4A0CD

Structure of the cand1-cul4b-rbx1 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
b'KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CULLIN-ASSOCIATED NEDD8-DISSOCIATED PROTEIN 1
publication title The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 8
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4a0cD00
2LV9A 3PURA 5TBNA 3U5MA 5B76A 3SOXA 3ZTGA 4TKPB 3M99A 5FB0A 2VPDA 4PPEA 2M1RA 3L1ZB 4UP0A 4A4BA 4W4UA 4LLBA 1LDKC 2XEUA 2G43A 5DINA 3ZVYA 5DKAA 2ECTA 2ECVA 5H9MA 5G05B 2MA5A 2KIZA 1DVPA 2VP7A 3T7LA 1MM3A 1IYMA 4YC9A 2D8SA 2VJEB 3KQIA 2VJEA 1JOCA 2VPEA 4AYCB 4AYCA 2VJFB 3LQIA 2VJFA 2K4DA 2BAYA 1VYXA 4FK5A 2KREA 5B78A 2MIQA 2C2LA 2MNZA 3LRQA 2KYUA 2LQ6A 4P5OB 4PTBA 2QIZA 5KH9A 4A0CD 1Z6UA 1WIMA 2YHOA 2L5UA 2H0DB 1V87A 1Z2QA 2JMIA 1WE9A 4YBMA 4UI9B 4I7CA 2EA6A 2EODA 1CHCA 2VPBA 4AUQB 1U6GB 2G6QA 2FUUA 4B7YC 4BBQA 4Q6FA 4ZDTA 3DPLR 1ZBDB 5AITA 4YATA 2PUYA 4S3OC 4S3OB 5LKXA 1MM2A 2Y1MA 5LKZA 2QICA 2ECIA 2L75A 3RTRB 3N9LA 2XB1A 4WA6A 2YYRA 1WEEA 2ECJA 3HCTA 4MSXA 1RMDA 1X4IA 2LXPC 4I7DA 1HYIA 1WEUA 2JMJA 2VNFA 4YADA 3M63A 2MD7B 4LADB 5D1MB 3ZPVE 1VD4A 5KH3A 3RPGC 4YABA 4R2YA 5J3XA 3RPGB 3O33A 2KGIA 2YU4A 3U5NA 4QF3A 2MUMA 4V3KC 2MT5A 1HYJA 4C9ZA 3HCUA 2LGVA 2M6MA 4A4CA 3LQHA 5TABA 3O7AA 4CA1A 5H1UA 2JRJA 1K2FA 2HYED 2MNYA 4YBSA 3L11A 2ECNA 2F6NA 1F62A 1X4JA 1WESA 1WEVA 3KV5A 5B79A 2YQLA 3EB5A 4XI1A 4NN2A 3L1XA 3HTKC 5LKTA 3ZNIA 4I7BA 3O35A 2VPGA 3SOWA 2HDPA 3N9OA 2CSZA 3VK6A 3V43A 4N3WA 5TDRA 2YHNA 4YAXA 3ASLA 4ZQLA 3O36A 4FJCA 1LDJB 2LGKA 2KWJA 2UZGA 2H0DA 2F42A 4AVXA 2YSJA 3LQJA 1JM7B 5H1TA 3I2DA 4LKAA 1JM7A 2L0BA 5KH7A 5TRBA 2M3HA 4V3LC 5B77A 4ZUXU 4L7XA 3U5OA 4WZ0A 3C5KA 5EYAF 4QF2A 1XWHA 2YSMA 1WEOA 4FO9A 4O64A 3ZYQA 2PNXA 2L80A 4MVTA 4F52B 4GNDA 3DQVR 2JMDA 4R7EA 4WZ3B 3HCSA 3M62A 2Y43A 2YUCA 2FUIA 2KWNA 5D1LB 2KR4A 2Y1NA 4L58A 2RI7A 2KFTA 4GB0A 2K1JA 2MA6A 2MD8C 3N9QA 3QZVA 1Z60A 1WGMA 2NAAA 3EB6A 5TDWA 2LN0A 4WZ2A 5FB1A 5B8DA 3N9MA 3IHPA 4GNGA 2CT2A 2E6SA 2ECWA 1G25A 4YBTA 4BHWA 2CKLB 2CKLA 5D1KB 2CSYA 3MHHA 2ZETC 3PHDA 4N4FA 2YW8A 2LRIC 1T1HA 1WFKA 1E4UA 2KE1A 4IC2A 3SOUA 3T6RA 5AIUA 2E6RA 4GNFA 5G04B 5I3LA 2LDRA 2DX8A 4R8PK 3SHBA 4UP5A 5H1VA 3ZPV1 2YT5A 3ZVZB 2LXHC 2M85A 2QJ0A 1WEQA 2I50A 5C11A 2YURA 2LGGA 4B86C 3N9NA 2OXQC 5FERA 2KWOA 2C2VS 3KV6A 3GL6A 1BORA 3U5PA 3O34A 4FIPA 1WILA 2RSDA 2F6JA 2AN6A 5G0FA 2KWKA 2FSAA 3PUQA 4X3GA 2KGGA 2YQMA 4LJNA 2YREA 2IDAA 4IC3A 1FBVA 4A49A 2KU3A 4LK9A 5JG6A 1N87A 2L43A 5LCWB 2K16A 5B75A 3KNVA 5FEYA 2LGLA 3FL2A 1WEMA 2K17A 3GV4A 3O37A 3MHSA 1X4UA 3NG2A 4GNEA 2G45A 5LKUA 1WEPA 1VFYA 2EGPA 3C6WA 1FP0A 1WEWA 2ECGA 3O70A 3N9PA 4AP4A 4CCGX 1WENA 5C13A
chains in the Genus database with same CATH superfamily
2LV9A 3PURA 5TBNA 3U5MA 5B76A 3SOXA 3ZTGA 4TKPB 3M99A 5FB0A 2VPDA 4PPEA 2M1RA 3L1ZB 4UP0A 4A4BA 4W4UA 4LLBA 1LDKC 2XEUA 2G43A 5DINA 3ZVYA 5DKAA 2KKXA 2ECTA 3FEHA 5SVXA 2ECVA 5H9MA 5G05B 2MA5A 3FJUB 2KIZA 1DVPA 2VP7A 3T7LA 1MM3A 1IYMA 4YC9A 2D8SA 2VJEB 3KQIA 2VJEA 1JOCA 2VPEA 4AYCB 4AYCA 2VJFB 3LQIA 2VJFA 2K4DA 2BAYA 4Z0OA 1VYXA 4FK5A 2KREA 5B78A 2MIQA 2C2LA 2MNZA 3LRQA 2KYUA 2LQ6A 4P5OB 4PTBA 2QIZA 5KH9A 4A0CD 1Z6UA 1WIMA 2YHOA 2L5UA 2H0DB 3MDBC 2E61A 1V87A 1Z2QA 2JMIA 2CSVA 1WE9A 4YBMA 4UI9B 4I7CA 2EA6A 4OGCA 2EODA 1CHCA 2VPBA 4AUQB 1U6GB 2G6QA 2FUUA 4B7YC 4BBQA 4Q6FA 4ZDTA 3DPLR 1ZBDB 5AITA 2XOCA 4YATA 2PUYA 4S3OC 3FAOA 4S3OB 5LKXA 1MM2A 2Y1MA 5LKZA 2QICA 2ECIA 2L75A 3RTRB 3N9LA 2XB1A 4WA6A 2YYRA 1WEEA 2ECJA 2RR4A 3HCTA 3LJUX 4MSXA 3Q1DA 1RMDA 1X4IA 2EGMA 2LXPC 4I7DA 1HYIA 1WEUA 4F1PA 2EXUA 2JMJA 2VNFA 4YADA 3M63A 2MD7B 4LADB 5D1MB 3ZPVE 2CRWA 1VD4A 5KH3A 3RPGC 4YABA 3FM8C 4R2YA 5J3XA 3RPGB 3O33A 4QQ4A 2KGIA 3LDYA 2YU4A 3U5NA 4QF3A 2MUMA 4V3KC 2MT5A 1HYJA 4C9ZA 3HCUA 2LGVA 2P57A 2M6MA 2D8UA 3DWDA 4A4CA 3LQHA 5TABA 3O7AA 4CA1A 5H1UA 2JRJA 1K2FA 2HYED 2MNYA 4YBSA 3L11A 4H9DA 2ECNA 2F6NA 1F62A 1X4JA 1WESA 1WEVA 3KV5A 5B79A 2YQLA 3EB5A 4XI1A 2B0OE 4NN2A 3L1XA 3HTKC 5LKTA 3ZNIA 3DDTA 4I7BA 3O35A 2VPGA 3SOWA 2HDPA 3N9OA 2CSZA 3VK6A 3V43A 2JM3A 4N3WA 5TDRA 2YHNA 4YAXA 3ASLA 4ZQLA 3O36A 3O47A 4FJCA 1LDJB 2LGKA 2KWJA 2UZGA 2DJAA 2H0DA 2F42A 4AVXA 2YSJA 3LQJA 1JM7B 5H1TA 3I2DA 4LKAA 1JM7A 2L0BA 5KH7A 2OWAA 5TRBA 2M3HA 2KKYA 4V3LC 3E2DA 5B77A 4ZUXU 4L7XA 3U5OA 4WZ0A 3C5KA 5EYAF 4QF2A 3KDEC 1XWHA 2YSMA 1WEOA 4FO9A 4O64A 3ZYQA 2PNXA 2L80A 4MVTA 4F52B 4GNDA 5K3QA 3DQVR 2JMDA 4R7EA 4WZ3B 3HCSA 3M62A 2Y43A 3LVRE 2YUCA 2FUIA 2KWNA 5D1LB 2KR4A 2Y1NA 2DSMA 4L58A 2RI7A 2KFTA 4GB0A 2K1JA 2MA6A 2MD8C 3N9QA 3QZVA 1Z60A 1WGMA 2NAAA 3EB6A 5TDWA 2LN0A 4WZ2A 5FB1A 2MKEA 5B8DA 3N9MA 3IHPA 4GNGA 2CT2A 2E6SA 2ECWA 1G25A 4O62A 2XOYA 4YBTA 4BHWA 2CKLB 2CKLA 5D1KB 2CSYA 3MHHA 3SUBA 2ZETC 3H7HA 3PHDA 4N4FA 2YW8A 1MBMA 2LRIC 1T1HA 2M13A 1WFKA 3JUEA 1E4UA 2KE1A 4IC2A 3SOUA 3T6RA 5AIUA 1DCQA 2E6RA 4GNFA 5G04B 5I3LA 2LDRA 5SVYA 2IQJA 2DX8A 4R8PK 3SHBA 4UP5A 5H1VA 3ZPV1 2YT5A 3ZVZB 2LXHC 2M85A 2QJ0A 1WEQA 2I50A 5C11A 2YURA 2LGGA 4B86C 5SVIB 3N9NA 5SVIA 2CRRA 2OXQC 3T9KA 5FERA 2KWOA 2C2VS 3KV6A 3GL6A 1BORA 3U5PA 3O34A 4FIPA 1WILA 2RSDA 2F6JA 2AN6A 5G0FA 2KWKA 2FSAA 2FD4A 3PUQA 4X3GA 2KGGA 2YQMA 4LJNA 2XOZA 2YREA 2IDAA 2L7PA 4IC3A 1FBVA 4A49A 2LAUA 2KU3A 4LK9A 2JUNA 5JG6A 1N87A 2L43A 5LCWB 2K16A 5B75A 3KNVA 5FEYA 2LGLA 2YVRA 4Z0RA 3FL2A 1WEMA 2K17A 3GV4A 3O37A 3MHSA 1X4UA 2CONA 3PLWA 3FANA 3NG2A 4GNEA 2G45A 5LKUA 2XP0A 1WEPA 1VFYA 2EGPA 3C6WA 1FP0A 3LVQE 4OGEA 1WEWA 2ECGA 3O70A 2FFWA 3N9PA 4AP4A 4CCGX 1WENA 5C13A 3M7KA
chains in the Genus database with same CATH topology
2LV9A 3PURA 5TBNA 3U5MA 5B76A 3SOXA 3ZTGA 4TKPB 3M99A 5FB0A 2VPDA 4PPEA 2M1RA 3L1ZB 4UP0A 4A4BA 4W4UA 4LLBA 1LDKC 2XEUA 2G43A 5DINA 3ZVYA 5DKAA 2ECTA 2ECVA 5H9MA 5G05B 2MA5A 2KIZA 1DVPA 2VP7A 3T7LA 1MM3A 1IYMA 4YC9A 2D8SA 2VJEB 3KQIA 2VJEA 1JOCA 2VPEA 4AYCB 4AYCA 2VJFB 3LQIA 2VJFA 2K4DA 2BAYA 1VYXA 4FK5A 2KREA 5B78A 2MIQA 2C2LA 2MNZA 3LRQA 2KYUA 2LQ6A 4P5OB 4PTBA 2QIZA 5KH9A 4A0CD 1Z6UA 1WIMA 2YHOA 2L5UA 2H0DB 1V87A 1Z2QA 2JMIA 1WE9A 4YBMA 4UI9B 4I7CA 2EA6A 2EODA 1CHCA 2VPBA 4AUQB 1U6GB 2G6QA 2FUUA 4B7YC 4BBQA 4Q6FA 4ZDTA 3DPLR 1ZBDB 5AITA 4YATA 2PUYA 4S3OC 4S3OB 5LKXA 1MM2A 2Y1MA 5LKZA 2QICA 2ECIA 2L75A 3RTRB 3N9LA 2XB1A 4WA6A 2YYRA 1WEEA 2ECJA 3HCTA 4MSXA 1RMDA 1X4IA 2LXPC 4I7DA 1HYIA 1WEUA 2JMJA 2VNFA 4YADA 3M63A 2MD7B 4LADB 5D1MB 3ZPVE 1VD4A 5KH3A 3RPGC 4YABA 4R2YA 5J3XA 3RPGB 3O33A 2KGIA 2YU4A 3U5NA 4QF3A 2MUMA 4V3KC 2MT5A 1HYJA 4C9ZA 3HCUA 2LGVA 2M6MA 4A4CA 3LQHA 5TABA 3O7AA 4CA1A 5H1UA 2JRJA 1K2FA 2HYED 2MNYA 4YBSA 3L11A 2ECNA 2F6NA 1F62A 1X4JA 1WESA 1WEVA 3KV5A 5B79A 2YQLA 3EB5A 4XI1A 4NN2A 3L1XA 3HTKC 5LKTA 3ZNIA 4I7BA 3O35A 2VPGA 3SOWA 2HDPA 3N9OA 2CSZA 3VK6A 3V43A 4N3WA 5TDRA 2YHNA 4YAXA 3ASLA 4ZQLA 3O36A 4FJCA 1LDJB 2LGKA 2KWJA 2UZGA 2H0DA 2F42A 4AVXA 2YSJA 3LQJA 1JM7B 5H1TA 3I2DA 4LKAA 1JM7A 2L0BA 5KH7A 5TRBA 2M3HA 4V3LC 5B77A 4ZUXU 4L7XA 3U5OA 4WZ0A 3C5KA 5EYAF 4QF2A 1XWHA 2YSMA 1WEOA 4FO9A 4O64A 3ZYQA 2PNXA 2L80A 4MVTA 4F52B 4GNDA 3DQVR 2JMDA 4R7EA 4WZ3B 3HCSA 3M62A 2Y43A 2YUCA 2FUIA 2KWNA 5D1LB 2KR4A 2Y1NA 4L58A 2RI7A 2KFTA 4GB0A 2K1JA 2MA6A 2MD8C 3N9QA 3QZVA 1Z60A 1WGMA 2NAAA 3EB6A 5TDWA 2LN0A 4WZ2A 5FB1A 5B8DA 3N9MA 3IHPA 4GNGA 2CT2A 2E6SA 2ECWA 1G25A 4YBTA 4BHWA 2CKLB 2CKLA 5D1KB 2CSYA 3MHHA 2ZETC 3PHDA 4N4FA 2YW8A 2LRIC 1T1HA 1WFKA 1E4UA 2KE1A 4IC2A 3SOUA 3T6RA 5AIUA 2E6RA 4GNFA 5G04B 5I3LA 2LDRA 2DX8A 4R8PK 3SHBA 4UP5A 5H1VA 3ZPV1 2YT5A 3ZVZB 2LXHC 2M85A 2QJ0A 1WEQA 2I50A 5C11A 2YURA 2LGGA 4B86C 3N9NA 2OXQC 5FERA 2KWOA 2C2VS 3KV6A 3GL6A 1BORA 3U5PA 3O34A 4FIPA 1WILA 2RSDA 2F6JA 2AN6A 5G0FA 2KWKA 2FSAA 3PUQA 4X3GA 2KGGA 2YQMA 4LJNA 2YREA 2IDAA 4IC3A 1FBVA 4A49A 2KU3A 4LK9A 5JG6A 1N87A 2L43A 5LCWB 2K16A 5B75A 3KNVA 5FEYA 2LGLA 3FL2A 1WEMA 2K17A 3GV4A 3O37A 3MHSA 1X4UA 3NG2A 4GNEA 2G45A 5LKUA 1WEPA 1VFYA 2EGPA 3C6WA 1FP0A 1WEWA 2ECGA 3O70A 3N9PA 4AP4A 4CCGX 1WENA 5C13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV9 A;  3PUR A;  5TBN A;  3U5M A;  5B76 A;  3SOX A;  3ZTG A;  4TKP B;  3M99 A;  5FB0 A;  2VPD A;  4PPE A;  2M1R A;  3L1Z B;  4UP0 A;  4A4B A;  4W4U A;  4LLB A;  1LDK C;  2XEU A;  2G43 A;  5DIN A;  3ZVY A;  5DKA A;  2ECT A;  2ECV A;  5H9M A;  5G05 B;  2MA5 A;  2KIZ A;  1DVP A;  2VP7 A;  3T7L A;  1MM3 A;  1IYM A;  4YC9 A;  2D8S A;  2VJE B;  3KQI A;  2VJE A;  1JOC A;  2VPE A;  4AYC B;  4AYC A;  2VJF B;  3LQI A;  2VJF A;  2K4D A;  2BAY A;  1VYX A;  4FK5 A;  2KRE A;  5B78 A;  2MIQ A;  2C2L A;  2MNZ A;  3LRQ A;  2KYU A;  2LQ6 A;  4P5O B;  4PTB A;  2QIZ A;  5KH9 A;  4A0C D;  1Z6U A;  1WIM A;  2YHO A;  2L5U A;  2H0D B;  1V87 A;  1Z2Q A;  2JMI A;  1WE9 A;  4YBM A;  4UI9 B;  4I7C A;  2EA6 A;  2EOD A;  1CHC A;  2VPB A;  4AUQ B;  1U6G B;  2G6Q A;  2FUU A;  4B7Y C;  4BBQ A;  4Q6F A;  4ZDT A;  3DPL R;  1ZBD B;  5AIT A;  4YAT A;  2PUY A;  4S3O C;  4S3O B;  5LKX A;  1MM2 A;  2Y1M A;  5LKZ A;  2QIC A;  2ECI A;  2L75 A;  3RTR B;  3N9L A;  2XB1 A;  4WA6 A;  2YYR A;  1WEE A;  2ECJ A;  3HCT A;  4MSX A;  1RMD A;  1X4I A;  2LXP C;  4I7D A;  1HYI A;  1WEU A;  2JMJ A;  2VNF A;  4YAD A;  3M63 A;  2MD7 B;  4LAD B;  5D1M B;  3ZPV E;  1VD4 A;  5KH3 A;  3RPG C;  4YAB A;  4R2Y A;  5J3X A;  3RPG B;  3O33 A;  2KGI A;  2YU4 A;  3U5N A;  4QF3 A;  2MUM A;  4V3K C;  2MT5 A;  1HYJ A;  4C9Z A;  3HCU A;  2LGV A;  2M6M A;  4A4C A;  3LQH A;  5TAB A;  3O7A A;  4CA1 A;  5H1U A;  2JRJ A;  1K2F A;  2HYE D;  2MNY A;  4YBS A;  3L11 A;  2ECN A;  2F6N A;  1F62 A;  1X4J A;  1WES A;  1WEV A;  3KV5 A;  5B79 A;  2YQL A;  3EB5 A;  4XI1 A;  4NN2 A;  3L1X A;  3HTK C;  5LKT A;  3ZNI A;  4I7B A;  3O35 A;  2VPG A;  3SOW A;  2HDP A;  3N9O A;  2CSZ A;  3VK6 A;  3V43 A;  4N3W A;  5TDR A;  2YHN A;  4YAX A;  3ASL A;  4ZQL A;  3O36 A;  4FJC A;  1LDJ B;  2LGK A;  2KWJ A;  2UZG A;  2H0D A;  2F42 A;  4AVX A;  2YSJ A;  3LQJ A;  1JM7 B;  5H1T A;  3I2D A;  4LKA A;  1JM7 A;  2L0B A;  5KH7 A;  5TRB A;  2M3H A;  4V3L C;  5B77 A;  4ZUX U;  4L7X A;  3U5O A;  4WZ0 A;  3C5K A;  5EYA F;  4QF2 A;  1XWH A;  2YSM A;  1WEO A;  4FO9 A;  4O64 A;  3ZYQ A;  2PNX A;  2L80 A;  4MVT A;  4F52 B;  4GND A;  3DQV R;  2JMD A;  4R7E A;  4WZ3 B;  3HCS A;  3M62 A;  2Y43 A;  2YUC A;  2FUI A;  2KWN A;  5D1L B;  2KR4 A;  2Y1N A;  4L58 A;  2RI7 A;  2KFT A;  4GB0 A;  2K1J A;  2MA6 A;  2MD8 C;  3N9Q A;  3QZV A;  1Z60 A;  1WGM A;  2NAA A;  3EB6 A;  5TDW A;  2LN0 A;  4WZ2 A;  5FB1 A;  5B8D A;  3N9M A;  3IHP A;  4GNG A;  2CT2 A;  2E6S A;  2ECW A;  1G25 A;  4YBT A;  4BHW A;  2CKL B;  2CKL A;  5D1K B;  2CSY A;  3MHH A;  2ZET C;  3PHD A;  4N4F A;  2YW8 A;  2LRI C;  1T1H A;  1WFK A;  1E4U A;  2KE1 A;  4IC2 A;  3SOU A;  3T6R A;  5AIU A;  2E6R A;  4GNF A;  5G04 B;  5I3L A;  2LDR A;  2DX8 A;  4R8P K;  3SHB A;  4UP5 A;  5H1V A;  3ZPV 1;  2YT5 A;  3ZVZ B;  2LXH C;  2M85 A;  2QJ0 A;  1WEQ A;  2I50 A;  5C11 A;  2YUR A;  2LGG A;  4B86 C;  3N9N A;  2OXQ C;  5FER A;  2KWO A;  2C2V S;  3KV6 A;  3GL6 A;  1BOR A;  3U5P A;  3O34 A;  4FIP A;  1WIL A;  2RSD A;  2F6J A;  2AN6 A;  5G0F A;  2KWK A;  2FSA A;  3PUQ A;  4X3G A;  2KGG A;  2YQM A;  4LJN A;  2YRE A;  2IDA A;  4IC3 A;  1FBV A;  4A49 A;  2KU3 A;  4LK9 A;  5JG6 A;  1N87 A;  2L43 A;  5LCW B;  2K16 A;  5B75 A;  3KNV A;  5FEY A;  2LGL A;  3FL2 A;  1WEM A;  2K17 A;  3GV4 A;  3O37 A;  3MHS A;  1X4U A;  3NG2 A;  4GNE A;  2G45 A;  5LKU A;  1WEP A;  1VFY A;  2EGP A;  3C6W A;  1FP0 A;  1WEW A;  2ECG A;  3O70 A;  3N9P A;  4AP4 A;  4CCG X;  1WEN A;  5C13 A; 
#chains in the Genus database with same CATH topology
 2LV9 A;  3PUR A;  5TBN A;  3U5M A;  5B76 A;  3SOX A;  3ZTG A;  4TKP B;  3M99 A;  5FB0 A;  2VPD A;  4PPE A;  2M1R A;  3L1Z B;  4UP0 A;  4A4B A;  4W4U A;  4LLB A;  1LDK C;  2XEU A;  2G43 A;  5DIN A;  3ZVY A;  5DKA A;  2KKX A;  2ECT A;  3FEH A;  5SVX A;  2ECV A;  5H9M A;  5G05 B;  2MA5 A;  3FJU B;  2KIZ A;  1DVP A;  2VP7 A;  3T7L A;  1MM3 A;  1IYM A;  4YC9 A;  2D8S A;  2VJE B;  3KQI A;  2VJE A;  1JOC A;  2VPE A;  4AYC B;  4AYC A;  2VJF B;  3LQI A;  2VJF A;  2K4D A;  2BAY A;  4Z0O A;  1VYX A;  4FK5 A;  2KRE A;  5B78 A;  2MIQ A;  2C2L A;  2MNZ A;  3LRQ A;  2KYU A;  2LQ6 A;  4P5O B;  4PTB A;  2QIZ A;  5KH9 A;  4A0C D;  1Z6U A;  1WIM A;  2YHO A;  2L5U A;  2H0D B;  3MDB C;  2E61 A;  1V87 A;  1Z2Q A;  2JMI A;  2CSV A;  1WE9 A;  4YBM A;  4UI9 B;  4I7C A;  2EA6 A;  4OGC A;  2EOD A;  1CHC A;  2VPB A;  4AUQ B;  1U6G B;  2G6Q A;  2FUU A;  4B7Y C;  4BBQ A;  4Q6F A;  4ZDT A;  3DPL R;  1ZBD B;  5AIT A;  2XOC A;  4YAT A;  2PUY A;  4S3O C;  3FAO A;  4S3O B;  5LKX A;  1MM2 A;  2Y1M A;  5LKZ A;  2QIC A;  2ECI A;  2L75 A;  3RTR B;  3N9L A;  2XB1 A;  4WA6 A;  2YYR A;  1WEE A;  2ECJ A;  2RR4 A;  3HCT A;  3LJU X;  4MSX A;  3Q1D A;  1RMD A;  1X4I A;  2EGM A;  2LXP C;  4I7D A;  1HYI A;  1WEU A;  4F1P A;  2EXU A;  2JMJ A;  2VNF A;  4YAD A;  3M63 A;  2MD7 B;  4LAD B;  5D1M B;  3ZPV E;  2CRW A;  1VD4 A;  5KH3 A;  3RPG C;  4YAB A;  3FM8 C;  4R2Y A;  5J3X A;  3RPG B;  3O33 A;  4QQ4 A;  2KGI A;  3LDY A;  2YU4 A;  3U5N A;  4QF3 A;  2MUM A;  4V3K C;  2MT5 A;  1HYJ A;  4C9Z A;  3HCU A;  2LGV A;  2P57 A;  2M6M A;  2D8U A;  3DWD A;  4A4C A;  3LQH A;  5TAB A;  3O7A A;  4CA1 A;  5H1U A;  2JRJ A;  1K2F A;  2HYE D;  2MNY A;  4YBS A;  3L11 A;  4H9D A;  2ECN A;  2F6N A;  1F62 A;  1X4J A;  1WES A;  1WEV A;  3KV5 A;  5B79 A;  2YQL A;  3EB5 A;  4XI1 A;  2B0O E;  4NN2 A;  3L1X A;  3HTK C;  5LKT A;  3ZNI A;  3DDT A;  4I7B A;  3O35 A;  2VPG A;  3SOW A;  2HDP A;  3N9O A;  2CSZ A;  3VK6 A;  3V43 A;  2JM3 A;  4N3W A;  5TDR A;  2YHN A;  4YAX A;  3ASL A;  4ZQL A;  3O36 A;  3O47 A;  4FJC A;  1LDJ B;  2LGK A;  2KWJ A;  2UZG A;  2DJA A;  2H0D A;  2F42 A;  4AVX A;  2YSJ A;  3LQJ A;  1JM7 B;  5H1T A;  3I2D A;  4LKA A;  1JM7 A;  2L0B A;  5KH7 A;  2OWA A;  5TRB A;  2M3H A;  2KKY A;  4V3L C;  3E2D A;  5B77 A;  4ZUX U;  4L7X A;  3U5O A;  4WZ0 A;  3C5K A;  5EYA F;  4QF2 A;  3KDE C;  1XWH A;  2YSM A;  1WEO A;  4FO9 A;  4O64 A;  3ZYQ A;  2PNX A;  2L80 A;  4MVT A;  4F52 B;  4GND A;  5K3Q A;  3DQV R;  2JMD A;  4R7E A;  4WZ3 B;  3HCS A;  3M62 A;  2Y43 A;  3LVR E;  2YUC A;  2FUI A;  2KWN A;  5D1L B;  2KR4 A;  2Y1N A;  2DSM A;  4L58 A;  2RI7 A;  2KFT A;  4GB0 A;  2K1J A;  2MA6 A;  2MD8 C;  3N9Q A;  3QZV A;  1Z60 A;  1WGM A;  2NAA A;  3EB6 A;  5TDW A;  2LN0 A;  4WZ2 A;  5FB1 A;  2MKE A;  5B8D A;  3N9M A;  3IHP A;  4GNG A;  2CT2 A;  2E6S A;  2ECW A;  1G25 A;  4O62 A;  2XOY A;  4YBT A;  4BHW A;  2CKL B;  2CKL A;  5D1K B;  2CSY A;  3MHH A;  3SUB A;  2ZET C;  3H7H A;  3PHD A;  4N4F A;  2YW8 A;  1MBM A;  2LRI C;  1T1H A;  2M13 A;  1WFK A;  3JUE A;  1E4U A;  2KE1 A;  4IC2 A;  3SOU A;  3T6R A;  5AIU A;  1DCQ A;  2E6R A;  4GNF A;  5G04 B;  5I3L A;  2LDR A;  5SVY A;  2IQJ A;  2DX8 A;  4R8P K;  3SHB A;  4UP5 A;  5H1V A;  3ZPV 1;  2YT5 A;  3ZVZ B;  2LXH C;  2M85 A;  2QJ0 A;  1WEQ A;  2I50 A;  5C11 A;  2YUR A;  2LGG A;  4B86 C;  5SVI B;  3N9N A;  5SVI A;  2CRR A;  2OXQ C;  3T9K A;  5FER A;  2KWO A;  2C2V S;  3KV6 A;  3GL6 A;  1BOR A;  3U5P A;  3O34 A;  4FIP A;  1WIL A;  2RSD A;  2F6J A;  2AN6 A;  5G0F A;  2KWK A;  2FSA A;  2FD4 A;  3PUQ A;  4X3G A;  2KGG A;  2YQM A;  4LJN A;  2XOZ A;  2YRE A;  2IDA A;  2L7P A;  4IC3 A;  1FBV A;  4A49 A;  2LAU A;  2KU3 A;  4LK9 A;  2JUN A;  5JG6 A;  1N87 A;  2L43 A;  5LCW B;  2K16 A;  5B75 A;  3KNV A;  5FEY A;  2LGL A;  2YVR A;  4Z0R A;  3FL2 A;  1WEM A;  2K17 A;  3GV4 A;  3O37 A;  3MHS A;  1X4U A;  2CON A;  3PLW A;  3FAN A;  3NG2 A;  4GNE A;  2G45 A;  5LKU A;  2XP0 A;  1WEP A;  1VFY A;  2EGP A;  3C6W A;  1FP0 A;  3LVQ E;  4OGE A;  1WEW A;  2ECG A;  3O70 A;  2FFW A;  3N9P A;  4AP4 A;  4CCG X;  1WEN A;  5C13 A;  3M7K A; 
#chains in the Genus database with same CATH homology
 2LV9 A;  3PUR A;  5TBN A;  3U5M A;  5B76 A;  3SOX A;  3ZTG A;  4TKP B;  3M99 A;  5FB0 A;  2VPD A;  4PPE A;  2M1R A;  3L1Z B;  4UP0 A;  4A4B A;  4W4U A;  4LLB A;  1LDK C;  2XEU A;  2G43 A;  5DIN A;  3ZVY A;  5DKA A;  2ECT A;  2ECV A;  5H9M A;  5G05 B;  2MA5 A;  2KIZ A;  1DVP A;  2VP7 A;  3T7L A;  1MM3 A;  1IYM A;  4YC9 A;  2D8S A;  2VJE B;  3KQI A;  2VJE A;  1JOC A;  2VPE A;  4AYC B;  4AYC A;  2VJF B;  3LQI A;  2VJF A;  2K4D A;  2BAY A;  1VYX A;  4FK5 A;  2KRE A;  5B78 A;  2MIQ A;  2C2L A;  2MNZ A;  3LRQ A;  2KYU A;  2LQ6 A;  4P5O B;  4PTB A;  2QIZ A;  5KH9 A;  4A0C D;  1Z6U A;  1WIM A;  2YHO A;  2L5U A;  2H0D B;  1V87 A;  1Z2Q A;  2JMI A;  1WE9 A;  4YBM A;  4UI9 B;  4I7C A;  2EA6 A;  2EOD A;  1CHC A;  2VPB A;  4AUQ B;  1U6G B;  2G6Q A;  2FUU A;  4B7Y C;  4BBQ A;  4Q6F A;  4ZDT A;  3DPL R;  1ZBD B;  5AIT A;  4YAT A;  2PUY A;  4S3O C;  4S3O B;  5LKX A;  1MM2 A;  2Y1M A;  5LKZ A;  2QIC A;  2ECI A;  2L75 A;  3RTR B;  3N9L A;  2XB1 A;  4WA6 A;  2YYR A;  1WEE A;  2ECJ A;  3HCT A;  4MSX A;  1RMD A;  1X4I A;  2LXP C;  4I7D A;  1HYI A;  1WEU A;  2JMJ A;  2VNF A;  4YAD A;  3M63 A;  2MD7 B;  4LAD B;  5D1M B;  3ZPV E;  1VD4 A;  5KH3 A;  3RPG C;  4YAB A;  4R2Y A;  5J3X A;  3RPG B;  3O33 A;  2KGI A;  2YU4 A;  3U5N A;  4QF3 A;  2MUM A;  4V3K C;  2MT5 A;  1HYJ A;  4C9Z A;  3HCU A;  2LGV A;  2M6M A;  4A4C A;  3LQH A;  5TAB A;  3O7A A;  4CA1 A;  5H1U A;  2JRJ A;  1K2F A;  2HYE D;  2MNY A;  4YBS A;  3L11 A;  2ECN A;  2F6N A;  1F62 A;  1X4J A;  1WES A;  1WEV A;  3KV5 A;  5B79 A;  2YQL A;  3EB5 A;  4XI1 A;  4NN2 A;  3L1X A;  3HTK C;  5LKT A;  3ZNI A;  4I7B A;  3O35 A;  2VPG A;  3SOW A;  2HDP A;  3N9O A;  2CSZ A;  3VK6 A;  3V43 A;  4N3W A;  5TDR A;  2YHN A;  4YAX A;  3ASL A;  4ZQL A;  3O36 A;  4FJC A;  1LDJ B;  2LGK A;  2KWJ A;  2UZG A;  2H0D A;  2F42 A;  4AVX A;  2YSJ A;  3LQJ A;  1JM7 B;  5H1T A;  3I2D A;  4LKA A;  1JM7 A;  2L0B A;  5KH7 A;  5TRB A;  2M3H A;  4V3L C;  5B77 A;  4ZUX U;  4L7X A;  3U5O A;  4WZ0 A;  3C5K A;  5EYA F;  4QF2 A;  1XWH A;  2YSM A;  1WEO A;  4FO9 A;  4O64 A;  3ZYQ A;  2PNX A;  2L80 A;  4MVT A;  4F52 B;  4GND A;  3DQV R;  2JMD A;  4R7E A;  4WZ3 B;  3HCS A;  3M62 A;  2Y43 A;  2YUC A;  2FUI A;  2KWN A;  5D1L B;  2KR4 A;  2Y1N A;  4L58 A;  2RI7 A;  2KFT A;  4GB0 A;  2K1J A;  2MA6 A;  2MD8 C;  3N9Q A;  3QZV A;  1Z60 A;  1WGM A;  2NAA A;  3EB6 A;  5TDW A;  2LN0 A;  4WZ2 A;  5FB1 A;  5B8D A;  3N9M A;  3IHP A;  4GNG A;  2CT2 A;  2E6S A;  2ECW A;  1G25 A;  4YBT A;  4BHW A;  2CKL B;  2CKL A;  5D1K B;  2CSY A;  3MHH A;  2ZET C;  3PHD A;  4N4F A;  2YW8 A;  2LRI C;  1T1H A;  1WFK A;  1E4U A;  2KE1 A;  4IC2 A;  3SOU A;  3T6R A;  5AIU A;  2E6R A;  4GNF A;  5G04 B;  5I3L A;  2LDR A;  2DX8 A;  4R8P K;  3SHB A;  4UP5 A;  5H1V A;  3ZPV 1;  2YT5 A;  3ZVZ B;  2LXH C;  2M85 A;  2QJ0 A;  1WEQ A;  2I50 A;  5C11 A;  2YUR A;  2LGG A;  4B86 C;  3N9N A;  2OXQ C;  5FER A;  2KWO A;  2C2V S;  3KV6 A;  3GL6 A;  1BOR A;  3U5P A;  3O34 A;  4FIP A;  1WIL A;  2RSD A;  2F6J A;  2AN6 A;  5G0F A;  2KWK A;  2FSA A;  3PUQ A;  4X3G A;  2KGG A;  2YQM A;  4LJN A;  2YRE A;  2IDA A;  4IC3 A;  1FBV A;  4A49 A;  2KU3 A;  4LK9 A;  5JG6 A;  1N87 A;  2L43 A;  5LCW B;  2K16 A;  5B75 A;  3KNV A;  5FEY A;  2LGL A;  3FL2 A;  1WEM A;  2K17 A;  3GV4 A;  3O37 A;  3MHS A;  1X4U A;  3NG2 A;  4GNE A;  2G45 A;  5LKU A;  1WEP A;  1VFY A;  2EGP A;  3C6W A;  1FP0 A;  1WEW A;  2ECG A;  3O70 A;  3N9P A;  4AP4 A;  4CCG X;  1WEN A;  5C13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...