1F62A

Wstf-phd
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR WSTF
publication title Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 51
sequence length 51
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1f62A00
3L11A 3SHBA 2E6SA 2F6JA 2KR4A 3O34A 4N3WA 4CCGX 3HCTA 5FEYA 3RTRB 4W4UA 1BORA 1X4IA 3O7AA 1WE9A 1N87A 3EB6A 2KE1A 3U5PA 5DINA 5C13A 4R8PK 4R7EA 2D8SA 4MSXA 1VD4A 2L80A 1WEOA 4WZ0A 4WZ2A 2EA6A 4ZDTA 2Y1MA 3O35A 2L0BA 3O33A 1WFKA 4IC2A 2VP7A 2KWJA 2NAAA 3DPLR 4LLBA 5LKXA 4A4BA 1VYXA 2MNYA 4MVTA 3DQVR 4YBSA 3VK6A 3FL2A 2KREA 3C5KA 2YHNA 3ZYQA 2M6MA 1WEPA 4UP5A 2FUUA 3HCUA 2LDRA 4QF3A 2Y43A 2MA6A 1X4JA 2YT5A 2AN6A 3QZVA 4UP0A 1JOCA 4YBTA 2K17A 1HYJA 4C9ZA 3ZPV1 2M1RA 2PUYA 2ECGA 4YATA 4O64A 2QIZA 5G05B 4YBMA 4FJCA 5D1KB 3U5OA 2ECVA 3L1ZB 3LQHA 3T6RA 2VJFA 4V3LC 3IHPA 2L5UA 3N9OA 4A4CA 3U5NA 2CKLA 3ZPVE 1VFYA 2QICA 2RI7A 1F62A 2KYUA 2K16A 3M63A 2YUCA 1IYMA 2LN0A 3N9LA 2VJEB 3O70A 3KNVA 1JM7A 2XEUA 2LXHC 4YAXA 2VPGA 4L58A 2MNZA 2KGIA 5EYAF 4FK5A 3RPGB 4BBQA 2YW8A 4YABA 4LKAA 2JRJA 2LGVA 1MM2A 5KH9A 5FERA 2LRIC 1X4UA 2ECIA 2LXPC 4AYCB 2YQMA 4GNEA 2YYRA 4YC9A 2YURA 4R2YA 3V43A 3PHDA 4A0CD 5FB1A 1XWHA 2H0DA 3PURA 1HYIA 1V87A 5LKUA 4ZQLA 2VPDA 2KFTA 2MT5A 4AP4A 4ZUXU 2L43A 1WIMA 2YSJA 5TABA 1WILA 2BAYA 3M62A 4I7DA 1FP0A 2RSDA 2KWKA 1MM3A 4N4FA 5LKTA 4S3OB 5H1TA 2F6NA 3N9MA 5C11A 5TRBA 4YADA 2FSAA 5J3XA 4V3KC 5H1UA 4TKPB 2EODA 1LDJB 2EGPA 2PNXA 1WEEA 4LADB 2K4DA 5KH7A 4NN2A 5H1VA 4QF2A 3I2DA 4L7XA 1WEVA 5TDWA 1CHCA 2G43A 2LGLA 3SOXA 2YU4A 2VJEA 3EB5A 3NG2A 5B79A 3ZNIA 1ZBDB 5LKZA 2MA5A 3M99A 2OXQC 1T1HA 2KWNA 2ECTA 1WEQA 3N9NA 5JG6A 2HDPA 4UI9B 2C2VS 2KU3A 2KGGA 3PUQA 4PPEA 2MD8C 4B86C 2MIQA 2G45A 4WZ3B 2G6QA 4Q6FA 3U5MA 1Z60A 2VJFB 4GB0A 2CKLB 4GNGA 2LGGA 3HTKC 4FIPA 2YQLA 4CA1A 1U6GB 5TDRA 2CSYA 3KV6A 2HYED 4A49A 2YREA 1FBVA 2LGKA 3GL6A 2ECJA 5B8DA 3O37A 1JM7B 5TBNA 4WA6A 2JMIA 1WEWA 2UZGA 5KH3A 3HCSA 3RPGC 4AVXA 5I3LA 2VNFA 2ECNA 5D1LB 3N9QA 4F52B 4BHWA 3MHSA 1LDKC 1WESA 2M85A 2YHOA 3KV5A 2KIZA 1G25A 1E4UA 4AUQB 2JMDA 3LQIA 3ZTGA 3T7LA 2F42A 4I7CA 2ECWA 4PTBA 2DX8A 4XI1A 3SOUA 2H0DB 3LRQA 5D1MB 5DKAA 4B7YC 1RMDA 4GNFA 3LQJA 2LV9A 1WENA 4I7BA 1WGMA 4FO9A 2L75A 3ASLA 1WEMA 3ZVYA 4X3GA 5FB0A 4S3OC 2MD7B 4LK9A 5B78A 4LJNA 2FUIA 2Y1NA 3KQIA 2VPBA 3SOWA 5B75A 2JMJA 3C6WA 2LQ6A 2QJ0A 3O36A 2ZETC 2I50A 2C2LA 2IDAA 2E6RA 2VPEA 3L1XA 2CSZA 2K1JA 5G0FA 5AIUA 5B77A 3N9PA 4GNDA 5AITA 5G04B 2M3HA 2XB1A 3MHHA 3ZVZB 1DVPA 5B76A 5LCWB 1Z6UA 2KWOA 2MUMA 1WEUA 1K2FA 2CT2A 2YSMA 4AYCA 4P5OB 3GV4A 5H9MA 4IC3A 1Z2QA
chains in the Genus database with same CATH superfamily
3L11A 3SHBA 2E6SA 2F6JA 2KR4A 3O34A 4N3WA 4CCGX 3HCTA 5FEYA 3RTRB 4W4UA 1BORA 2DSMA 1X4IA 3O7AA 1WE9A 1N87A 3EB6A 2XOYA 2KE1A 3U5PA 5DINA 4Z0RA 5C13A 4R8PK 4R7EA 2D8SA 4MSXA 1VD4A 2L80A 1WEOA 4WZ0A 4WZ2A 2EA6A 4ZDTA 2Y1MA 3O35A 2L0BA 5SVIB 3O33A 4Z0OA 1WFKA 4IC2A 2VP7A 2KWJA 2NAAA 3DPLR 4LLBA 5LKXA 4F1PA 4A4BA 1VYXA 2MKEA 2MNYA 4MVTA 3DQVR 4YBSA 2CONA 3FL2A 3VK6A 2KREA 3C5KA 2YHNA 3ZYQA 2M6MA 1WEPA 4UP5A 2FUUA 3HCUA 2LDRA 4QF3A 2Y43A 2MA6A 1X4JA 2YT5A 2AN6A 3QZVA 2CSVA 4UP0A 1JOCA 4YBTA 2K17A 1HYJA 4C9ZA 3ZPV1 2M1RA 2PUYA 2ECGA 4YATA 4O64A 2QIZA 5G05B 4YBMA 3JUEA 4FJCA 5D1KB 2EXUA 3U5OA 2ECVA 3L1ZB 3LQHA 3T6RA 2VJFA 4V3LC 4H9DA 3IHPA 2L5UA 3N9OA 4A4CA 3U5NA 2CKLA 3ZPVE 1VFYA 2QICA 2RI7A 1F62A 1MBMA 2KYUA 2YVRA 2K16A 5SVYA 3M63A 2YUCA 1IYMA 2D8UA 2LN0A 3N9LA 2VJEB 3O70A 3KNVA 1JM7A 2XEUA 2LXHC 4YAXA 2VPGA 3LVQE 4L58A 2MNZA 2KGIA 2XOCA 5EYAF 4FK5A 2B0OE 2M13A 3RPGB 5SVIA 4BBQA 2YW8A 3SUBA 4YABA 2KKYA 4LKAA 2DJAA 2JRJA 2LGVA 3LJUX 2FFWA 1MM2A 5KH9A 5FERA 2LRIC 1X4UA 2ECIA 2LXPC 4AYCB 3FAOA 2YQMA 2P57A 4GNEA 3Q1DA 2YYRA 4YC9A 4QQ4A 2YURA 4R2YA 3V43A 3PHDA 4A0CD 5FB1A 3KDEC 1XWHA 2H0DA 3PURA 1HYIA 1V87A 5LKUA 4ZQLA 2VPDA 4OGEA 2RR4A 2KFTA 2MT5A 4AP4A 4ZUXU 2L43A 1WIMA 2YSJA 5TABA 1WILA 2BAYA 3M62A 4I7DA 1FP0A 2RSDA 2KWKA 1MM3A 5SVXA 2JUNA 4N4FA 5LKTA 4S3OB 5H1TA 1DCQA 2F6NA 2OWAA 3N9MA 5C11A 5TRBA 4YADA 2FSAA 5J3XA 4V3KC 5H1UA 4TKPB 2EODA 1LDJB 3DDTA 2EGPA 2PNXA 3LDYA 1WEEA 2FD4A 4LADB 2K4DA 5KH7A 4NN2A 5H1VA 4QF2A 3I2DA 4L7XA 1WEVA 5TDWA 2LAUA 3FJUB 1CHCA 2G43A 2LGLA 3SOXA 2YU4A 2VJEA 3EB5A 2E61A 3NG2A 5B79A 3ZNIA 1ZBDB 5LKZA 2MA5A 3M99A 2OXQC 1T1HA 2KWNA 2ECTA 1WEQA 2JM3A 3N9NA 5JG6A 2HDPA 4UI9B 2C2VS 2KU3A 2KGGA 3PUQA 4PPEA 2EGMA 2MD8C 4B86C 2MIQA 2G45A 4WZ3B 2G6QA 3PLWA 3M7KA 4Q6FA 3U5MA 1Z60A 2VJFB 4GB0A 2CKLB 4GNGA 3LVRE 2LGGA 3HTKC 4FIPA 2XOZA 2YQLA 4CA1A 1U6GB 5TDRA 2CSYA 3KV6A 2HYED 4A49A 2YREA 1FBVA 2LGKA 3GL6A 2ECJA 5B8DA 3H7HA 3O37A 1JM7B 5TBNA 4WA6A 2JMIA 1WEWA 2UZGA 5K3QA 5KH3A 4OGCA 3HCSA 3RPGC 2KKXA 4AVXA 5I3LA 2VNFA 3FEHA 2ECNA 3O47A 2XP0A 3FM8C 5D1LB 3N9QA 4F52B 4BHWA 3MHSA 1LDKC 1WESA 2M85A 2YHOA 3KV5A 2KIZA 1G25A 1E4UA 4AUQB 2JMDA 3LQIA 3ZTGA 3T7LA 2F42A 4I7CA 3DWDA 2ECWA 4PTBA 2DX8A 4XI1A 3SOUA 2H0DB 3LRQA 2IQJA 5D1MB 5DKAA 4B7YC 1RMDA 4GNFA 3LQJA 2LV9A 1WENA 4I7BA 1WGMA 2L7PA 4FO9A 2L75A 3ASLA 1WEMA 3ZVYA 4X3GA 5FB0A 4S3OC 2MD7B 4LK9A 5B78A 4LJNA 2FUIA 2Y1NA 3KQIA 4O62A 2VPBA 3SOWA 5B75A 2JMJA 3MDBC 3C6WA 2LQ6A 2QJ0A 3O36A 2ZETC 2I50A 2C2LA 2IDAA 3FANA 3T9KA 2E6RA 2VPEA 3L1XA 2CSZA 2CRWA 2K1JA 5G0FA 5AIUA 5B77A 3N9PA 3E2DA 4GNDA 5AITA 5G04B 2M3HA 2XB1A 3MHHA 3ZVZB 1DVPA 5B76A 2CRRA 5LCWB 1Z6UA 2KWOA 2MUMA 1WEUA 1K2FA 2CT2A 2YSMA 4AYCA 4P5OB 3GV4A 5H9MA 4IC3A 1Z2QA
chains in the Genus database with same CATH topology
3L11A 3SHBA 2E6SA 2F6JA 2KR4A 3O34A 4N3WA 4CCGX 3HCTA 5FEYA 3RTRB 4W4UA 1BORA 1X4IA 3O7AA 1WE9A 1N87A 3EB6A 2KE1A 3U5PA 5DINA 5C13A 4R8PK 4R7EA 2D8SA 4MSXA 1VD4A 2L80A 1WEOA 4WZ0A 4WZ2A 2EA6A 4ZDTA 2Y1MA 3O35A 2L0BA 3O33A 1WFKA 4IC2A 2VP7A 2KWJA 2NAAA 3DPLR 4LLBA 5LKXA 4A4BA 1VYXA 2MNYA 4MVTA 3DQVR 4YBSA 3VK6A 3FL2A 2KREA 3C5KA 2YHNA 3ZYQA 2M6MA 1WEPA 4UP5A 2FUUA 3HCUA 2LDRA 4QF3A 2Y43A 2MA6A 1X4JA 2YT5A 2AN6A 3QZVA 4UP0A 1JOCA 4YBTA 2K17A 1HYJA 4C9ZA 3ZPV1 2M1RA 2PUYA 2ECGA 4YATA 4O64A 2QIZA 5G05B 4YBMA 4FJCA 5D1KB 3U5OA 2ECVA 3L1ZB 3LQHA 3T6RA 2VJFA 4V3LC 3IHPA 2L5UA 3N9OA 4A4CA 3U5NA 2CKLA 3ZPVE 1VFYA 2QICA 2RI7A 1F62A 2KYUA 2K16A 3M63A 2YUCA 1IYMA 2LN0A 3N9LA 2VJEB 3O70A 3KNVA 1JM7A 2XEUA 2LXHC 4YAXA 2VPGA 4L58A 2MNZA 2KGIA 5EYAF 4FK5A 3RPGB 4BBQA 2YW8A 4YABA 4LKAA 2JRJA 2LGVA 1MM2A 5KH9A 5FERA 2LRIC 1X4UA 2ECIA 2LXPC 4AYCB 2YQMA 4GNEA 2YYRA 4YC9A 2YURA 4R2YA 3V43A 3PHDA 4A0CD 5FB1A 1XWHA 2H0DA 3PURA 1HYIA 1V87A 5LKUA 4ZQLA 2VPDA 2KFTA 2MT5A 4AP4A 4ZUXU 2L43A 1WIMA 2YSJA 5TABA 1WILA 2BAYA 3M62A 4I7DA 1FP0A 2RSDA 2KWKA 1MM3A 4N4FA 5LKTA 4S3OB 5H1TA 2F6NA 3N9MA 5C11A 5TRBA 4YADA 2FSAA 5J3XA 4V3KC 5H1UA 4TKPB 2EODA 1LDJB 2EGPA 2PNXA 1WEEA 4LADB 2K4DA 5KH7A 4NN2A 5H1VA 4QF2A 3I2DA 4L7XA 1WEVA 5TDWA 1CHCA 2G43A 2LGLA 3SOXA 2YU4A 2VJEA 3EB5A 3NG2A 5B79A 3ZNIA 1ZBDB 5LKZA 2MA5A 3M99A 2OXQC 1T1HA 2KWNA 2ECTA 1WEQA 3N9NA 5JG6A 2HDPA 4UI9B 2C2VS 2KU3A 2KGGA 3PUQA 4PPEA 2MD8C 4B86C 2MIQA 2G45A 4WZ3B 2G6QA 4Q6FA 3U5MA 1Z60A 2VJFB 4GB0A 2CKLB 4GNGA 2LGGA 3HTKC 4FIPA 2YQLA 4CA1A 1U6GB 5TDRA 2CSYA 3KV6A 2HYED 4A49A 2YREA 1FBVA 2LGKA 3GL6A 2ECJA 5B8DA 3O37A 1JM7B 5TBNA 4WA6A 2JMIA 1WEWA 2UZGA 5KH3A 3HCSA 3RPGC 4AVXA 5I3LA 2VNFA 2ECNA 5D1LB 3N9QA 4F52B 4BHWA 3MHSA 1LDKC 1WESA 2M85A 2YHOA 3KV5A 2KIZA 1G25A 1E4UA 4AUQB 2JMDA 3LQIA 3ZTGA 3T7LA 2F42A 4I7CA 2ECWA 4PTBA 2DX8A 4XI1A 3SOUA 2H0DB 3LRQA 5D1MB 5DKAA 4B7YC 1RMDA 4GNFA 3LQJA 2LV9A 1WENA 4I7BA 1WGMA 4FO9A 2L75A 3ASLA 1WEMA 3ZVYA 4X3GA 5FB0A 4S3OC 2MD7B 4LK9A 5B78A 4LJNA 2FUIA 2Y1NA 3KQIA 2VPBA 3SOWA 5B75A 2JMJA 3C6WA 2LQ6A 2QJ0A 3O36A 2ZETC 2I50A 2C2LA 2IDAA 2E6RA 2VPEA 3L1XA 2CSZA 2K1JA 5G0FA 5AIUA 5B77A 3N9PA 4GNDA 5AITA 5G04B 2M3HA 2XB1A 3MHHA 3ZVZB 1DVPA 5B76A 5LCWB 1Z6UA 2KWOA 2MUMA 1WEUA 1K2FA 2CT2A 2YSMA 4AYCA 4P5OB 3GV4A 5H9MA 4IC3A 1Z2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  3SHB A;  2E6S A;  2F6J A;  2KR4 A;  3O34 A;  4N3W A;  4CCG X;  3HCT A;  5FEY A;  3RTR B;  4W4U A;  1BOR A;  1X4I A;  3O7A A;  1WE9 A;  1N87 A;  3EB6 A;  2KE1 A;  3U5P A;  5DIN A;  5C13 A;  4R8P K;  4R7E A;  2D8S A;  4MSX A;  1VD4 A;  2L80 A;  1WEO A;  4WZ0 A;  4WZ2 A;  2EA6 A;  4ZDT A;  2Y1M A;  3O35 A;  2L0B A;  3O33 A;  1WFK A;  4IC2 A;  2VP7 A;  2KWJ A;  2NAA A;  3DPL R;  4LLB A;  5LKX A;  4A4B A;  1VYX A;  2MNY A;  4MVT A;  3DQV R;  4YBS A;  3VK6 A;  3FL2 A;  2KRE A;  3C5K A;  2YHN A;  3ZYQ A;  2M6M A;  1WEP A;  4UP5 A;  2FUU A;  3HCU A;  2LDR A;  4QF3 A;  2Y43 A;  2MA6 A;  1X4J A;  2YT5 A;  2AN6 A;  3QZV A;  4UP0 A;  1JOC A;  4YBT A;  2K17 A;  1HYJ A;  4C9Z A;  3ZPV 1;  2M1R A;  2PUY A;  2ECG A;  4YAT A;  4O64 A;  2QIZ A;  5G05 B;  4YBM A;  4FJC A;  5D1K B;  3U5O A;  2ECV A;  3L1Z B;  3LQH A;  3T6R A;  2VJF A;  4V3L C;  3IHP A;  2L5U A;  3N9O A;  4A4C A;  3U5N A;  2CKL A;  3ZPV E;  1VFY A;  2QIC A;  2RI7 A;  1F62 A;  2KYU A;  2K16 A;  3M63 A;  2YUC A;  1IYM A;  2LN0 A;  3N9L A;  2VJE B;  3O70 A;  3KNV A;  1JM7 A;  2XEU A;  2LXH C;  4YAX A;  2VPG A;  4L58 A;  2MNZ A;  2KGI A;  5EYA F;  4FK5 A;  3RPG B;  4BBQ A;  2YW8 A;  4YAB A;  4LKA A;  2JRJ A;  2LGV A;  1MM2 A;  5KH9 A;  5FER A;  2LRI C;  1X4U A;  2ECI A;  2LXP C;  4AYC B;  2YQM A;  4GNE A;  2YYR A;  4YC9 A;  2YUR A;  4R2Y A;  3V43 A;  3PHD A;  4A0C D;  5FB1 A;  1XWH A;  2H0D A;  3PUR A;  1HYI A;  1V87 A;  5LKU A;  4ZQL A;  2VPD A;  2KFT A;  2MT5 A;  4AP4 A;  4ZUX U;  2L43 A;  1WIM A;  2YSJ A;  5TAB A;  1WIL A;  2BAY A;  3M62 A;  4I7D A;  1FP0 A;  2RSD A;  2KWK A;  1MM3 A;  4N4F A;  5LKT A;  4S3O B;  5H1T A;  2F6N A;  3N9M A;  5C11 A;  5TRB A;  4YAD A;  2FSA A;  5J3X A;  4V3K C;  5H1U A;  4TKP B;  2EOD A;  1LDJ B;  2EGP A;  2PNX A;  1WEE A;  4LAD B;  2K4D A;  5KH7 A;  4NN2 A;  5H1V A;  4QF2 A;  3I2D A;  4L7X A;  1WEV A;  5TDW A;  1CHC A;  2G43 A;  2LGL A;  3SOX A;  2YU4 A;  2VJE A;  3EB5 A;  3NG2 A;  5B79 A;  3ZNI A;  1ZBD B;  5LKZ A;  2MA5 A;  3M99 A;  2OXQ C;  1T1H A;  2KWN A;  2ECT A;  1WEQ A;  3N9N A;  5JG6 A;  2HDP A;  4UI9 B;  2C2V S;  2KU3 A;  2KGG A;  3PUQ A;  4PPE A;  2MD8 C;  4B86 C;  2MIQ A;  2G45 A;  4WZ3 B;  2G6Q A;  4Q6F A;  3U5M A;  1Z60 A;  2VJF B;  4GB0 A;  2CKL B;  4GNG A;  2LGG A;  3HTK C;  4FIP A;  2YQL A;  4CA1 A;  1U6G B;  5TDR A;  2CSY A;  3KV6 A;  2HYE D;  4A49 A;  2YRE A;  1FBV A;  2LGK A;  3GL6 A;  2ECJ A;  5B8D A;  3O37 A;  1JM7 B;  5TBN A;  4WA6 A;  2JMI A;  1WEW A;  2UZG A;  5KH3 A;  3HCS A;  3RPG C;  4AVX A;  5I3L A;  2VNF A;  2ECN A;  5D1L B;  3N9Q A;  4F52 B;  4BHW A;  3MHS A;  1LDK C;  1WES A;  2M85 A;  2YHO A;  3KV5 A;  2KIZ A;  1G25 A;  1E4U A;  4AUQ B;  2JMD A;  3LQI A;  3ZTG A;  3T7L A;  2F42 A;  4I7C A;  2ECW A;  4PTB A;  2DX8 A;  4XI1 A;  3SOU A;  2H0D B;  3LRQ A;  5D1M B;  5DKA A;  4B7Y C;  1RMD A;  4GNF A;  3LQJ A;  2LV9 A;  1WEN A;  4I7B A;  1WGM A;  4FO9 A;  2L75 A;  3ASL A;  1WEM A;  3ZVY A;  4X3G A;  5FB0 A;  4S3O C;  2MD7 B;  4LK9 A;  5B78 A;  4LJN A;  2FUI A;  2Y1N A;  3KQI A;  2VPB A;  3SOW A;  5B75 A;  2JMJ A;  3C6W A;  2LQ6 A;  2QJ0 A;  3O36 A;  2ZET C;  2I50 A;  2C2L A;  2IDA A;  2E6R A;  2VPE A;  3L1X A;  2CSZ A;  2K1J A;  5G0F A;  5AIU A;  5B77 A;  3N9P A;  4GND A;  5AIT A;  5G04 B;  2M3H A;  2XB1 A;  3MHH A;  3ZVZ B;  1DVP A;  5B76 A;  5LCW B;  1Z6U A;  2KWO A;  2MUM A;  1WEU A;  1K2F A;  2CT2 A;  2YSM A;  4AYC A;  4P5O B;  3GV4 A;  5H9M A;  4IC3 A;  1Z2Q A; 
#chains in the Genus database with same CATH topology
 3L11 A;  3SHB A;  2E6S A;  2F6J A;  2KR4 A;  3O34 A;  4N3W A;  4CCG X;  3HCT A;  5FEY A;  3RTR B;  4W4U A;  1BOR A;  2DSM A;  1X4I A;  3O7A A;  1WE9 A;  1N87 A;  3EB6 A;  2XOY A;  2KE1 A;  3U5P A;  5DIN A;  4Z0R A;  5C13 A;  4R8P K;  4R7E A;  2D8S A;  4MSX A;  1VD4 A;  2L80 A;  1WEO A;  4WZ0 A;  4WZ2 A;  2EA6 A;  4ZDT A;  2Y1M A;  3O35 A;  2L0B A;  5SVI B;  3O33 A;  4Z0O A;  1WFK A;  4IC2 A;  2VP7 A;  2KWJ A;  2NAA A;  3DPL R;  4LLB A;  5LKX A;  4F1P A;  4A4B A;  1VYX A;  2MKE A;  2MNY A;  4MVT A;  3DQV R;  4YBS A;  2CON A;  3FL2 A;  3VK6 A;  2KRE A;  3C5K A;  2YHN A;  3ZYQ A;  2M6M A;  1WEP A;  4UP5 A;  2FUU A;  3HCU A;  2LDR A;  4QF3 A;  2Y43 A;  2MA6 A;  1X4J A;  2YT5 A;  2AN6 A;  3QZV A;  2CSV A;  4UP0 A;  1JOC A;  4YBT A;  2K17 A;  1HYJ A;  4C9Z A;  3ZPV 1;  2M1R A;  2PUY A;  2ECG A;  4YAT A;  4O64 A;  2QIZ A;  5G05 B;  4YBM A;  3JUE A;  4FJC A;  5D1K B;  2EXU A;  3U5O A;  2ECV A;  3L1Z B;  3LQH A;  3T6R A;  2VJF A;  4V3L C;  4H9D A;  3IHP A;  2L5U A;  3N9O A;  4A4C A;  3U5N A;  2CKL A;  3ZPV E;  1VFY A;  2QIC A;  2RI7 A;  1F62 A;  1MBM A;  2KYU A;  2YVR A;  2K16 A;  5SVY A;  3M63 A;  2YUC A;  1IYM A;  2D8U A;  2LN0 A;  3N9L A;  2VJE B;  3O70 A;  3KNV A;  1JM7 A;  2XEU A;  2LXH C;  4YAX A;  2VPG A;  3LVQ E;  4L58 A;  2MNZ A;  2KGI A;  2XOC A;  5EYA F;  4FK5 A;  2B0O E;  2M13 A;  3RPG B;  5SVI A;  4BBQ A;  2YW8 A;  3SUB A;  4YAB A;  2KKY A;  4LKA A;  2DJA A;  2JRJ A;  2LGV A;  3LJU X;  2FFW A;  1MM2 A;  5KH9 A;  5FER A;  2LRI C;  1X4U A;  2ECI A;  2LXP C;  4AYC B;  3FAO A;  2YQM A;  2P57 A;  4GNE A;  3Q1D A;  2YYR A;  4YC9 A;  4QQ4 A;  2YUR A;  4R2Y A;  3V43 A;  3PHD A;  4A0C D;  5FB1 A;  3KDE C;  1XWH A;  2H0D A;  3PUR A;  1HYI A;  1V87 A;  5LKU A;  4ZQL A;  2VPD A;  4OGE A;  2RR4 A;  2KFT A;  2MT5 A;  4AP4 A;  4ZUX U;  2L43 A;  1WIM A;  2YSJ A;  5TAB A;  1WIL A;  2BAY A;  3M62 A;  4I7D A;  1FP0 A;  2RSD A;  2KWK A;  1MM3 A;  5SVX A;  2JUN A;  4N4F A;  5LKT A;  4S3O B;  5H1T A;  1DCQ A;  2F6N A;  2OWA A;  3N9M A;  5C11 A;  5TRB A;  4YAD A;  2FSA A;  5J3X A;  4V3K C;  5H1U A;  4TKP B;  2EOD A;  1LDJ B;  3DDT A;  2EGP A;  2PNX A;  3LDY A;  1WEE A;  2FD4 A;  4LAD B;  2K4D A;  5KH7 A;  4NN2 A;  5H1V A;  4QF2 A;  3I2D A;  4L7X A;  1WEV A;  5TDW A;  2LAU A;  3FJU B;  1CHC A;  2G43 A;  2LGL A;  3SOX A;  2YU4 A;  2VJE A;  3EB5 A;  2E61 A;  3NG2 A;  5B79 A;  3ZNI A;  1ZBD B;  5LKZ A;  2MA5 A;  3M99 A;  2OXQ C;  1T1H A;  2KWN A;  2ECT A;  1WEQ A;  2JM3 A;  3N9N A;  5JG6 A;  2HDP A;  4UI9 B;  2C2V S;  2KU3 A;  2KGG A;  3PUQ A;  4PPE A;  2EGM A;  2MD8 C;  4B86 C;  2MIQ A;  2G45 A;  4WZ3 B;  2G6Q A;  3PLW A;  3M7K A;  4Q6F A;  3U5M A;  1Z60 A;  2VJF B;  4GB0 A;  2CKL B;  4GNG A;  3LVR E;  2LGG A;  3HTK C;  4FIP A;  2XOZ A;  2YQL A;  4CA1 A;  1U6G B;  5TDR A;  2CSY A;  3KV6 A;  2HYE D;  4A49 A;  2YRE A;  1FBV A;  2LGK A;  3GL6 A;  2ECJ A;  5B8D A;  3H7H A;  3O37 A;  1JM7 B;  5TBN A;  4WA6 A;  2JMI A;  1WEW A;  2UZG A;  5K3Q A;  5KH3 A;  4OGC A;  3HCS A;  3RPG C;  2KKX A;  4AVX A;  5I3L A;  2VNF A;  3FEH A;  2ECN A;  3O47 A;  2XP0 A;  3FM8 C;  5D1L B;  3N9Q A;  4F52 B;  4BHW A;  3MHS A;  1LDK C;  1WES A;  2M85 A;  2YHO A;  3KV5 A;  2KIZ A;  1G25 A;  1E4U A;  4AUQ B;  2JMD A;  3LQI A;  3ZTG A;  3T7L A;  2F42 A;  4I7C A;  3DWD A;  2ECW A;  4PTB A;  2DX8 A;  4XI1 A;  3SOU A;  2H0D B;  3LRQ A;  2IQJ A;  5D1M B;  5DKA A;  4B7Y C;  1RMD A;  4GNF A;  3LQJ A;  2LV9 A;  1WEN A;  4I7B A;  1WGM A;  2L7P A;  4FO9 A;  2L75 A;  3ASL A;  1WEM A;  3ZVY A;  4X3G A;  5FB0 A;  4S3O C;  2MD7 B;  4LK9 A;  5B78 A;  4LJN A;  2FUI A;  2Y1N A;  3KQI A;  4O62 A;  2VPB A;  3SOW A;  5B75 A;  2JMJ A;  3MDB C;  3C6W A;  2LQ6 A;  2QJ0 A;  3O36 A;  2ZET C;  2I50 A;  2C2L A;  2IDA A;  3FAN A;  3T9K A;  2E6R A;  2VPE A;  3L1X A;  2CSZ A;  2CRW A;  2K1J A;  5G0F A;  5AIU A;  5B77 A;  3N9P A;  3E2D A;  4GND A;  5AIT A;  5G04 B;  2M3H A;  2XB1 A;  3MHH A;  3ZVZ B;  1DVP A;  5B76 A;  2CRR A;  5LCW B;  1Z6U A;  2KWO A;  2MUM A;  1WEU A;  1K2F A;  2CT2 A;  2YSM A;  4AYC A;  4P5O B;  3GV4 A;  5H9M A;  4IC3 A;  1Z2Q A; 
#chains in the Genus database with same CATH homology
 3L11 A;  3SHB A;  2E6S A;  2F6J A;  2KR4 A;  3O34 A;  4N3W A;  4CCG X;  3HCT A;  5FEY A;  3RTR B;  4W4U A;  1BOR A;  1X4I A;  3O7A A;  1WE9 A;  1N87 A;  3EB6 A;  2KE1 A;  3U5P A;  5DIN A;  5C13 A;  4R8P K;  4R7E A;  2D8S A;  4MSX A;  1VD4 A;  2L80 A;  1WEO A;  4WZ0 A;  4WZ2 A;  2EA6 A;  4ZDT A;  2Y1M A;  3O35 A;  2L0B A;  3O33 A;  1WFK A;  4IC2 A;  2VP7 A;  2KWJ A;  2NAA A;  3DPL R;  4LLB A;  5LKX A;  4A4B A;  1VYX A;  2MNY A;  4MVT A;  3DQV R;  4YBS A;  3VK6 A;  3FL2 A;  2KRE A;  3C5K A;  2YHN A;  3ZYQ A;  2M6M A;  1WEP A;  4UP5 A;  2FUU A;  3HCU A;  2LDR A;  4QF3 A;  2Y43 A;  2MA6 A;  1X4J A;  2YT5 A;  2AN6 A;  3QZV A;  4UP0 A;  1JOC A;  4YBT A;  2K17 A;  1HYJ A;  4C9Z A;  3ZPV 1;  2M1R A;  2PUY A;  2ECG A;  4YAT A;  4O64 A;  2QIZ A;  5G05 B;  4YBM A;  4FJC A;  5D1K B;  3U5O A;  2ECV A;  3L1Z B;  3LQH A;  3T6R A;  2VJF A;  4V3L C;  3IHP A;  2L5U A;  3N9O A;  4A4C A;  3U5N A;  2CKL A;  3ZPV E;  1VFY A;  2QIC A;  2RI7 A;  1F62 A;  2KYU A;  2K16 A;  3M63 A;  2YUC A;  1IYM A;  2LN0 A;  3N9L A;  2VJE B;  3O70 A;  3KNV A;  1JM7 A;  2XEU A;  2LXH C;  4YAX A;  2VPG A;  4L58 A;  2MNZ A;  2KGI A;  5EYA F;  4FK5 A;  3RPG B;  4BBQ A;  2YW8 A;  4YAB A;  4LKA A;  2JRJ A;  2LGV A;  1MM2 A;  5KH9 A;  5FER A;  2LRI C;  1X4U A;  2ECI A;  2LXP C;  4AYC B;  2YQM A;  4GNE A;  2YYR A;  4YC9 A;  2YUR A;  4R2Y A;  3V43 A;  3PHD A;  4A0C D;  5FB1 A;  1XWH A;  2H0D A;  3PUR A;  1HYI A;  1V87 A;  5LKU A;  4ZQL A;  2VPD A;  2KFT A;  2MT5 A;  4AP4 A;  4ZUX U;  2L43 A;  1WIM A;  2YSJ A;  5TAB A;  1WIL A;  2BAY A;  3M62 A;  4I7D A;  1FP0 A;  2RSD A;  2KWK A;  1MM3 A;  4N4F A;  5LKT A;  4S3O B;  5H1T A;  2F6N A;  3N9M A;  5C11 A;  5TRB A;  4YAD A;  2FSA A;  5J3X A;  4V3K C;  5H1U A;  4TKP B;  2EOD A;  1LDJ B;  2EGP A;  2PNX A;  1WEE A;  4LAD B;  2K4D A;  5KH7 A;  4NN2 A;  5H1V A;  4QF2 A;  3I2D A;  4L7X A;  1WEV A;  5TDW A;  1CHC A;  2G43 A;  2LGL A;  3SOX A;  2YU4 A;  2VJE A;  3EB5 A;  3NG2 A;  5B79 A;  3ZNI A;  1ZBD B;  5LKZ A;  2MA5 A;  3M99 A;  2OXQ C;  1T1H A;  2KWN A;  2ECT A;  1WEQ A;  3N9N A;  5JG6 A;  2HDP A;  4UI9 B;  2C2V S;  2KU3 A;  2KGG A;  3PUQ A;  4PPE A;  2MD8 C;  4B86 C;  2MIQ A;  2G45 A;  4WZ3 B;  2G6Q A;  4Q6F A;  3U5M A;  1Z60 A;  2VJF B;  4GB0 A;  2CKL B;  4GNG A;  2LGG A;  3HTK C;  4FIP A;  2YQL A;  4CA1 A;  1U6G B;  5TDR A;  2CSY A;  3KV6 A;  2HYE D;  4A49 A;  2YRE A;  1FBV A;  2LGK A;  3GL6 A;  2ECJ A;  5B8D A;  3O37 A;  1JM7 B;  5TBN A;  4WA6 A;  2JMI A;  1WEW A;  2UZG A;  5KH3 A;  3HCS A;  3RPG C;  4AVX A;  5I3L A;  2VNF A;  2ECN A;  5D1L B;  3N9Q A;  4F52 B;  4BHW A;  3MHS A;  1LDK C;  1WES A;  2M85 A;  2YHO A;  3KV5 A;  2KIZ A;  1G25 A;  1E4U A;  4AUQ B;  2JMD A;  3LQI A;  3ZTG A;  3T7L A;  2F42 A;  4I7C A;  2ECW A;  4PTB A;  2DX8 A;  4XI1 A;  3SOU A;  2H0D B;  3LRQ A;  5D1M B;  5DKA A;  4B7Y C;  1RMD A;  4GNF A;  3LQJ A;  2LV9 A;  1WEN A;  4I7B A;  1WGM A;  4FO9 A;  2L75 A;  3ASL A;  1WEM A;  3ZVY A;  4X3G A;  5FB0 A;  4S3O C;  2MD7 B;  4LK9 A;  5B78 A;  4LJN A;  2FUI A;  2Y1N A;  3KQI A;  2VPB A;  3SOW A;  5B75 A;  2JMJ A;  3C6W A;  2LQ6 A;  2QJ0 A;  3O36 A;  2ZET C;  2I50 A;  2C2L A;  2IDA A;  2E6R A;  2VPE A;  3L1X A;  2CSZ A;  2K1J A;  5G0F A;  5AIU A;  5B77 A;  3N9P A;  4GND A;  5AIT A;  5G04 B;  2M3H A;  2XB1 A;  3MHH A;  3ZVZ B;  1DVP A;  5B76 A;  5LCW B;  1Z6U A;  2KWO A;  2MUM A;  1WEU A;  1K2F A;  2CT2 A;  2YSM A;  4AYC A;  4P5O B;  3GV4 A;  5H9M A;  4IC3 A;  1Z2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...