1F62A

Wstf-phd
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR WSTF
publication title Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 51
sequence length 51
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1f62A00
2XB1A 1IYMA 4YC9A 1DVPA 5B8DA 2Y1NA 2KWNA 2KFTA 2MD7B 1JM7B 5LKZA 4AP4A 1WE9A 3HTKC 2M3HA 4V3LC 4LADB 4A49A 2ECNA 5DKAA 3M63A 2LQ6A 4AYCA 4GNFA 1WFKA 2D8SA 3O33A 4AVXA 2KWKA 3M99A 4QF3A 5J3XA 5G0FA 5I3LA 3O37A 4L7XA 2YQLA 2FSAA 4A4CA 2JMIA 4MSXA 2EODA 2G43A 3RTRB 4A4BA 3KV6A 3U5MA 3DQVR 2ECVA 4R8PK 2OXQC 4ZUXU 2LDRA 4LK9A 2YQMA 4WZ3B 4GB0A 4ZDTA 4ZQLA 2YSJA 4WA6A 5H1TA 5H1UA 5B77A 2HYED 2MA6A 3M62A 2YREA 2KGIA 2I50A 2LGKA 5DINA 2CSYA 3VK6A 2BAYA 4C9ZA 2EGPA 2ECJA 5LKUA 3N9PA 1ZBDB 2H0DB 3C5KA 4V3KC 4X3GA 3KNVA 5KH3A 5LKTA 2KE1A 3KV5A 5AIUA 4GNGA 1Z6UA 3LQIA 1WILA 3U5NA 1K2FA 4YADA 3FL2A 2KR4A 5FERA 3LRQA 4R2YA 2UZGA 1WGMA 2VJFA 2ECIA 5FB1A 4NN2A 1FBVA 1Z2QA 2JMJA 5AITA 3NG2A 2YU4A 4P5OB 1VYXA 2LGGA 4YBTA 4Q6FA 4YABA 4WZ2A 2MNZA 2NAAA 3RPGC 5FB0A 3SOUA 4FK5A 2Y1MA 5TDRA 4FIPA 4I7BA 2L80A 1MM3A 4YBMA 5EYAF 5TBNA 4I7CA 2JRJA 3U5PA 4PPEA 5JG6A 3SOXA 1X4JA 1G25A 2C2VS 3LQJA 2M85A 3O36A 3L11A 2G45A 3QZVA 2CSZA 2MIQA 4S3OC 3ZVZB 2K17A 4S3OB 2MT5A 3GL6A 5C13A 4B86C 3V43A 5G05B 4LKAA 2F6NA 1U6GB 4UI9B 4FJCA 2L0BA 3N9OA 4CCGX 2M6MA 1XWHA 2YYRA 1X4UA 1WEWA 1CHCA 3PURA 4XI1A 4N3WA 1X4IA 2E6SA 2FUIA 5KH7A 4YBSA 1HYIA 2LN0A 4UP0A 2KWJA 4B7YC 3IHPA 2KGGA 1T1HA 3O7AA 4UP5A 2VJEA 1RMDA 4LJNA 4AYCB 1JM7A 2F6JA 2MNYA 5KH9A 3O70A 4F52B 2M1RA 2MUMA 2YHOA 4FO9A 3N9QA 4BHWA 3DPLR 3EB6A 3HCUA 5D1LB 2PNXA 4TKPB 2YHNA 2JMDA 3ASLA 2HDPA 4CA1A 2LXHC 1BORA 2ECWA 3LQHA 3RPGB 2LXPC 1E4UA 1VD4A 2ECGA 2ZETC 2L43A 4BBQA 2EA6A 2Y43A 2RSDA 2FUUA 3PHDA 3O35A 5B76A 2YSMA 4L58A 5TDWA 4I7DA 2CKLA 2LGLA 2QJ0A 2LRIC 3ZNIA 2KWOA 3MHSA 2YT5A 4GNDA 2VPGA 2K16A 2YUCA 5G04B 4R7EA 5H1VA 5LCWB 4LLBA 2VJEB 2H0DA 1FP0A 3GV4A 3MHHA 3N9NA 1WENA 5TRBA 1WEPA 3HCTA 1LDKC 4W4UA 2C2LA 1V87A 5B78A 2VJFB 2KREA 2IDAA 3ZPVE 2CT2A 3T7LA 2LGVA 1HYJA 2K1JA 2VP7A 3C6WA 3SHBA 1WEEA 2VPBA 2XEUA 3ZYQA 2VPEA 2QIZA 4PTBA 5D1MB 2QICA 1F62A 3N9LA 2LV9A 5LKXA 4YATA 3L1ZB 5FEYA 1WEQA 4MVTA 2MA5A 2PUYA 1WEVA 2E6RA 2CKLB 5B79A 5C11A 4QF2A 4N4FA 4A0CD 4O64A 3T6RA 3I2DA 3ZTGA 3ZPV1 5TABA 1MM2A 5D1KB 1WIMA 1VFYA 2KYUA 4IC2A 2DX8A 2VPDA 1WESA 3SOWA 2AN6A 1LDJB 2MD8C 2L75A 3EB5A 5B75A 4IC3A 2KIZA 2K4DA 2ECTA 3ZVYA 3L1XA 4WZ0A 1WEMA 3KQIA 4YAXA 2F42A 5H9MA 2G6QA 3HCSA 2YURA 1WEUA 3N9MA 3PUQA 1WEOA 2RI7A 1JOCA 4GNEA 3U5OA 1N87A 2KU3A 2YW8A 2L5UA 1Z60A 4AUQB 3O34A 2VNFA
chains in the Genus database with same CATH superfamily
4QQ4A 2XB1A 1IYMA 4YC9A 2JM3A 1DVPA 5B8DA 2Y1NA 2KWNA 2KFTA 2FFWA 2EXUA 2MD7B 1JM7B 5LKZA 4AP4A 1WE9A 3HTKC 3FJUB 2M3HA 4V3LC 4LADB 4A49A 2ECNA 5DKAA 3M63A 2LQ6A 4H9DA 5SVIA 4AYCA 4GNFA 1WFKA 2D8SA 1DCQA 3O33A 4AVXA 2KWKA 3M99A 4QF3A 5J3XA 2XOYA 5G0FA 5I3LA 3O37A 4L7XA 2YQLA 2FSAA 4A4CA 5K3QA 2JMIA 4MSXA 2EODA 2G43A 3RTRB 4A4BA 3KV6A 5SVXA 3U5MA 3DQVR 3E2DA 2KKXA 3SUBA 2ECVA 4R8PK 2OXQC 4ZUXU 2LDRA 4LK9A 3KDEC 2YQMA 2YVRA 4WZ3B 4GB0A 4ZDTA 4ZQLA 5SVYA 4Z0OA 2YSJA 4WA6A 5H1TA 5H1UA 5B77A 2HYED 2MA6A 3M62A 2YREA 2KGIA 2I50A 2LGKA 5DINA 2CSYA 3VK6A 2BAYA 4C9ZA 2EGPA 2ECJA 3FANA 3T9KA 5LKUA 3N9PA 4OGEA 1ZBDB 2H0DB 3C5KA 3DDTA 4V3KC 4X3GA 3KNVA 5KH3A 5LKTA 2KE1A 3KV5A 5AIUA 4GNGA 2OWAA 5SVIB 1Z6UA 3LQIA 1WILA 3U5NA 1K2FA 4YADA 3FL2A 2KR4A 5FERA 3LRQA 4R2YA 2UZGA 1WGMA 2VJFA 2ECIA 5FB1A 4NN2A 1FBVA 1Z2QA 2JMJA 5AITA 3NG2A 2YU4A 4P5OB 1VYXA 2LGGA 4YBTA 4Q6FA 4YABA 4WZ2A 2MNZA 2NAAA 3RPGC 5FB0A 3SOUA 4FK5A 3Q1DA 2E61A 3LVRE 2XOCA 2Y1MA 2CSVA 5TDRA 2P57A 4FIPA 2LAUA 4I7BA 2L80A 1MM3A 4YBMA 5EYAF 5TBNA 4I7CA 2JRJA 3U5PA 2CRRA 4PPEA 5JG6A 3SOXA 1X4JA 1G25A 2C2VS 3LQJA 2M85A 3O36A 3L11A 2G45A 3QZVA 2CSZA 2MIQA 4S3OC 3ZVZB 2K17A 4S3OB 2MT5A 2DJAA 3GL6A 5C13A 4B86C 3V43A 5G05B 4LKAA 2F6NA 1U6GB 4UI9B 4FJCA 2L0BA 3N9OA 4CCGX 2RR4A 2M6MA 1XWHA 2YYRA 1X4UA 1WEWA 1CHCA 3PURA 4XI1A 4N3WA 1X4IA 3FM8C 2E6SA 2FUIA 3MDBC 5KH7A 4YBSA 1HYIA 2LN0A 3O47A 4UP0A 2KWJA 4B7YC 3LVQE 3IHPA 2KGGA 1T1HA 3O7AA 4UP5A 2MKEA 2VJEA 1RMDA 4LJNA 4AYCB 1JM7A 2F6JA 2MNYA 5KH9A 3O70A 4F52B 2M1RA 2MUMA 2YHOA 4FO9A 3N9QA 4BHWA 3DPLR 3EB6A 3HCUA 5D1LB 2PNXA 4TKPB 2YHNA 2JMDA 3ASLA 3JUEA 3H7HA 2HDPA 4CA1A 2LXHC 1BORA 2ECWA 3LQHA 3RPGB 2LXPC 1E4UA 1VD4A 3FEHA 2ECGA 2ZETC 2L43A 2CONA 4BBQA 2EA6A 2Y43A 2RSDA 2FUUA 3PHDA 3O35A 5B76A 2YSMA 4L58A 5TDWA 4I7DA 2CKLA 2LGLA 2DSMA 2QJ0A 2LRIC 3ZNIA 2KWOA 3MHSA 2YT5A 4GNDA 2VPGA 2K16A 2YUCA 5G04B 4R7EA 5H1VA 5LCWB 3LJUX 4LLBA 2CRWA 2VJEB 2H0DA 1FP0A 3GV4A 2M13A 3MHHA 3FAOA 3N9NA 1WENA 2IQJA 5TRBA 2JUNA 1WEPA 3HCTA 1LDKC 4W4UA 2C2LA 1V87A 5B78A 2VJFB 2KREA 2IDAA 3ZPVE 2CT2A 3T7LA 2LGVA 2XOZA 1HYJA 2K1JA 2VP7A 3C6WA 3SHBA 1WEEA 2FD4A 2VPBA 3M7KA 2XEUA 3ZYQA 2VPEA 2L7PA 2QIZA 4PTBA 5D1MB 2QICA 1F62A 3N9LA 2LV9A 5LKXA 4YATA 3L1ZB 5FEYA 1WEQA 4OGCA 4MVTA 2MA5A 2PUYA 1WEVA 2E6RA 2CKLB 5B79A 5C11A 4QF2A 4N4FA 2EGMA 4A0CD 4O64A 3T6RA 3I2DA 3ZTGA 3ZPV1 5TABA 1MM2A 5D1KB 1WIMA 1VFYA 2KYUA 4IC2A 2DX8A 2VPDA 1WESA 3PLWA 3SOWA 4F1PA 2AN6A 1LDJB 2MD8C 2L75A 3EB5A 3DWDA 5B75A 4IC3A 2KIZA 2K4DA 2ECTA 2KKYA 3ZVYA 3L1XA 1MBMA 4Z0RA 4WZ0A 1WEMA 3KQIA 4YAXA 2F42A 2D8UA 5H9MA 2G6QA 3HCSA 2YURA 1WEUA 3N9MA 2XP0A 3PUQA 1WEOA 2RI7A 1JOCA 4GNEA 3U5OA 1N87A 2KU3A 2YW8A 3LDYA 2L5UA 4O62A 1Z60A 4AUQB 3O34A 2B0OE 2VNFA
chains in the Genus database with same CATH topology
2XB1A 1IYMA 4YC9A 1DVPA 5B8DA 2Y1NA 2KWNA 2KFTA 2MD7B 1JM7B 5LKZA 4AP4A 1WE9A 3HTKC 2M3HA 4V3LC 4LADB 4A49A 2ECNA 5DKAA 3M63A 2LQ6A 4AYCA 4GNFA 1WFKA 2D8SA 3O33A 4AVXA 2KWKA 3M99A 4QF3A 5J3XA 5G0FA 5I3LA 3O37A 4L7XA 2YQLA 2FSAA 4A4CA 2JMIA 4MSXA 2EODA 2G43A 3RTRB 4A4BA 3KV6A 3U5MA 3DQVR 2ECVA 4R8PK 2OXQC 4ZUXU 2LDRA 4LK9A 2YQMA 4WZ3B 4GB0A 4ZDTA 4ZQLA 2YSJA 4WA6A 5H1TA 5H1UA 5B77A 2HYED 2MA6A 3M62A 2YREA 2KGIA 2I50A 2LGKA 5DINA 2CSYA 3VK6A 2BAYA 4C9ZA 2EGPA 2ECJA 5LKUA 3N9PA 1ZBDB 2H0DB 3C5KA 4V3KC 4X3GA 3KNVA 5KH3A 5LKTA 2KE1A 3KV5A 5AIUA 4GNGA 1Z6UA 3LQIA 1WILA 3U5NA 1K2FA 4YADA 3FL2A 2KR4A 5FERA 3LRQA 4R2YA 2UZGA 1WGMA 2VJFA 2ECIA 5FB1A 4NN2A 1FBVA 1Z2QA 2JMJA 5AITA 3NG2A 2YU4A 4P5OB 1VYXA 2LGGA 4YBTA 4Q6FA 4YABA 4WZ2A 2MNZA 2NAAA 3RPGC 5FB0A 3SOUA 4FK5A 2Y1MA 5TDRA 4FIPA 4I7BA 2L80A 1MM3A 4YBMA 5EYAF 5TBNA 4I7CA 2JRJA 3U5PA 4PPEA 5JG6A 3SOXA 1X4JA 1G25A 2C2VS 3LQJA 2M85A 3O36A 3L11A 2G45A 3QZVA 2CSZA 2MIQA 4S3OC 3ZVZB 2K17A 4S3OB 2MT5A 3GL6A 5C13A 4B86C 3V43A 5G05B 4LKAA 2F6NA 1U6GB 4UI9B 4FJCA 2L0BA 3N9OA 4CCGX 2M6MA 1XWHA 2YYRA 1X4UA 1WEWA 1CHCA 3PURA 4XI1A 4N3WA 1X4IA 2E6SA 2FUIA 5KH7A 4YBSA 1HYIA 2LN0A 4UP0A 2KWJA 4B7YC 3IHPA 2KGGA 1T1HA 3O7AA 4UP5A 2VJEA 1RMDA 4LJNA 4AYCB 1JM7A 2F6JA 2MNYA 5KH9A 3O70A 4F52B 2M1RA 2MUMA 2YHOA 4FO9A 3N9QA 4BHWA 3DPLR 3EB6A 3HCUA 5D1LB 2PNXA 4TKPB 2YHNA 2JMDA 3ASLA 2HDPA 4CA1A 2LXHC 1BORA 2ECWA 3LQHA 3RPGB 2LXPC 1E4UA 1VD4A 2ECGA 2ZETC 2L43A 4BBQA 2EA6A 2Y43A 2RSDA 2FUUA 3PHDA 3O35A 5B76A 2YSMA 4L58A 5TDWA 4I7DA 2CKLA 2LGLA 2QJ0A 2LRIC 3ZNIA 2KWOA 3MHSA 2YT5A 4GNDA 2VPGA 2K16A 2YUCA 5G04B 4R7EA 5H1VA 5LCWB 4LLBA 2VJEB 2H0DA 1FP0A 3GV4A 3MHHA 3N9NA 1WENA 5TRBA 1WEPA 3HCTA 1LDKC 4W4UA 2C2LA 1V87A 5B78A 2VJFB 2KREA 2IDAA 3ZPVE 2CT2A 3T7LA 2LGVA 1HYJA 2K1JA 2VP7A 3C6WA 3SHBA 1WEEA 2VPBA 2XEUA 3ZYQA 2VPEA 2QIZA 4PTBA 5D1MB 2QICA 1F62A 3N9LA 2LV9A 5LKXA 4YATA 3L1ZB 5FEYA 1WEQA 4MVTA 2MA5A 2PUYA 1WEVA 2E6RA 2CKLB 5B79A 5C11A 4QF2A 4N4FA 4A0CD 4O64A 3T6RA 3I2DA 3ZTGA 3ZPV1 5TABA 1MM2A 5D1KB 1WIMA 1VFYA 2KYUA 4IC2A 2DX8A 2VPDA 1WESA 3SOWA 2AN6A 1LDJB 2MD8C 2L75A 3EB5A 5B75A 4IC3A 2KIZA 2K4DA 2ECTA 3ZVYA 3L1XA 4WZ0A 1WEMA 3KQIA 4YAXA 2F42A 5H9MA 2G6QA 3HCSA 2YURA 1WEUA 3N9MA 3PUQA 1WEOA 2RI7A 1JOCA 4GNEA 3U5OA 1N87A 2KU3A 2YW8A 2L5UA 1Z60A 4AUQB 3O34A 2VNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB1 A;  1IYM A;  4YC9 A;  1DVP A;  5B8D A;  2Y1N A;  2KWN A;  2KFT A;  2MD7 B;  1JM7 B;  5LKZ A;  4AP4 A;  1WE9 A;  3HTK C;  2M3H A;  4V3L C;  4LAD B;  4A49 A;  2ECN A;  5DKA A;  3M63 A;  2LQ6 A;  4AYC A;  4GNF A;  1WFK A;  2D8S A;  3O33 A;  4AVX A;  2KWK A;  3M99 A;  4QF3 A;  5J3X A;  5G0F A;  5I3L A;  3O37 A;  4L7X A;  2YQL A;  2FSA A;  4A4C A;  2JMI A;  4MSX A;  2EOD A;  2G43 A;  3RTR B;  4A4B A;  3KV6 A;  3U5M A;  3DQV R;  2ECV A;  4R8P K;  2OXQ C;  4ZUX U;  2LDR A;  4LK9 A;  2YQM A;  4WZ3 B;  4GB0 A;  4ZDT A;  4ZQL A;  2YSJ A;  4WA6 A;  5H1T A;  5H1U A;  5B77 A;  2HYE D;  2MA6 A;  3M62 A;  2YRE A;  2KGI A;  2I50 A;  2LGK A;  5DIN A;  2CSY A;  3VK6 A;  2BAY A;  4C9Z A;  2EGP A;  2ECJ A;  5LKU A;  3N9P A;  1ZBD B;  2H0D B;  3C5K A;  4V3K C;  4X3G A;  3KNV A;  5KH3 A;  5LKT A;  2KE1 A;  3KV5 A;  5AIU A;  4GNG A;  1Z6U A;  3LQI A;  1WIL A;  3U5N A;  1K2F A;  4YAD A;  3FL2 A;  2KR4 A;  5FER A;  3LRQ A;  4R2Y A;  2UZG A;  1WGM A;  2VJF A;  2ECI A;  5FB1 A;  4NN2 A;  1FBV A;  1Z2Q A;  2JMJ A;  5AIT A;  3NG2 A;  2YU4 A;  4P5O B;  1VYX A;  2LGG A;  4YBT A;  4Q6F A;  4YAB A;  4WZ2 A;  2MNZ A;  2NAA A;  3RPG C;  5FB0 A;  3SOU A;  4FK5 A;  2Y1M A;  5TDR A;  4FIP A;  4I7B A;  2L80 A;  1MM3 A;  4YBM A;  5EYA F;  5TBN A;  4I7C A;  2JRJ A;  3U5P A;  4PPE A;  5JG6 A;  3SOX A;  1X4J A;  1G25 A;  2C2V S;  3LQJ A;  2M85 A;  3O36 A;  3L11 A;  2G45 A;  3QZV A;  2CSZ A;  2MIQ A;  4S3O C;  3ZVZ B;  2K17 A;  4S3O B;  2MT5 A;  3GL6 A;  5C13 A;  4B86 C;  3V43 A;  5G05 B;  4LKA A;  2F6N A;  1U6G B;  4UI9 B;  4FJC A;  2L0B A;  3N9O A;  4CCG X;  2M6M A;  1XWH A;  2YYR A;  1X4U A;  1WEW A;  1CHC A;  3PUR A;  4XI1 A;  4N3W A;  1X4I A;  2E6S A;  2FUI A;  5KH7 A;  4YBS A;  1HYI A;  2LN0 A;  4UP0 A;  2KWJ A;  4B7Y C;  3IHP A;  2KGG A;  1T1H A;  3O7A A;  4UP5 A;  2VJE A;  1RMD A;  4LJN A;  4AYC B;  1JM7 A;  2F6J A;  2MNY A;  5KH9 A;  3O70 A;  4F52 B;  2M1R A;  2MUM A;  2YHO A;  4FO9 A;  3N9Q A;  4BHW A;  3DPL R;  3EB6 A;  3HCU A;  5D1L B;  2PNX A;  4TKP B;  2YHN A;  2JMD A;  3ASL A;  2HDP A;  4CA1 A;  2LXH C;  1BOR A;  2ECW A;  3LQH A;  3RPG B;  2LXP C;  1E4U A;  1VD4 A;  2ECG A;  2ZET C;  2L43 A;  4BBQ A;  2EA6 A;  2Y43 A;  2RSD A;  2FUU A;  3PHD A;  3O35 A;  5B76 A;  2YSM A;  4L58 A;  5TDW A;  4I7D A;  2CKL A;  2LGL A;  2QJ0 A;  2LRI C;  3ZNI A;  2KWO A;  3MHS A;  2YT5 A;  4GND A;  2VPG A;  2K16 A;  2YUC A;  5G04 B;  4R7E A;  5H1V A;  5LCW B;  4LLB A;  2VJE B;  2H0D A;  1FP0 A;  3GV4 A;  3MHH A;  3N9N A;  1WEN A;  5TRB A;  1WEP A;  3HCT A;  1LDK C;  4W4U A;  2C2L A;  1V87 A;  5B78 A;  2VJF B;  2KRE A;  2IDA A;  3ZPV E;  2CT2 A;  3T7L A;  2LGV A;  1HYJ A;  2K1J A;  2VP7 A;  3C6W A;  3SHB A;  1WEE A;  2VPB A;  2XEU A;  3ZYQ A;  2VPE A;  2QIZ A;  4PTB A;  5D1M B;  2QIC A;  1F62 A;  3N9L A;  2LV9 A;  5LKX A;  4YAT A;  3L1Z B;  5FEY A;  1WEQ A;  4MVT A;  2MA5 A;  2PUY A;  1WEV A;  2E6R A;  2CKL B;  5B79 A;  5C11 A;  4QF2 A;  4N4F A;  4A0C D;  4O64 A;  3T6R A;  3I2D A;  3ZTG A;  3ZPV 1;  5TAB A;  1MM2 A;  5D1K B;  1WIM A;  1VFY A;  2KYU A;  4IC2 A;  2DX8 A;  2VPD A;  1WES A;  3SOW A;  2AN6 A;  1LDJ B;  2MD8 C;  2L75 A;  3EB5 A;  5B75 A;  4IC3 A;  2KIZ A;  2K4D A;  2ECT A;  3ZVY A;  3L1X A;  4WZ0 A;  1WEM A;  3KQI A;  4YAX A;  2F42 A;  5H9M A;  2G6Q A;  3HCS A;  2YUR A;  1WEU A;  3N9M A;  3PUQ A;  1WEO A;  2RI7 A;  1JOC A;  4GNE A;  3U5O A;  1N87 A;  2KU3 A;  2YW8 A;  2L5U A;  1Z60 A;  4AUQ B;  3O34 A;  2VNF A; 
#chains in the Genus database with same CATH topology
 4QQ4 A;  2XB1 A;  1IYM A;  4YC9 A;  2JM3 A;  1DVP A;  5B8D A;  2Y1N A;  2KWN A;  2KFT A;  2FFW A;  2EXU A;  2MD7 B;  1JM7 B;  5LKZ A;  4AP4 A;  1WE9 A;  3HTK C;  3FJU B;  2M3H A;  4V3L C;  4LAD B;  4A49 A;  2ECN A;  5DKA A;  3M63 A;  2LQ6 A;  4H9D A;  5SVI A;  4AYC A;  4GNF A;  1WFK A;  2D8S A;  1DCQ A;  3O33 A;  4AVX A;  2KWK A;  3M99 A;  4QF3 A;  5J3X A;  2XOY A;  5G0F A;  5I3L A;  3O37 A;  4L7X A;  2YQL A;  2FSA A;  4A4C A;  5K3Q A;  2JMI A;  4MSX A;  2EOD A;  2G43 A;  3RTR B;  4A4B A;  3KV6 A;  5SVX A;  3U5M A;  3DQV R;  3E2D A;  2KKX A;  3SUB A;  2ECV A;  4R8P K;  2OXQ C;  4ZUX U;  2LDR A;  4LK9 A;  3KDE C;  2YQM A;  2YVR A;  4WZ3 B;  4GB0 A;  4ZDT A;  4ZQL A;  5SVY A;  4Z0O A;  2YSJ A;  4WA6 A;  5H1T A;  5H1U A;  5B77 A;  2HYE D;  2MA6 A;  3M62 A;  2YRE A;  2KGI A;  2I50 A;  2LGK A;  5DIN A;  2CSY A;  3VK6 A;  2BAY A;  4C9Z A;  2EGP A;  2ECJ A;  3FAN A;  3T9K A;  5LKU A;  3N9P A;  4OGE A;  1ZBD B;  2H0D B;  3C5K A;  3DDT A;  4V3K C;  4X3G A;  3KNV A;  5KH3 A;  5LKT A;  2KE1 A;  3KV5 A;  5AIU A;  4GNG A;  2OWA A;  5SVI B;  1Z6U A;  3LQI A;  1WIL A;  3U5N A;  1K2F A;  4YAD A;  3FL2 A;  2KR4 A;  5FER A;  3LRQ A;  4R2Y A;  2UZG A;  1WGM A;  2VJF A;  2ECI A;  5FB1 A;  4NN2 A;  1FBV A;  1Z2Q A;  2JMJ A;  5AIT A;  3NG2 A;  2YU4 A;  4P5O B;  1VYX A;  2LGG A;  4YBT A;  4Q6F A;  4YAB A;  4WZ2 A;  2MNZ A;  2NAA A;  3RPG C;  5FB0 A;  3SOU A;  4FK5 A;  3Q1D A;  2E61 A;  3LVR E;  2XOC A;  2Y1M A;  2CSV A;  5TDR A;  2P57 A;  4FIP A;  2LAU A;  4I7B A;  2L80 A;  1MM3 A;  4YBM A;  5EYA F;  5TBN A;  4I7C A;  2JRJ A;  3U5P A;  2CRR A;  4PPE A;  5JG6 A;  3SOX A;  1X4J A;  1G25 A;  2C2V S;  3LQJ A;  2M85 A;  3O36 A;  3L11 A;  2G45 A;  3QZV A;  2CSZ A;  2MIQ A;  4S3O C;  3ZVZ B;  2K17 A;  4S3O B;  2MT5 A;  2DJA A;  3GL6 A;  5C13 A;  4B86 C;  3V43 A;  5G05 B;  4LKA A;  2F6N A;  1U6G B;  4UI9 B;  4FJC A;  2L0B A;  3N9O A;  4CCG X;  2RR4 A;  2M6M A;  1XWH A;  2YYR A;  1X4U A;  1WEW A;  1CHC A;  3PUR A;  4XI1 A;  4N3W A;  1X4I A;  3FM8 C;  2E6S A;  2FUI A;  3MDB C;  5KH7 A;  4YBS A;  1HYI A;  2LN0 A;  3O47 A;  4UP0 A;  2KWJ A;  4B7Y C;  3LVQ E;  3IHP A;  2KGG A;  1T1H A;  3O7A A;  4UP5 A;  2MKE A;  2VJE A;  1RMD A;  4LJN A;  4AYC B;  1JM7 A;  2F6J A;  2MNY A;  5KH9 A;  3O70 A;  4F52 B;  2M1R A;  2MUM A;  2YHO A;  4FO9 A;  3N9Q A;  4BHW A;  3DPL R;  3EB6 A;  3HCU A;  5D1L B;  2PNX A;  4TKP B;  2YHN A;  2JMD A;  3ASL A;  3JUE A;  3H7H A;  2HDP A;  4CA1 A;  2LXH C;  1BOR A;  2ECW A;  3LQH A;  3RPG B;  2LXP C;  1E4U A;  1VD4 A;  3FEH A;  2ECG A;  2ZET C;  2L43 A;  2CON A;  4BBQ A;  2EA6 A;  2Y43 A;  2RSD A;  2FUU A;  3PHD A;  3O35 A;  5B76 A;  2YSM A;  4L58 A;  5TDW A;  4I7D A;  2CKL A;  2LGL A;  2DSM A;  2QJ0 A;  2LRI C;  3ZNI A;  2KWO A;  3MHS A;  2YT5 A;  4GND A;  2VPG A;  2K16 A;  2YUC A;  5G04 B;  4R7E A;  5H1V A;  5LCW B;  3LJU X;  4LLB A;  2CRW A;  2VJE B;  2H0D A;  1FP0 A;  3GV4 A;  2M13 A;  3MHH A;  3FAO A;  3N9N A;  1WEN A;  2IQJ A;  5TRB A;  2JUN A;  1WEP A;  3HCT A;  1LDK C;  4W4U A;  2C2L A;  1V87 A;  5B78 A;  2VJF B;  2KRE A;  2IDA A;  3ZPV E;  2CT2 A;  3T7L A;  2LGV A;  2XOZ A;  1HYJ A;  2K1J A;  2VP7 A;  3C6W A;  3SHB A;  1WEE A;  2FD4 A;  2VPB A;  3M7K A;  2XEU A;  3ZYQ A;  2VPE A;  2L7P A;  2QIZ A;  4PTB A;  5D1M B;  2QIC A;  1F62 A;  3N9L A;  2LV9 A;  5LKX A;  4YAT A;  3L1Z B;  5FEY A;  1WEQ A;  4OGC A;  4MVT A;  2MA5 A;  2PUY A;  1WEV A;  2E6R A;  2CKL B;  5B79 A;  5C11 A;  4QF2 A;  4N4F A;  2EGM A;  4A0C D;  4O64 A;  3T6R A;  3I2D A;  3ZTG A;  3ZPV 1;  5TAB A;  1MM2 A;  5D1K B;  1WIM A;  1VFY A;  2KYU A;  4IC2 A;  2DX8 A;  2VPD A;  1WES A;  3PLW A;  3SOW A;  4F1P A;  2AN6 A;  1LDJ B;  2MD8 C;  2L75 A;  3EB5 A;  3DWD A;  5B75 A;  4IC3 A;  2KIZ A;  2K4D A;  2ECT A;  2KKY A;  3ZVY A;  3L1X A;  1MBM A;  4Z0R A;  4WZ0 A;  1WEM A;  3KQI A;  4YAX A;  2F42 A;  2D8U A;  5H9M A;  2G6Q A;  3HCS A;  2YUR A;  1WEU A;  3N9M A;  2XP0 A;  3PUQ A;  1WEO A;  2RI7 A;  1JOC A;  4GNE A;  3U5O A;  1N87 A;  2KU3 A;  2YW8 A;  3LDY A;  2L5U A;  4O62 A;  1Z60 A;  4AUQ B;  3O34 A;  2B0O E;  2VNF A; 
#chains in the Genus database with same CATH homology
 2XB1 A;  1IYM A;  4YC9 A;  1DVP A;  5B8D A;  2Y1N A;  2KWN A;  2KFT A;  2MD7 B;  1JM7 B;  5LKZ A;  4AP4 A;  1WE9 A;  3HTK C;  2M3H A;  4V3L C;  4LAD B;  4A49 A;  2ECN A;  5DKA A;  3M63 A;  2LQ6 A;  4AYC A;  4GNF A;  1WFK A;  2D8S A;  3O33 A;  4AVX A;  2KWK A;  3M99 A;  4QF3 A;  5J3X A;  5G0F A;  5I3L A;  3O37 A;  4L7X A;  2YQL A;  2FSA A;  4A4C A;  2JMI A;  4MSX A;  2EOD A;  2G43 A;  3RTR B;  4A4B A;  3KV6 A;  3U5M A;  3DQV R;  2ECV A;  4R8P K;  2OXQ C;  4ZUX U;  2LDR A;  4LK9 A;  2YQM A;  4WZ3 B;  4GB0 A;  4ZDT A;  4ZQL A;  2YSJ A;  4WA6 A;  5H1T A;  5H1U A;  5B77 A;  2HYE D;  2MA6 A;  3M62 A;  2YRE A;  2KGI A;  2I50 A;  2LGK A;  5DIN A;  2CSY A;  3VK6 A;  2BAY A;  4C9Z A;  2EGP A;  2ECJ A;  5LKU A;  3N9P A;  1ZBD B;  2H0D B;  3C5K A;  4V3K C;  4X3G A;  3KNV A;  5KH3 A;  5LKT A;  2KE1 A;  3KV5 A;  5AIU A;  4GNG A;  1Z6U A;  3LQI A;  1WIL A;  3U5N A;  1K2F A;  4YAD A;  3FL2 A;  2KR4 A;  5FER A;  3LRQ A;  4R2Y A;  2UZG A;  1WGM A;  2VJF A;  2ECI A;  5FB1 A;  4NN2 A;  1FBV A;  1Z2Q A;  2JMJ A;  5AIT A;  3NG2 A;  2YU4 A;  4P5O B;  1VYX A;  2LGG A;  4YBT A;  4Q6F A;  4YAB A;  4WZ2 A;  2MNZ A;  2NAA A;  3RPG C;  5FB0 A;  3SOU A;  4FK5 A;  2Y1M A;  5TDR A;  4FIP A;  4I7B A;  2L80 A;  1MM3 A;  4YBM A;  5EYA F;  5TBN A;  4I7C A;  2JRJ A;  3U5P A;  4PPE A;  5JG6 A;  3SOX A;  1X4J A;  1G25 A;  2C2V S;  3LQJ A;  2M85 A;  3O36 A;  3L11 A;  2G45 A;  3QZV A;  2CSZ A;  2MIQ A;  4S3O C;  3ZVZ B;  2K17 A;  4S3O B;  2MT5 A;  3GL6 A;  5C13 A;  4B86 C;  3V43 A;  5G05 B;  4LKA A;  2F6N A;  1U6G B;  4UI9 B;  4FJC A;  2L0B A;  3N9O A;  4CCG X;  2M6M A;  1XWH A;  2YYR A;  1X4U A;  1WEW A;  1CHC A;  3PUR A;  4XI1 A;  4N3W A;  1X4I A;  2E6S A;  2FUI A;  5KH7 A;  4YBS A;  1HYI A;  2LN0 A;  4UP0 A;  2KWJ A;  4B7Y C;  3IHP A;  2KGG A;  1T1H A;  3O7A A;  4UP5 A;  2VJE A;  1RMD A;  4LJN A;  4AYC B;  1JM7 A;  2F6J A;  2MNY A;  5KH9 A;  3O70 A;  4F52 B;  2M1R A;  2MUM A;  2YHO A;  4FO9 A;  3N9Q A;  4BHW A;  3DPL R;  3EB6 A;  3HCU A;  5D1L B;  2PNX A;  4TKP B;  2YHN A;  2JMD A;  3ASL A;  2HDP A;  4CA1 A;  2LXH C;  1BOR A;  2ECW A;  3LQH A;  3RPG B;  2LXP C;  1E4U A;  1VD4 A;  2ECG A;  2ZET C;  2L43 A;  4BBQ A;  2EA6 A;  2Y43 A;  2RSD A;  2FUU A;  3PHD A;  3O35 A;  5B76 A;  2YSM A;  4L58 A;  5TDW A;  4I7D A;  2CKL A;  2LGL A;  2QJ0 A;  2LRI C;  3ZNI A;  2KWO A;  3MHS A;  2YT5 A;  4GND A;  2VPG A;  2K16 A;  2YUC A;  5G04 B;  4R7E A;  5H1V A;  5LCW B;  4LLB A;  2VJE B;  2H0D A;  1FP0 A;  3GV4 A;  3MHH A;  3N9N A;  1WEN A;  5TRB A;  1WEP A;  3HCT A;  1LDK C;  4W4U A;  2C2L A;  1V87 A;  5B78 A;  2VJF B;  2KRE A;  2IDA A;  3ZPV E;  2CT2 A;  3T7L A;  2LGV A;  1HYJ A;  2K1J A;  2VP7 A;  3C6W A;  3SHB A;  1WEE A;  2VPB A;  2XEU A;  3ZYQ A;  2VPE A;  2QIZ A;  4PTB A;  5D1M B;  2QIC A;  1F62 A;  3N9L A;  2LV9 A;  5LKX A;  4YAT A;  3L1Z B;  5FEY A;  1WEQ A;  4MVT A;  2MA5 A;  2PUY A;  1WEV A;  2E6R A;  2CKL B;  5B79 A;  5C11 A;  4QF2 A;  4N4F A;  4A0C D;  4O64 A;  3T6R A;  3I2D A;  3ZTG A;  3ZPV 1;  5TAB A;  1MM2 A;  5D1K B;  1WIM A;  1VFY A;  2KYU A;  4IC2 A;  2DX8 A;  2VPD A;  1WES A;  3SOW A;  2AN6 A;  1LDJ B;  2MD8 C;  2L75 A;  3EB5 A;  5B75 A;  4IC3 A;  2KIZ A;  2K4D A;  2ECT A;  3ZVY A;  3L1X A;  4WZ0 A;  1WEM A;  3KQI A;  4YAX A;  2F42 A;  5H9M A;  2G6Q A;  3HCS A;  2YUR A;  1WEU A;  3N9M A;  3PUQ A;  1WEO A;  2RI7 A;  1JOC A;  4GNE A;  3U5O A;  1N87 A;  2KU3 A;  2YW8 A;  2L5U A;  1Z60 A;  4AUQ B;  3O34 A;  2VNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...