B8D A;  5FB0 A;  3T7L A;  5B77 A;  1WEQ A;  1ZBD B;  2YYR A;  2VPG A;  1WES A;  2YU4 A;  4N4F A;  2MIQ A;  2DX8 A;  1G25 A;  2BAY A;  4NN2 A;  5B78 A;  4LJN A;  4FK5 A;  1Z6U A;  3O33 A;  1VYX A;  1MM3 A;  3ZVY A;  2L80 A;  2ECG A;  1V87 A;  2L5U A;  2LXH C;  2KWJ A;  2M1R A;  2CSY A;  3IHP A;  1Z60 A;  4ZDT A;  2KWK A;  4UI9 B;  4A49 A;  4BBQ A;  2JRJ A;  3HCU A;  4A4C A;  1JOC A;  2MD8 C;  5LKZ A;  5TDR A;  5TAB A;  5DKA A;  2RSD A;  1WEE A;  3SOW A;  1WEP A;  4L58 A;  2ECT A;  3PUR A;  3ZPV E;  2ZET C;  2CKL B;  4ZQL A;  2KU3 A;  3N9L A;  4C9Z A;  5TBN A;  3LQI A;  4LAD B;  3HTK C;  2RI7 A;  4R8P K;  2Y43 A;  3KV5 A;  2ECI A;  4WA6 A;  2G6Q A;  4TKP B;  4YBM A;  2F6N A;  3SOU A;  1DVP A;  1WEW A;  3I2D A;  4WZ0 A;  2YUC A;  4YAX A;  2M3H A;  1LDJ B;  2QIZ A;  4S3O B;  2YQL A;  1WGM A;  2MT5 A;  3LQH A;  1X4J A;  1F62 A;  5G0F A;  3V43 A;  5B79 A;  2C2V S;  2VJF A;  4PTB A;  3L1Z B;  3KV6 A;  3O7A A;  2C2L A;  3NG2 A;  2HDP A;  2KIZ A;  2PNX A;  5KH3 A;  2KYU A;  2QJ0 A;  2MD7 B;  2UZG A;  3L1X A;  2YSM A;  1WEO A;  4AP4 A;  1JM7 B;  2CT2 A;  2D8S A;  2KWO A;  5B76 A;  1VD4 A;  4YC9 A;  3DQV R;  2PUY A;  2YT5 A;  2ECV A;  2KE1 A;  2XB1 A;  5D1K B;  5H1V A;  2LXP C;  5EYA F;  5G04 B;  2LGK A;  1WEV A;  1CHC A;  4GNF A;  5KH7 A;  3N9N A;  1WEM A;  4B7Y C;  1WEN A;  3GV4 A;  2YHN A;  2VP7 A;  2LRI C;  1Z2Q A;  1K2F A;  4P5O B;  5H1T A;  4ZUX U;  3LQJ A;  3T6R A;  2L43 A;  3RPG C;  3C5K A;  4F52 B;  2VPB A;  5LKX A;  2CSZ A;  2VNF A;  4YAB A;  1E4U A;  2KGI A;  3M62 A;  2YW8 A;  3QZV A;  2ECW A;  2K16 A;  5TDW A;  2K4D A;  1WEU A;  1X4U A;  4IC2 A;  2L75 A;  2QIC A;  3ZPV 1;  2YQM A;  4YAD A;  3M99 A;  5C11 A;  2FSA A;  2ECN A;  2VJE A;  5FB1 A;  5I3L A;  1HYJ A;  3VK6 A;  4A0C D;  3U5P A;  2VPE A;  3EB5 A;  4N3W A;  2KRE A;  2CKL A;  2K1J A;  2YRE A;  5H1U A;  2L0B A;  4QF3 A;  3KQI A;  1IYM A;  5KH9 A;  4W4U A;  1XWH A;  4GB0 A;  4I7D A;  2MNZ A;  2KGG A;  2KR4 A;  3FL2 A;  4FIP A;  2VJF B;  2YHO A;  4UP5 A;  2EA6 A;  4IC3 A;  1WFK A;  4MSX A;  2Y1N A;  4I7B A;  4XI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...