1F62A

Wstf-phd
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
b'ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR WSTF
publication title Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 51
sequence length 51
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1f62A00
2QIZA 2KWJA 3ZPV1 5KH7A 2VPBA 3PHDA 4A49A 2MIQA 2M1RA 4LADB 4C9ZA 2VJFB 4WZ3B 5EYAF 2MA6A 2LRIC 2ECIA 2KWOA 3O7AA 4I7CA 3QZVA 1WIMA 3ZYQA 2MD7B 2VPGA 2HYED 3KV5A 5LKZA 3L11A 2YSJA 4ZQLA 3C6WA 4FIPA 2IDAA 2M3HA 3O33A 1JM7A 2LN0A 2VJEA 5KH3A 3L1XA 5B79A 2FSAA 3RPGB 4FK5A 3HCSA 2K1JA 2K17A 5TABA 2Y43A 3T7LA 4R2YA 4AVXA 2ECVA 2AN6A 3RTRB 2F42A 1FP0A 2KIZA 3KNVA 5H9MA 1X4JA 3VK6A 4YADA 5D1LB 2VP7A 2MD8C 2VPDA 4ZDTA 4V3KC 2LXPC 2RI7A 3IHPA 1K2FA 5G05B 4PPEA 3U5NA 2YUCA 4NN2A 2KGIA 3LRQA 2L5UA 3EB6A 5TBNA 3HCTA 3N9PA 2L75A 2VJFA 5B78A 3M62A 4AYCB 2LV9A 5TRBA 1JOCA 1VFYA 1WESA 3KQIA 3GL6A 2KFTA 2XB1A 3ZVYA 2QJ0A 2PUYA 4L7XA 4BHWA 2MNYA 2MT5A 3M99A 4WZ0A 5FERA 4O64A 2L80A 2ECWA 2MUMA 2ECGA 2CSYA 3U5PA 5G04B 4YC9A 1LDJB 2KR4A 4YBMA 2KU3A 5B75A 2H0DB 4GNFA 1N87A 2KE1A 4R8PK 2KREA 4LJNA 5FB1A 3HTKC 4UP5A 2MA5A 3LQIA 4FO9A 4GNEA 4N4FA 2K4DA 3NG2A 5AIUA 2YT5A 2LQ6A 1HYIA 4TKPB 5C13A 2KWKA 1WGMA 4A0CD 2Y1MA 3HCUA 4F52B 2ECJA 2JRJA 4GNDA 2PNXA 4I7BA 3L1ZB 4R7EA 1XWHA 4X3GA 2YHNA 2LGLA 5LCWB 4UI9B 3MHSA 4AP4A 1WEQA 2JMIA 5LKTA 2QICA 2BAYA 4LLBA 3ZPVE 2Y1NA 3O70A 3DQVR 1HYJA 1WEMA 2EA6A 2D8SA 4B86C 2C2LA 3I2DA 4S3OC 4AYCA 1FBVA 1WEWA 2YURA 4Q6FA 1WEOA 4YATA 4A4BA 2KGGA 2YREA 5TDWA 2G43A 2CKLB 3T6RA 3U5MA 3U5OA 2E6RA 3O37A 3N9LA 2HDPA 2UZGA 3SHBA 5KH9A 1WEVA 3PURA 4LK9A 5LKUA 2H0DA 4CA1A 4W4UA 1WENA 1VYXA 5DKAA 2F6JA 2M85A 2YW8A 2YYRA 5FB0A 4MSXA 4ZUXU 5G0FA 1WILA 1U6GB 2YSMA 1T1HA 4YBTA 3N9NA 4B7YC 2MNZA 5B8DA 5AITA 4IC3A 2C2VS 2YQLA 4PTBA 3DPLR 1IYMA 2XEUA 2RSDA 3V43A 4FJCA 5I3LA 4P5OB 3RPGC 5B76A 1WE9A 4UP0A 2KWNA 2YU4A 1RMDA 4AUQB 2L0BA 1MM2A 1VD4A 2FUUA 2L43A 2EODA 1F62A 2M6MA 4YBSA 4I7DA 4GB0A 3LQHA 3ZVZB 2ZETC 3M63A 5B77A 3MHHA 2E6SA 3C5KA 4L58A 4YABA 5JG6A 2CT2A 4CCGX 2CKLA 1LDKC 5C11A 1WEUA 4MVTA 2G45A 2YQMA 4XI1A 2F6NA 4LKAA 5D1MB 1CHCA 3PUQA 2EGPA 4A4CA 3FL2A 1DVPA 1WEEA 3O34A 2ECNA 3ZNIA 1V87A 1ZBDB 2LDRA 3N9OA 5H1VA 1MM3A 5D1KB 4IC2A 2LGVA 3SOWA 4QF3A 4V3LC 3GV4A 5FEYA 4QF2A 4N3WA 1JM7B 2KYUA 2VJEB 1WFKA 2OXQC 3LQJA 2ECTA 2LGGA 2LGKA 3SOXA 1X4IA 5H1UA 3ZTGA 2LXHC 5DINA 2CSZA 4YAXA 1X4UA 3O35A 5H1TA 4S3OB 3N9QA 5TDRA 4BBQA 2JMDA 1WEPA 3KV6A 2DX8A 2G6QA 3SOUA 1Z60A 3ASLA 2FUIA 4GNGA 4WZ2A 3N9MA 3O36A 1G25A 2I50A 3EB5A 2YHOA 5J3XA 2NAAA 4WA6A 2VNFA 2VPEA 1Z6UA 2K16A 2JMJA 5LKXA 1BORA 1Z2QA 1E4UA
chains in the Genus database with same CATH superfamily
3LVRE 2QIZA 2KWJA 3ZPV1 5KH7A 2VPBA 3PHDA 4A49A 2CSVA 4OGCA 2MIQA 2M1RA 4LADB 4C9ZA 2VJFB 4WZ3B 5EYAF 2MA6A 2LRIC 2ECIA 2KWOA 3O7AA 4I7CA 3FAOA 3QZVA 1WIMA 3ZYQA 4QQ4A 2MD7B 2VPGA 3PLWA 2HYED 3KV5A 5LKZA 3L11A 2YSJA 4ZQLA 3C6WA 4FIPA 2IDAA 3FEHA 2M3HA 3O33A 1JM7A 3Q1DA 3T9KA 2LN0A 2VJEA 5KH3A 3L1XA 2D8UA 5B79A 2FSAA 3RPGB 4FK5A 3HCSA 2K1JA 2K17A 2B0OE 5TABA 2Y43A 3T7LA 4R2YA 4AVXA 2ECVA 2AN6A 3RTRB 2F42A 5SVIA 1FP0A 2KIZA 3E2DA 3KNVA 5H9MA 1X4JA 3VK6A 4YADA 5D1LB 2L7PA 2VP7A 2MD8C 2VPDA 4ZDTA 3DWDA 4V3KC 2LXPC 2RI7A 3IHPA 2KKYA 1K2FA 5G05B 4PPEA 3U5NA 4O62A 2YUCA 4NN2A 2KGIA 3LRQA 2XOYA 2FFWA 2L5UA 3EB6A 5TBNA 3HCTA 3N9PA 2L75A 2MKEA 2VJFA 3KDEC 2RR4A 2XOCA 5B78A 3FANA 3M62A 4AYCB 2LV9A 5TRBA 1JOCA 1VFYA 1WESA 3KQIA 3GL6A 3MDBC 2KFTA 2XB1A 3ZVYA 2QJ0A 2PUYA 4L7XA 4BHWA 2MNYA 2MT5A 3M99A 4WZ0A 5FERA 4O64A 2L80A 2ECWA 2MUMA 2ECGA 2CSYA 3U5PA 5G04B 4YC9A 1LDJB 2KR4A 4YBMA 2KU3A 5B75A 2H0DB 4GNFA 1N87A 2KE1A 4R8PK 2KREA 4LJNA 5FB1A 3HTKC 4UP5A 2MA5A 2JM3A 3LQIA 2YVRA 4FO9A 4GNEA 4N4FA 2XOZA 2K4DA 3NG2A 5AIUA 2YT5A 3DDTA 2LQ6A 1HYIA 4TKPB 3LJUX 5C13A 3LDYA 2KWKA 1WGMA 4A0CD 2Y1MA 3HCUA 2XP0A 4F52B 2ECJA 2JRJA 4GNDA 2EGMA 2PNXA 4I7BA 2CONA 3L1ZB 4R7EA 1XWHA 4X3GA 2YHNA 1MBMA 5SVXA 2LGLA 5LCWB 4UI9B 3MHSA 4AP4A 1WEQA 2JMIA 3O47A 5LKTA 2QICA 2BAYA 4LLBA 3ZPVE 2Y1NA 3O70A 3DQVR 1HYJA 1WEMA 2EA6A 2D8SA 4B86C 2C2LA 3H7HA 2LAUA 3I2DA 4S3OC 4AYCA 1FBVA 1WEWA 2YURA 4Q6FA 2DSMA 1WEOA 4YATA 4A4BA 2KGGA 2YREA 5TDWA 2G43A 2CKLB 3T6RA 3U5MA 3U5OA 2E6RA 3O37A 3N9LA 2HDPA 2UZGA 3SHBA 5KH9A 1WEVA 3PURA 4LK9A 5LKUA 2H0DA 4CA1A 4W4UA 1WENA 1VYXA 5DKAA 2F6JA 2M85A 2YW8A 2YYRA 2KKXA 5FB0A 1DCQA 4MSXA 2FD4A 4ZUXU 5G0FA 1WILA 1U6GB 2YSMA 2DJAA 1T1HA 3LVQE 5K3QA 4YBTA 3N9NA 4B7YC 2MNZA 5B8DA 5AITA 4IC3A 2C2VS 2YQLA 4PTBA 3DPLR 1IYMA 2XEUA 2RSDA 3V43A 4FJCA 5I3LA 2EXUA 4P5OB 3RPGC 5B76A 1WE9A 4UP0A 2KWNA 2YU4A 1RMDA 4AUQB 2L0BA 1MM2A 4F1PA 2JUNA 3SUBA 1VD4A 2FUUA 2M13A 2L43A 2EODA 1F62A 2M6MA 4YBSA 4I7DA 4GB0A 3LQHA 3ZVZB 2ZETC 3M63A 5B77A 3MHHA 2E6SA 3C5KA 4L58A 4YABA 5JG6A 2CT2A 4CCGX 2CKLA 1LDKC 5C11A 1WEUA 4MVTA 2G45A 2YQMA 4XI1A 2F6NA 4LKAA 5D1MB 1CHCA 3PUQA 2EGPA 4A4CA 3FL2A 3M7KA 1DVPA 1WEEA 3O34A 2ECNA 3ZNIA 1V87A 1ZBDB 2LDRA 3N9OA 5H1VA 1MM3A 5D1KB 4IC2A 2LGVA 3SOWA 4QF3A 4V3LC 3GV4A 5FEYA 4QF2A 4N3WA 1JM7B 2KYUA 2VJEB 2OWAA 1WFKA 2OXQC 3LQJA 2ECTA 2LGGA 3FJUB 2LGKA 4Z0RA 3SOXA 5SVIB 2IQJA 1X4IA 5H1UA 3ZTGA 2LXHC 5DINA 2CSZA 4YAXA 1X4UA 3O35A 5H1TA 3FM8C 4S3OB 4OGEA 3N9QA 5TDRA 4BBQA 2JMDA 1WEPA 3KV6A 2DX8A 2G6QA 3SOUA 5SVYA 1Z60A 3ASLA 2FUIA 4H9DA 4GNGA 4WZ2A 4Z0OA 3N9MA 3O36A 1G25A 2I50A 3EB5A 2YHOA 5J3XA 2NAAA 2P57A 4WA6A 2VNFA 2VPEA 1Z6UA 2K16A 2JMJA 5LKXA 1BORA 2CRRA 1Z2QA 3JUEA 2CRWA 1E4UA 2E61A
chains in the Genus database with same CATH topology
2QIZA 2KWJA 3ZPV1 5KH7A 2VPBA 3PHDA 4A49A 2MIQA 2M1RA 4LADB 4C9ZA 2VJFB 4WZ3B 5EYAF 2MA6A 2LRIC 2ECIA 2KWOA 3O7AA 4I7CA 3QZVA 1WIMA 3ZYQA 2MD7B 2VPGA 2HYED 3KV5A 5LKZA 3L11A 2YSJA 4ZQLA 3C6WA 4FIPA 2IDAA 2M3HA 3O33A 1JM7A 2LN0A 2VJEA 5KH3A 3L1XA 5B79A 2FSAA 3RPGB 4FK5A 3HCSA 2K1JA 2K17A 5TABA 2Y43A 3T7LA 4R2YA 4AVXA 2ECVA 2AN6A 3RTRB 2F42A 1FP0A 2KIZA 3KNVA 5H9MA 1X4JA 3VK6A 4YADA 5D1LB 2VP7A 2MD8C 2VPDA 4ZDTA 4V3KC 2LXPC 2RI7A 3IHPA 1K2FA 5G05B 4PPEA 3U5NA 2YUCA 4NN2A 2KGIA 3LRQA 2L5UA 3EB6A 5TBNA 3HCTA 3N9PA 2L75A 2VJFA 5B78A 3M62A 4AYCB 2LV9A 5TRBA 1JOCA 1VFYA 1WESA 3KQIA 3GL6A 2KFTA 2XB1A 3ZVYA 2QJ0A 2PUYA 4L7XA 4BHWA 2MNYA 2MT5A 3M99A 4WZ0A 5FERA 4O64A 2L80A 2ECWA 2MUMA 2ECGA 2CSYA 3U5PA 5G04B 4YC9A 1LDJB 2KR4A 4YBMA 2KU3A 5B75A 2H0DB 4GNFA 1N87A 2KE1A 4R8PK 2KREA 4LJNA 5FB1A 3HTKC 4UP5A 2MA5A 3LQIA 4FO9A 4GNEA 4N4FA 2K4DA 3NG2A 5AIUA 2YT5A 2LQ6A 1HYIA 4TKPB 5C13A 2KWKA 1WGMA 4A0CD 2Y1MA 3HCUA 4F52B 2ECJA 2JRJA 4GNDA 2PNXA 4I7BA 3L1ZB 4R7EA 1XWHA 4X3GA 2YHNA 2LGLA 5LCWB 4UI9B 3MHSA 4AP4A 1WEQA 2JMIA 5LKTA 2QICA 2BAYA 4LLBA 3ZPVE 2Y1NA 3O70A 3DQVR 1HYJA 1WEMA 2EA6A 2D8SA 4B86C 2C2LA 3I2DA 4S3OC 4AYCA 1FBVA 1WEWA 2YURA 4Q6FA 1WEOA 4YATA 4A4BA 2KGGA 2YREA 5TDWA 2G43A 2CKLB 3T6RA 3U5MA 3U5OA 2E6RA 3O37A 3N9LA 2HDPA 2UZGA 3SHBA 5KH9A 1WEVA 3PURA 4LK9A 5LKUA 2H0DA 4CA1A 4W4UA 1WENA 1VYXA 5DKAA 2F6JA 2M85A 2YW8A 2YYRA 5FB0A 4MSXA 4ZUXU 5G0FA 1WILA 1U6GB 2YSMA 1T1HA 4YBTA 3N9NA 4B7YC 2MNZA 5B8DA 5AITA 4IC3A 2C2VS 2YQLA 4PTBA 3DPLR 1IYMA 2XEUA 2RSDA 3V43A 4FJCA 5I3LA 4P5OB 3RPGC 5B76A 1WE9A 4UP0A 2KWNA 2YU4A 1RMDA 4AUQB 2L0BA 1MM2A 1VD4A 2FUUA 2L43A 2EODA 1F62A 2M6MA 4YBSA 4I7DA 4GB0A 3LQHA 3ZVZB 2ZETC 3M63A 5B77A 3MHHA 2E6SA 3C5KA 4L58A 4YABA 5JG6A 2CT2A 4CCGX 2CKLA 1LDKC 5C11A 1WEUA 4MVTA 2G45A 2YQMA 4XI1A 2F6NA 4LKAA 5D1MB 1CHCA 3PUQA 2EGPA 4A4CA 3FL2A 1DVPA 1WEEA 3O34A 2ECNA 3ZNIA 1V87A 1ZBDB 2LDRA 3N9OA 5H1VA 1MM3A 5D1KB 4IC2A 2LGVA 3SOWA 4QF3A 4V3LC 3GV4A 5FEYA 4QF2A 4N3WA 1JM7B 2KYUA 2VJEB 1WFKA 2OXQC 3LQJA 2ECTA 2LGGA 2LGKA 3SOXA 1X4IA 5H1UA 3ZTGA 2LXHC 5DINA 2CSZA 4YAXA 1X4UA 3O35A 5H1TA 4S3OB 3N9QA 5TDRA 4BBQA 2JMDA 1WEPA 3KV6A 2DX8A 2G6QA 3SOUA 1Z60A 3ASLA 2FUIA 4GNGA 4WZ2A 3N9MA 3O36A 1G25A 2I50A 3EB5A 2YHOA 5J3XA 2NAAA 4WA6A 2VNFA 2VPEA 1Z6UA 2K16A 2JMJA 5LKXA 1BORA 1Z2QA 1E4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIZ A;  2KWJ A;  3ZPV 1;  5KH7 A;  2VPB A;  3PHD A;  4A49 A;  2MIQ A;  2M1R A;  4LAD B;  4C9Z A;  2VJF B;  4WZ3 B;  5EYA F;  2MA6 A;  2LRI C;  2ECI A;  2KWO A;  3O7A A;  4I7C A;  3QZV A;  1WIM A;  3ZYQ A;  2MD7 B;  2VPG A;  2HYE D;  3KV5 A;  5LKZ A;  3L11 A;  2YSJ A;  4ZQL A;  3C6W A;  4FIP A;  2IDA A;  2M3H A;  3O33 A;  1JM7 A;  2LN0 A;  2VJE A;  5KH3 A;  3L1X A;  5B79 A;  2FSA A;  3RPG B;  4FK5 A;  3HCS A;  2K1J A;  2K17 A;  5TAB A;  2Y43 A;  3T7L A;  4R2Y A;  4AVX A;  2ECV A;  2AN6 A;  3RTR B;  2F42 A;  1FP0 A;  2KIZ A;  3KNV A;  5H9M A;  1X4J A;  3VK6 A;  4YAD A;  5D1L B;  2VP7 A;  2MD8 C;  2VPD A;  4ZDT A;  4V3K C;  2LXP C;  2RI7 A;  3IHP A;  1K2F A;  5G05 B;  4PPE A;  3U5N A;  2YUC A;  4NN2 A;  2KGI A;  3LRQ A;  2L5U A;  3EB6 A;  5TBN A;  3HCT A;  3N9P A;  2L75 A;  2VJF A;  5B78 A;  3M62 A;  4AYC B;  2LV9 A;  5TRB A;  1JOC A;  1VFY A;  1WES A;  3KQI A;  3GL6 A;  2KFT A;  2XB1 A;  3ZVY A;  2QJ0 A;  2PUY A;  4L7X A;  4BHW A;  2MNY A;  2MT5 A;  3M99 A;  4WZ0 A;  5FER A;  4O64 A;  2L80 A;  2ECW A;  2MUM A;  2ECG A;  2CSY A;  3U5P A;  5G04 B;  4YC9 A;  1LDJ B;  2KR4 A;  4YBM A;  2KU3 A;  5B75 A;  2H0D B;  4GNF A;  1N87 A;  2KE1 A;  4R8P K;  2KRE A;  4LJN A;  5FB1 A;  3HTK C;  4UP5 A;  2MA5 A;  3LQI A;  4FO9 A;  4GNE A;  4N4F A;  2K4D A;  3NG2 A;  5AIU A;  2YT5 A;  2LQ6 A;  1HYI A;  4TKP B;  5C13 A;  2KWK A;  1WGM A;  4A0C D;  2Y1M A;  3HCU A;  4F52 B;  2ECJ A;  2JRJ A;  4GND A;  2PNX A;  4I7B A;  3L1Z B;  4R7E A;  1XWH A;  4X3G A;  2YHN A;  2LGL A;  5LCW B;  4UI9 B;  3MHS A;  4AP4 A;  1WEQ A;  2JMI A;  5LKT A;  2QIC A;  2BAY A;  4LLB A;  3ZPV E;  2Y1N A;  3O70 A;  3DQV R;  1HYJ A;  1WEM A;  2EA6 A;  2D8S A;  4B86 C;  2C2L A;  3I2D A;  4S3O C;  4AYC A;  1FBV A;  1WEW A;  2YUR A;  4Q6F A;  1WEO A;  4YAT A;  4A4B A;  2KGG A;  2YRE A;  5TDW A;  2G43 A;  2CKL B;  3T6R A;  3U5M A;  3U5O A;  2E6R A;  3O37 A;  3N9L A;  2HDP A;  2UZG A;  3SHB A;  5KH9 A;  1WEV A;  3PUR A;  4LK9 A;  5LKU A;  2H0D A;  4CA1 A;  4W4U A;  1WEN A;  1VYX A;  5DKA A;  2F6J A;  2M85 A;  2YW8 A;  2YYR A;  5FB0 A;  4MSX A;  4ZUX U;  5G0F A;  1WIL A;  1U6G B;  2YSM A;  1T1H A;  4YBT A;  3N9N A;  4B7Y C;  2MNZ A;  5B8D A;  5AIT A;  4IC3 A;  2C2V S;  2YQL A;  4PTB A;  3DPL R;  1IYM A;  2XEU A;  2RSD A;  3V43 A;  4FJC A;  5I3L A;  4P5O B;  3RPG C;  5B76 A;  1WE9 A;  4UP0 A;  2KWN A;  2YU4 A;  1RMD A;  4AUQ B;  2L0B A;  1MM2 A;  1VD4 A;  2FUU A;  2L43 A;  2EOD A;  1F62 A;  2M6M A;  4YBS A;  4I7D A;  4GB0 A;  3LQH A;  3ZVZ B;  2ZET C;  3M63 A;  5B77 A;  3MHH A;  2E6S A;  3C5K A;  4L58 A;  4YAB A;  5JG6 A;  2CT2 A;  4CCG X;  2CKL A;  1LDK C;  5C11 A;  1WEU A;  4MVT A;  2G45 A;  2YQM A;  4XI1 A;  2F6N A;  4LKA A;  5D1M B;  1CHC A;  3PUQ A;  2EGP A;  4A4C A;  3FL2 A;  1DVP A;  1WEE A;  3O34 A;  2ECN A;  3ZNI A;  1V87 A;  1ZBD B;  2LDR A;  3N9O A;  5H1V A;  1MM3 A;  5D1K B;  4IC2 A;  2LGV A;  3SOW A;  4QF3 A;  4V3L C;  3GV4 A;  5FEY A;  4QF2 A;  4N3W A;  1JM7 B;  2KYU A;  2VJE B;  1WFK A;  2OXQ C;  3LQJ A;  2ECT A;  2LGG A;  2LGK A;  3SOX A;  1X4I A;  5H1U A;  3ZTG A;  2LXH C;  5DIN A;  2CSZ A;  4YAX A;  1X4U A;  3O35 A;  5H1T A;  4S3O B;  3N9Q A;  5TDR A;  4BBQ A;  2JMD A;  1WEP A;  3KV6 A;  2DX8 A;  2G6Q A;  3SOU A;  1Z60 A;  3ASL A;  2FUI A;  4GNG A;  4WZ2 A;  3N9M A;  3O36 A;  1G25 A;  2I50 A;  3EB5 A;  2YHO A;  5J3X A;  2NAA A;  4WA6 A;  2VNF A;  2VPE A;  1Z6U A;  2K16 A;  2JMJ A;  5LKX A;  1BOR A;  1Z2Q A;  1E4U A; 
#chains in the Genus database with same CATH topology
 3LVR E;  2QIZ A;  2KWJ A;  3ZPV 1;  5KH7 A;  2VPB A;  3PHD A;  4A49 A;  2CSV A;  4OGC A;  2MIQ A;  2M1R A;  4LAD B;  4C9Z A;  2VJF B;  4WZ3 B;  5EYA F;  2MA6 A;  2LRI C;  2ECI A;  2KWO A;  3O7A A;  4I7C A;  3FAO A;  3QZV A;  1WIM A;  3ZYQ A;  4QQ4 A;  2MD7 B;  2VPG A;  3PLW A;  2HYE D;  3KV5 A;  5LKZ A;  3L11 A;  2YSJ A;  4ZQL A;  3C6W A;  4FIP A;  2IDA A;  3FEH A;  2M3H A;  3O33 A;  1JM7 A;  3Q1D A;  3T9K A;  2LN0 A;  2VJE A;  5KH3 A;  3L1X A;  2D8U A;  5B79 A;  2FSA A;  3RPG B;  4FK5 A;  3HCS A;  2K1J A;  2K17 A;  2B0O E;  5TAB A;  2Y43 A;  3T7L A;  4R2Y A;  4AVX A;  2ECV A;  2AN6 A;  3RTR B;  2F42 A;  5SVI A;  1FP0 A;  2KIZ A;  3E2D A;  3KNV A;  5H9M A;  1X4J A;  3VK6 A;  4YAD A;  5D1L B;  2L7P A;  2VP7 A;  2MD8 C;  2VPD A;  4ZDT A;  3DWD A;  4V3K C;  2LXP C;  2RI7 A;  3IHP A;  2KKY A;  1K2F A;  5G05 B;  4PPE A;  3U5N A;  4O62 A;  2YUC A;  4NN2 A;  2KGI A;  3LRQ A;  2XOY A;  2FFW A;  2L5U A;  3EB6 A;  5TBN A;  3HCT A;  3N9P A;  2L75 A;  2MKE A;  2VJF A;  3KDE C;  2RR4 A;  2XOC A;  5B78 A;  3FAN A;  3M62 A;  4AYC B;  2LV9 A;  5TRB A;  1JOC A;  1VFY A;  1WES A;  3KQI A;  3GL6 A;  3MDB C;  2KFT A;  2XB1 A;  3ZVY A;  2QJ0 A;  2PUY A;  4L7X A;  4BHW A;  2MNY A;  2MT5 A;  3M99 A;  4WZ0 A;  5FER A;  4O64 A;  2L80 A;  2ECW A;  2MUM A;  2ECG A;  2CSY A;  3U5P A;  5G04 B;  4YC9 A;  1LDJ B;  2KR4 A;  4YBM A;  2KU3 A;  5B75 A;  2H0D B;  4GNF A;  1N87 A;  2KE1 A;  4R8P K;  2KRE A;  4LJN A;  5FB1 A;  3HTK C;  4UP5 A;  2MA5 A;  2JM3 A;  3LQI A;  2YVR A;  4FO9 A;  4GNE A;  4N4F A;  2XOZ A;  2K4D A;  3NG2 A;  5AIU A;  2YT5 A;  3DDT A;  2LQ6 A;  1HYI A;  4TKP B;  3LJU X;  5C13 A;  3LDY A;  2KWK A;  1WGM A;  4A0C D;  2Y1M A;  3HCU A;  2XP0 A;  4F52 B;  2ECJ A;  2JRJ A;  4GND A;  2EGM A;  2PNX A;  4I7B A;  2CON A;  3L1Z B;  4R7E A;  1XWH A;  4X3G A;  2YHN A;  1MBM A;  5SVX A;  2LGL A;  5LCW B;  4UI9 B;  3MHS A;  4AP4 A;  1WEQ A;  2JMI A;  3O47 A;  5LKT A;  2QIC A;  2BAY A;  4LLB A;  3ZPV E;  2Y1N A;  3O70 A;  3DQV R;  1HYJ A;  1WEM A;  2EA6 A;  2D8S A;  4B86 C;  2C2L A;  3H7H A;  2LAU A;  3I2D A;  4S3O C;  4AYC A;  1FBV A;  1WEW A;  2YUR A;  4Q6F A;  2DSM A;  1WEO A;  4YAT A;  4A4B A;  2KGG A;  2YRE A;  5TDW A;  2G43 A;  2CKL B;  3T6R A;  3U5M A;  3U5O A;  2E6R A;  3O37 A;  3N9L A;  2HDP A;  2UZG A;  3SHB A;  5KH9 A;  1WEV A;  3PUR A;  4LK9 A;  5LKU A;  2H0D A;  4CA1 A;  4W4U A;  1WEN A;  1VYX A;  5DKA A;  2F6J A;  2M85 A;  2YW8 A;  2YYR A;  2KKX A;  5FB0 A;  1DCQ A;  4MSX A;  2FD4 A;  4ZUX U;  5G0F A;  1WIL A;  1U6G B;  2YSM A;  2DJA A;  1T1H A;  3LVQ E;  5K3Q A;  4YBT A;  3N9N A;  4B7Y C;  2MNZ A;  5B8D A;  5AIT A;  4IC3 A;  2C2V S;  2YQL A;  4PTB A;  3DPL R;  1IYM A;  2XEU A;  2RSD A;  3V43 A;  4FJC A;  5I3L A;  2EXU A;  4P5O B;  3RPG C;  5B76 A;  1WE9 A;  4UP0 A;  2KWN A;  2YU4 A;  1RMD A;  4AUQ B;  2L0B A;  1MM2 A;  4F1P A;  2JUN A;  3SUB A;  1VD4 A;  2FUU A;  2M13 A;  2L43 A;  2EOD A;  1F62 A;  2M6M A;  4YBS A;  4I7D A;  4GB0 A;  3LQH A;  3ZVZ B;  2ZET C;  3M63 A;  5B77 A;  3MHH A;  2E6S A;  3C5K A;  4L58 A;  4YAB A;  5JG6 A;  2CT2 A;  4CCG X;  2CKL A;  1LDK C;  5C11 A;  1WEU A;  4MVT A;  2G45 A;  2YQM A;  4XI1 A;  2F6N A;  4LKA A;  5D1M B;  1CHC A;  3PUQ A;  2EGP A;  4A4C A;  3FL2 A;  3M7K A;  1DVP A;  1WEE A;  3O34 A;  2ECN A;  3ZNI A;  1V87 A;  1ZBD B;  2LDR A;  3N9O A;  5H1V A;  1MM3 A;  5D1K B;  4IC2 A;  2LGV A;  3SOW A;  4QF3 A;  4V3L C;  3GV4 A;  5FEY A;  4QF2 A;  4N3W A;  1JM7 B;  2KYU A;  2VJE B;  2OWA A;  1WFK A;  2OXQ C;  3LQJ A;  2ECT A;  2LGG A;  3FJU B;  2LGK A;  4Z0R A;  3SOX A;  5SVI B;  2IQJ A;  1X4I A;  5H1U A;  3ZTG A;  2LXH C;  5DIN A;  2CSZ A;  4YAX A;  1X4U A;  3O35 A;  5H1T A;  3FM8 C;  4S3O B;  4OGE A;  3N9Q A;  5TDR A;  4BBQ A;  2JMD A;  1WEP A;  3KV6 A;  2DX8 A;  2G6Q A;  3SOU A;  5SVY A;  1Z60 A;  3ASL A;  2FUI A;  4H9D A;  4GNG A;  4WZ2 A;  4Z0O A;  3N9M A;  3O36 A;  1G25 A;  2I50 A;  3EB5 A;  2YHO A;  5J3X A;  2NAA A;  2P57 A;  4WA6 A;  2VNF A;  2VPE A;  1Z6U A;  2K16 A;  2JMJ A;  5LKX A;  1BOR A;  2CRR A;  1Z2Q A;  3JUE A;  2CRW A;  1E4U A;  2E61 A; 
#chains in the Genus database with same CATH homology
 2QIZ A;  2KWJ A;  3ZPV 1;  5KH7 A;  2VPB A;  3PHD A;  4A49 A;  2MIQ A;  2M1R A;  4LAD B;  4C9Z A;  2VJF B;  4WZ3 B;  5EYA F;  2MA6 A;  2LRI C;  2ECI A;  2KWO A;  3O7A A;  4I7C A;  3QZV A;  1WIM A;  3ZYQ A;  2MD7 B;  2VPG A;  2HYE D;  3KV5 A;  5LKZ A;  3L11 A;  2YSJ A;  4ZQL A;  3C6W A;  4FIP A;  2IDA A;  2M3H A;  3O33 A;  1JM7 A;  2LN0 A;  2VJE A;  5KH3 A;  3L1X A;  5B79 A;  2FSA A;  3RPG B;  4FK5 A;  3HCS A;  2K1J A;  2K17 A;  5TAB A;  2Y43 A;  3T7L A;  4R2Y A;  4AVX A;  2ECV A;  2AN6 A;  3RTR B;  2F42 A;  1FP0 A;  2KIZ A;  3KNV A;  5H9M A;  1X4J A;  3VK6 A;  4YAD A;  5D1L B;  2VP7 A;  2MD8 C;  2VPD A;  4ZDT A;  4V3K C;  2LXP C;  2RI7 A;  3IHP A;  1K2F A;  5G05 B;  4PPE A;  3U5N A;  2YUC A;  4NN2 A;  2KGI A;  3LRQ A;  2L5U A;  3EB6 A;  5TBN A;  3HCT A;  3N9P A;  2L75 A;  2VJF A;  5B78 A;  3M62 A;  4AYC B;  2LV9 A;  5TRB A;  1JOC A;  1VFY A;  1WES A;  3KQI A;  3GL6 A;  2KFT A;  2XB1 A;  3ZVY A;  2QJ0 A;  2PUY A;  4L7X A;  4BHW A;  2MNY A;  2MT5 A;  3M99 A;  4WZ0 A;  5FER A;  4O64 A;  2L80 A;  2ECW A;  2MUM A;  2ECG A;  2CSY A;  3U5P A;  5G04 B;  4YC9 A;  1LDJ B;  2KR4 A;  4YBM A;  2KU3 A;  5B75 A;  2H0D B;  4GNF A;  1N87 A;  2KE1 A;  4R8P K;  2KRE A;  4LJN A;  5FB1 A;  3HTK C;  4UP5 A;  2MA5 A;  3LQI A;  4FO9 A;  4GNE A;  4N4F A;  2K4D A;  3NG2 A;  5AIU A;  2YT5 A;  2LQ6 A;  1HYI A;  4TKP B;  5C13 A;  2KWK A;  1WGM A;  4A0C D;  2Y1M A;  3HCU A;  4F52 B;  2ECJ A;  2JRJ A;  4GND A;  2PNX A;  4I7B A;  3L1Z B;  4R7E A;  1XWH A;  4X3G A;  2YHN A;  2LGL A;  5LCW B;  4UI9 B;  3MHS A;  4AP4 A;  1WEQ A;  2JMI A;  5LKT A;  2QIC A;  2BAY A;  4LLB A;  3ZPV E;  2Y1N A;  3O70 A;  3DQV R;  1HYJ A;  1WEM A;  2EA6 A;  2D8S A;  4B86 C;  2C2L A;  3I2D A;  4S3O C;  4AYC A;  1FBV A;  1WEW A;  2YUR A;  4Q6F A;  1WEO A;  4YAT A;  4A4B A;  2KGG A;  2YRE A;  5TDW A;  2G43 A;  2CKL B;  3T6R A;  3U5M A;  3U5O A;  2E6R A;  3O37 A;  3N9L A;  2HDP A;  2UZG A;  3SHB A;  5KH9 A;  1WEV A;  3PUR A;  4LK9 A;  5LKU A;  2H0D A;  4CA1 A;  4W4U A;  1WEN A;  1VYX A;  5DKA A;  2F6J A;  2M85 A;  2YW8 A;  2YYR A;  5FB0 A;  4MSX A;  4ZUX U;  5G0F A;  1WIL A;  1U6G B;  2YSM A;  1T1H A;  4YBT A;  3N9N A;  4B7Y C;  2MNZ A;  5B8D A;  5AIT A;  4IC3 A;  2C2V S;  2YQL A;  4PTB A;  3DPL R;  1IYM A;  2XEU A;  2RSD A;  3V43 A;  4FJC A;  5I3L A;  4P5O B;  3RPG C;  5B76 A;  1WE9 A;  4UP0 A;  2KWN A;  2YU4 A;  1RMD A;  4AUQ B;  2L0B A;  1MM2 A;  1VD4 A;  2FUU A;  2L43 A;  2EOD A;  1F62 A;  2M6M A;  4YBS A;  4I7D A;  4GB0 A;  3LQH A;  3ZVZ B;  2ZET C;  3M63 A;  5B77 A;  3MHH A;  2E6S A;  3C5K A;  4L58 A;  4YAB A;  5JG6 A;  2CT2 A;  4CCG X;  2CKL A;  1LDK C;  5C11 A;  1WEU A;  4MVT A;  2G45 A;  2YQM A;  4XI1 A;  2F6N A;  4LKA A;  5D1M B;  1CHC A;  3PUQ A;  2EGP A;  4A4C A;  3FL2 A;  1DVP A;  1WEE A;  3O34 A;  2ECN A;  3ZNI A;  1V87 A;  1ZBD B;  2LDR A;  3N9O A;  5H1V A;  1MM3 A;  5D1K B;  4IC2 A;  2LGV A;  3SOW A;  4QF3 A;  4V3L C;  3GV4 A;  5FEY A;  4QF2 A;  4N3W A;  1JM7 B;  2KYU A;  2VJE B;  1WFK A;  2OXQ C;  3LQJ A;  2ECT A;  2LGG A;  2LGK A;  3SOX A;  1X4I A;  5H1U A;  3ZTG A;  2LXH C;  5DIN A;  2CSZ A;  4YAX A;  1X4U A;  3O35 A;  5H1T A;  4S3O B;  3N9Q A;  5TDR A;  4BBQ A;  2JMD A;  1WEP A;  3KV6 A;  2DX8 A;  2G6Q A;  3SOU A;  1Z60 A;  3ASL A;  2FUI A;  4GNG A;  4WZ2 A;  3N9M A;  3O36 A;  1G25 A;  2I50 A;  3EB5 A;  2YHO A;  5J3X A;  2NAA A;  4WA6 A;  2VNF A;  2VPE A;  1Z6U A;  2K16 A;  2JMJ A;  5LKX A;  1BOR A;  1Z2Q A;  1E4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...