2KWJA

Solution structures of the double phd fingers of human transcriptional protein dpf3 bound to a histone peptide containing acetylation at lysine 14
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwjA00
2YURA 3MHSA 5D1KB 1WEPA 1DVPA 2ZETC 2EGPA 3IHPA 5FB0A 2VPBA 4R2YA 4F52B 2VPGA 1MM3A 2YHNA 1WEWA 2KR4A 2MUMA 4UI9B 5KH9A 2FSAA 5JG6A 2ECTA 3O37A 3V43A 2KIZA 3QZVA 2ECWA 1VFYA 4YABA 2E6SA 4Q6FA 4WZ3B 4N3WA 2EA6A 5FERA 4LKAA 4P5OB 1Z2QA 2JMJA 2YSMA 3O34A 2Y43A 2HYED 4C9ZA 1WIMA 2PUYA 4AP4A 1K2FA 2MIQA 3PHDA 2QICA 4I7CA 2L0BA 2F6JA 1WEEA 2CKLA 2QJ0A 5LCWB 4L58A 2CSYA 5AIUA 3RPGB 3NG2A 4ZDTA 2KWNA 4YC9A 3O7AA 1X4UA 3HTKC 4S3OC 2LGKA 1V87A 3MHHA 2AN6A 2KREA 2YYRA 1X4JA 3DQVR 3M99A 4I7DA 3SOXA 1G25A 2HDPA 2Y1MA 5TDRA 5DKAA 2L75A 3T7LA 3C6WA 1MM2A 2G45A 2KGGA 4L7XA 4UP0A 5H9MA 4UP5A 3PURA 4TKPB 5TABA 2VP7A 3L1ZB 2ECJA 3ZVZB 2ECVA 4GNEA 4YADA 4WA6A 4X3GA 1VYXA 1U6GB 2M85A 5J3XA 2ECIA 2YQLA 2L5UA 4LADB 1JOCA 2MD7B 4YAXA 1JM7A 3L11A 3C5KA 2L80A 3GL6A 5H1TA 4I7BA 3O36A 3ZPVE 1WESA 2KWOA 1WILA 4YBTA 4NN2A 2YT5A 4IC3A 3ZTGA 3L1XA 1WEVA 1FP0A 2L43A 3HCSA 2XEUA 3FL2A 3T6RA 2LGVA 5G05B 2K1JA 2MD8C 4YATA 1X4IA 2CKLB 5C11A 4LLBA 1HYJA 2DX8A 2MA5A 1WEUA 2YSJA 4S3OB 3KQIA 1LDJB 3LQHA 2C2VS 2LN0A 5LKTA 3LQIA 2C2LA 5D1LB 2YW8A 2RI7A 2K4DA 4CA1A 1RMDA 2LQ6A 4YBSA 1FBVA 4A4BA 2MT5A 2VNFA 4GB0A 4A0CD 5G04B 3DPLR 1XWHA 4YBMA 2LDRA 3RTRB 2H0DA 5LKZA 5I3LA 2F42A 2LGLA 4V3KC 1CHCA 3EB5A 3VK6A 1JM7B 2KYUA 2OXQC 5B76A 3I2DA 1WE9A 3U5OA 5H1UA 4XI1A 4GNFA 4AYCA 4LJNA 3SHBA 2VJFA 5TRBA 5TBNA 5FEYA 2XB1A 2M3HA 2ECNA 1F62A 2JRJA 3KV6A 4AUQB 1WEOA 4PTBA 2LXHC 3M63A 2Y1NA 4FIPA 4FJCA 4QF3A 2VPDA 4BHWA 4IC2A 2VPEA 2YU4A 1WEMA 4WZ0A 2UZGA 2MNZA 2E6RA 2LV9A 5KH3A 3O33A 2I50A 3PUQA 3GV4A 2IDAA 3O35A 4MSXA 1WEQA 2QIZA 1LDKC 5H1VA 3ZYQA 2K17A 2LXPC 4O64A 2VJEA 2NAAA 1HYIA 4FO9A 2H0DB 2M1RA 5C13A 4R7EA 3EB6A 2FUIA 2YHOA 2G43A 2K16A 1N87A 3ASLA 3KNVA 2KE1A 3LQJA 4ZUXU 1IYMA 3ZNIA 5TDWA 4MVTA 4PPEA 4R8PK 3N9OA 2KU3A 3U5PA 4ZQLA 3O70A 4AYCB 3LRQA 2VJFB 5DINA 2JMIA 5EYAF 2BAYA 4GNDA 4WZ2A 1BORA 3KV5A 4A4CA 3N9PA 2KWJA 2ECGA 5B78A 4CCGX 3ZVYA 3N9NA 5G0FA 5LKXA 4B86C 2F6NA 2KFTA 3HCTA 1T1HA 2KWKA 4FK5A 4QF2A 3ZPV1 1Z60A 3N9QA 2LGGA 2MA6A 3SOWA 1Z6UA 2RSDA 5LKUA 4LK9A 4V3LC 2LRIC 4A49A 1WGMA 3U5NA 3RPGC 2YUCA 2JMDA 2VJEB 4B7YC 3SOUA 5B77A 5D1MB 1ZBDB 2MNYA 2KGIA 5FB1A 3HCUA 5B79A 2FUUA 2YREA 2D8SA 4GNGA 1WENA 4AVXA 2G6QA 2YQMA 1VD4A 4W4UA 5B75A 2CSZA 5B8DA 3U5MA 1WFKA 1E4UA 2CT2A 2PNXA 4BBQA 3N9MA 4N4FA 2M6MA 2EODA 5AITA 3M62A 3N9LA 5KH7A
chains in the Genus database with same CATH superfamily
2YURA 3MHSA 5D1KB 1WEPA 1DVPA 2ZETC 2EGPA 3IHPA 5FB0A 2VPBA 4R2YA 4F52B 2VPGA 1MM3A 2YHNA 1WEWA 2KR4A 2MUMA 4UI9B 5KH9A 2FSAA 5JG6A 2ECTA 3O37A 1MBMA 3V43A 2KIZA 3QZVA 2ECWA 1VFYA 4YABA 2E6SA 4Q6FA 4WZ3B 4N3WA 5SVIA 2EA6A 5FERA 4P5OB 4LKAA 1Z2QA 2JMJA 2YSMA 3O34A 2Y43A 2HYED 4OGEA 4C9ZA 1WIMA 2PUYA 3FEHA 3PLWA 4AP4A 1K2FA 2MIQA 4H9DA 3PHDA 2QICA 4I7CA 2EGMA 2L0BA 2F6JA 1WEEA 2CKLA 2QJ0A 5LCWB 4L58A 2CSYA 5AIUA 3RPGB 3NG2A 4ZDTA 3LDYA 2KWNA 4YC9A 3O7AA 2E61A 1X4UA 3HTKC 4S3OC 2LGKA 1V87A 3MHHA 2KKXA 2AN6A 4F1PA 2KREA 2YYRA 4QQ4A 1X4JA 3DQVR 3M99A 4I7DA 3SOXA 1G25A 2HDPA 5K3QA 2Y1MA 5TDRA 5DKAA 2L75A 3T7LA 4OGCA 3C6WA 1MM2A 2G45A 2KGGA 4L7XA 4UP0A 5H9MA 4UP5A 3PURA 2D8UA 4TKPB 2DJAA 5TABA 2VP7A 3L1ZB 2ECJA 5SVYA 4Z0OA 3ZVZB 2ECVA 4GNEA 4YADA 4WA6A 4X3GA 1VYXA 1U6GB 2M85A 5J3XA 2ECIA 2YQLA 2L5UA 4LADB 1JOCA 2MD7B 2IQJA 4YAXA 1JM7A 3L11A 3C5KA 3JUEA 2FD4A 2B0OE 2L80A 3GL6A 5H1TA 4I7BA 3O36A 3E2DA 3ZPVE 1WESA 2KWOA 1WILA 4YBTA 4NN2A 2YT5A 4IC3A 3ZTGA 3L1XA 1WEVA 1FP0A 3SUBA 5SVIB 2L43A 3HCSA 2XEUA 2LAUA 3LJUX 3FL2A 3T6RA 2LGVA 5G05B 2K1JA 2MD8C 4YATA 5SVXA 1X4IA 2M13A 2CKLB 5C11A 4LLBA 1HYJA 2RR4A 2DX8A 2MA5A 2XOZA 1WEUA 2YSJA 4S3OB 2JUNA 3KQIA 2KKYA 1LDJB 3LQHA 2C2VS 2LN0A 5LKTA 4O62A 3LQIA 2C2LA 5D1LB 3LVQE 2YW8A 2RI7A 2K4DA 4CA1A 1RMDA 2LQ6A 3FJUB 4YBSA 1FBVA 4A4BA 2MT5A 2VNFA 4GB0A 4A0CD 5G04B 3DPLR 1XWHA 4YBMA 2LDRA 3RTRB 2H0DA 5LKZA 5I3LA 2F42A 2LGLA 4V3KC 1CHCA 3EB5A 3KDEC 3VK6A 1JM7B 2KYUA 2OWAA 2CRRA 2OXQC 5B76A 2XP0A 3I2DA 2P57A 1WE9A 3U5OA 5H1UA 4XI1A 4GNFA 4AYCA 4LJNA 3SHBA 2VJFA 5TRBA 5TBNA 2XOYA 5FEYA 2CRWA 2XB1A 2M3HA 2ECNA 1F62A 2JRJA 3KV6A 4AUQB 3DDTA 2L7PA 1WEOA 4PTBA 2LXHC 2FFWA 3M63A 2Y1NA 4FIPA 4FJCA 4QF3A 2VPDA 4BHWA 4IC2A 2VPEA 2YU4A 1WEMA 2CONA 2UZGA 2MNZA 4WZ0A 2E6RA 2LV9A 5KH3A 3O33A 2I50A 3FAOA 3PUQA 3GV4A 2IDAA 3O35A 4MSXA 1WEQA 2QIZA 1LDKC 3M7KA 5H1VA 3ZYQA 2K17A 2LXPC 4O64A 2VJEA 2NAAA 2YVRA 1HYIA 3LVRE 1DCQA 4FO9A 2H0DB 2M1RA 5C13A 4R7EA 3EB6A 2FUIA 2YHOA 2G43A 2K16A 1N87A 3ASLA 3KNVA 2KE1A 3LQJA 4ZUXU 1IYMA 3ZNIA 5TDWA 4MVTA 4PPEA 4R8PK 3N9OA 2KU3A 3U5PA 4ZQLA 3O70A 4AYCB 3LRQA 2VJFB 5DINA 2JMIA 5EYAF 2BAYA 4GNDA 4WZ2A 1BORA 3KV5A 4A4CA 3N9PA 2KWJA 2ECGA 5B78A 2EXUA 4CCGX 3ZVYA 3N9NA 5G0FA 5LKXA 4B86C 2F6NA 2JM3A 2KFTA 3HCTA 1T1HA 2KWKA 4FK5A 4QF2A 3ZPV1 1Z60A 3N9QA 2LGGA 2MA6A 3SOWA 3O47A 1Z6UA 2RSDA 5LKUA 4LK9A 4V3LC 2LRIC 4A49A 3FANA 1WGMA 3U5NA 4Z0RA 3RPGC 3Q1DA 2YUCA 2JMDA 2VJEB 4B7YC 3SOUA 5B77A 5D1MB 1ZBDB 2MNYA 2XOCA 2DSMA 2MKEA 2KGIA 5FB1A 3HCUA 5B79A 2FUUA 2YREA 2D8SA 4GNGA 1WENA 4AVXA 2G6QA 2YQMA 1VD4A 4W4UA 3MDBC 5B75A 2CSZA 3T9KA 5B8DA 3DWDA 3U5MA 1WFKA 1E4UA 2CT2A 2PNXA 4BBQA 3N9MA 2CSVA 3H7HA 4N4FA 3FM8C 2M6MA 2EODA 5AITA 3M62A 3N9LA 5KH7A
chains in the Genus database with same CATH topology
2YURA 3MHSA 5D1KB 1WEPA 1DVPA 2ZETC 2EGPA 3IHPA 5FB0A 2VPBA 4R2YA 4F52B 2VPGA 1MM3A 2YHNA 1WEWA 2KR4A 2MUMA 4UI9B 5KH9A 2FSAA 5JG6A 2ECTA 3O37A 3V43A 2KIZA 3QZVA 2ECWA 1VFYA 4YABA 2E6SA 4Q6FA 4WZ3B 4N3WA 2EA6A 5FERA 4LKAA 4P5OB 1Z2QA 2JMJA 2YSMA 3O34A 2Y43A 2HYED 4C9ZA 1WIMA 2PUYA 4AP4A 1K2FA 2MIQA 3PHDA 2QICA 4I7CA 2L0BA 2F6JA 1WEEA 2CKLA 2QJ0A 5LCWB 4L58A 2CSYA 5AIUA 3RPGB 3NG2A 4ZDTA 2KWNA 4YC9A 3O7AA 1X4UA 3HTKC 4S3OC 2LGKA 1V87A 3MHHA 2AN6A 2KREA 2YYRA 1X4JA 3DQVR 3M99A 4I7DA 3SOXA 1G25A 2HDPA 2Y1MA 5TDRA 5DKAA 2L75A 3T7LA 3C6WA 1MM2A 2G45A 2KGGA 4L7XA 4UP0A 5H9MA 4UP5A 3PURA 4TKPB 5TABA 2VP7A 3L1ZB 2ECJA 3ZVZB 2ECVA 4GNEA 4YADA 4WA6A 4X3GA 1VYXA 1U6GB 2M85A 5J3XA 2ECIA 2YQLA 2L5UA 4LADB 1JOCA 2MD7B 4YAXA 1JM7A 3L11A 3C5KA 2L80A 3GL6A 5H1TA 4I7BA 3O36A 3ZPVE 1WESA 2KWOA 1WILA 4YBTA 4NN2A 2YT5A 4IC3A 3ZTGA 3L1XA 1WEVA 1FP0A 2L43A 3HCSA 2XEUA 3FL2A 3T6RA 2LGVA 5G05B 2K1JA 2MD8C 4YATA 1X4IA 2CKLB 5C11A 4LLBA 1HYJA 2DX8A 2MA5A 1WEUA 2YSJA 4S3OB 3KQIA 1LDJB 3LQHA 2C2VS 2LN0A 5LKTA 3LQIA 2C2LA 5D1LB 2YW8A 2RI7A 2K4DA 4CA1A 1RMDA 2LQ6A 4YBSA 1FBVA 4A4BA 2MT5A 2VNFA 4GB0A 4A0CD 5G04B 3DPLR 1XWHA 4YBMA 2LDRA 3RTRB 2H0DA 5LKZA 5I3LA 2F42A 2LGLA 4V3KC 1CHCA 3EB5A 3VK6A 1JM7B 2KYUA 2OXQC 5B76A 3I2DA 1WE9A 3U5OA 5H1UA 4XI1A 4GNFA 4AYCA 4LJNA 3SHBA 2VJFA 5TRBA 5TBNA 5FEYA 2XB1A 2M3HA 2ECNA 1F62A 2JRJA 3KV6A 4AUQB 1WEOA 4PTBA 2LXHC 3M63A 2Y1NA 4FIPA 4FJCA 4QF3A 2VPDA 4BHWA 4IC2A 2VPEA 2YU4A 1WEMA 4WZ0A 2UZGA 2MNZA 2E6RA 2LV9A 5KH3A 3O33A 2I50A 3PUQA 3GV4A 2IDAA 3O35A 4MSXA 1WEQA 2QIZA 1LDKC 5H1VA 3ZYQA 2K17A 2LXPC 4O64A 2VJEA 2NAAA 1HYIA 4FO9A 2H0DB 2M1RA 5C13A 4R7EA 3EB6A 2FUIA 2YHOA 2G43A 2K16A 1N87A 3ASLA 3KNVA 2KE1A 3LQJA 4ZUXU 1IYMA 3ZNIA 5TDWA 4MVTA 4PPEA 4R8PK 3N9OA 2KU3A 3U5PA 4ZQLA 3O70A 4AYCB 3LRQA 2VJFB 5DINA 2JMIA 5EYAF 2BAYA 4GNDA 4WZ2A 1BORA 3KV5A 4A4CA 3N9PA 2KWJA 2ECGA 5B78A 4CCGX 3ZVYA 3N9NA 5G0FA 5LKXA 4B86C 2F6NA 2KFTA 3HCTA 1T1HA 2KWKA 4FK5A 4QF2A 3ZPV1 1Z60A 3N9QA 2LGGA 2MA6A 3SOWA 1Z6UA 2RSDA 5LKUA 4LK9A 4V3LC 2LRIC 4A49A 1WGMA 3U5NA 3RPGC 2YUCA 2JMDA 2VJEB 4B7YC 3SOUA 5B77A 5D1MB 1ZBDB 2MNYA 2KGIA 5FB1A 3HCUA 5B79A 2FUUA 2YREA 2D8SA 4GNGA 1WENA 4AVXA 2G6QA 2YQMA 1VD4A 4W4UA 5B75A 2CSZA 5B8DA 3U5MA 1WFKA 1E4UA 2CT2A 2PNXA 4BBQA 3N9MA 4N4FA 2M6MA 2EODA 5AITA 3M62A 3N9LA 5KH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUR A;  3MHS A;  5D1K B;  1WEP A;  1DVP A;  2ZET C;  2EGP A;  3IHP A;  5FB0 A;  2VPB A;  4R2Y A;  4F52 B;  2VPG A;  1MM3 A;  2YHN A;  1WEW A;  2KR4 A;  2MUM A;  4UI9 B;  5KH9 A;  2FSA A;  5JG6 A;  2ECT A;  3O37 A;  3V43 A;  2KIZ A;  3QZV A;  2ECW A;  1VFY A;  4YAB A;  2E6S A;  4Q6F A;  4WZ3 B;  4N3W A;  2EA6 A;  5FER A;  4LKA A;  4P5O B;  1Z2Q A;  2JMJ A;  2YSM A;  3O34 A;  2Y43 A;  2HYE D;  4C9Z A;  1WIM A;  2PUY A;  4AP4 A;  1K2F A;  2MIQ A;  3PHD A;  2QIC A;  4I7C A;  2L0B A;  2F6J A;  1WEE A;  2CKL A;  2QJ0 A;  5LCW B;  4L58 A;  2CSY A;  5AIU A;  3RPG B;  3NG2 A;  4ZDT A;  2KWN A;  4YC9 A;  3O7A A;  1X4U A;  3HTK C;  4S3O C;  2LGK A;  1V87 A;  3MHH A;  2AN6 A;  2KRE A;  2YYR A;  1X4J A;  3DQV R;  3M99 A;  4I7D A;  3SOX A;  1G25 A;  2HDP A;  2Y1M A;  5TDR A;  5DKA A;  2L75 A;  3T7L A;  3C6W A;  1MM2 A;  2G45 A;  2KGG A;  4L7X A;  4UP0 A;  5H9M A;  4UP5 A;  3PUR A;  4TKP B;  5TAB A;  2VP7 A;  3L1Z B;  2ECJ A;  3ZVZ B;  2ECV A;  4GNE A;  4YAD A;  4WA6 A;  4X3G A;  1VYX A;  1U6G B;  2M85 A;  5J3X A;  2ECI A;  2YQL A;  2L5U A;  4LAD B;  1JOC A;  2MD7 B;  4YAX A;  1JM7 A;  3L11 A;  3C5K A;  2L80 A;  3GL6 A;  5H1T A;  4I7B A;  3O36 A;  3ZPV E;  1WES A;  2KWO A;  1WIL A;  4YBT A;  4NN2 A;  2YT5 A;  4IC3 A;  3ZTG A;  3L1X A;  1WEV A;  1FP0 A;  2L43 A;  3HCS A;  2XEU A;  3FL2 A;  3T6R A;  2LGV A;  5G05 B;  2K1J A;  2MD8 C;  4YAT A;  1X4I A;  2CKL B;  5C11 A;  4LLB A;  1HYJ A;  2DX8 A;  2MA5 A;  1WEU A;  2YSJ A;  4S3O B;  3KQI A;  1LDJ B;  3LQH A;  2C2V S;  2LN0 A;  5LKT A;  3LQI A;  2C2L A;  5D1L B;  2YW8 A;  2RI7 A;  2K4D A;  4CA1 A;  1RMD A;  2LQ6 A;  4YBS A;  1FBV A;  4A4B A;  2MT5 A;  2VNF A;  4GB0 A;  4A0C D;  5G04 B;  3DPL R;  1XWH A;  4YBM A;  2LDR A;  3RTR B;  2H0D A;  5LKZ A;  5I3L A;  2F42 A;  2LGL A;  4V3K C;  1CHC A;  3EB5 A;  3VK6 A;  1JM7 B;  2KYU A;  2OXQ C;  5B76 A;  3I2D A;  1WE9 A;  3U5O A;  5H1U A;  4XI1 A;  4GNF A;  4AYC A;  4LJN A;  3SHB A;  2VJF A;  5TRB A;  5TBN A;  5FEY A;  2XB1 A;  2M3H A;  2ECN A;  1F62 A;  2JRJ A;  3KV6 A;  4AUQ B;  1WEO A;  4PTB A;  2LXH C;  3M63 A;  2Y1N A;  4FIP A;  4FJC A;  4QF3 A;  2VPD A;  4BHW A;  4IC2 A;  2VPE A;  2YU4 A;  1WEM A;  4WZ0 A;  2UZG A;  2MNZ A;  2E6R A;  2LV9 A;  5KH3 A;  3O33 A;  2I50 A;  3PUQ A;  3GV4 A;  2IDA A;  3O35 A;  4MSX A;  1WEQ A;  2QIZ A;  1LDK C;  5H1V A;  3ZYQ A;  2K17 A;  2LXP C;  4O64 A;  2VJE A;  2NAA A;  1HYI A;  4FO9 A;  2H0D B;  2M1R A;  5C13 A;  4R7E A;  3EB6 A;  2FUI A;  2YHO A;  2G43 A;  2K16 A;  1N87 A;  3ASL A;  3KNV A;  2KE1 A;  3LQJ A;  4ZUX U;  1IYM A;  3ZNI A;  5TDW A;  4MVT A;  4PPE A;  4R8P K;  3N9O A;  2KU3 A;  3U5P A;  4ZQL A;  3O70 A;  4AYC B;  3LRQ A;  2VJF B;  5DIN A;  2JMI A;  5EYA F;  2BAY A;  4GND A;  4WZ2 A;  1BOR A;  3KV5 A;  4A4C A;  3N9P A;  2KWJ A;  2ECG A;  5B78 A;  4CCG X;  3ZVY A;  3N9N A;  5G0F A;  5LKX A;  4B86 C;  2F6N A;  2KFT A;  3HCT A;  1T1H A;  2KWK A;  4FK5 A;  4QF2 A;  3ZPV 1;  1Z60 A;  3N9Q A;  2LGG A;  2MA6 A;  3SOW A;  1Z6U A;  2RSD A;  5LKU A;  4LK9 A;  4V3L C;  2LRI C;  4A49 A;  1WGM A;  3U5N A;  3RPG C;  2YUC A;  2JMD A;  2VJE B;  4B7Y C;  3SOU A;  5B77 A;  5D1M B;  1ZBD B;  2MNY A;  2KGI A;  5FB1 A;  3HCU A;  5B79 A;  2FUU A;  2YRE A;  2D8S A;  4GNG A;  1WEN A;  4AVX A;  2G6Q A;  2YQM A;  1VD4 A;  4W4U A;  5B75 A;  2CSZ A;  5B8D A;  3U5M A;  1WFK A;  1E4U A;  2CT2 A;  2PNX A;  4BBQ A;  3N9M A;  4N4F A;  2M6M A;  2EOD A;  5AIT A;  3M62 A;  3N9L A;  5KH7 A; 
#chains in the Genus database with same CATH topology
 2YUR A;  3MHS A;  5D1K B;  1WEP A;  1DVP A;  2ZET C;  2EGP A;  3IHP A;  5FB0 A;  2VPB A;  4R2Y A;  4F52 B;  2VPG A;  1MM3 A;  2YHN A;  1WEW A;  2KR4 A;  2MUM A;  4UI9 B;  5KH9 A;  2FSA A;  5JG6 A;  2ECT A;  3O37 A;  1MBM A;  3V43 A;  2KIZ A;  3QZV A;  2ECW A;  1VFY A;  4YAB A;  2E6S A;  4Q6F A;  4WZ3 B;  4N3W A;  5SVI A;  2EA6 A;  5FER A;  4P5O B;  4LKA A;  1Z2Q A;  2JMJ A;  2YSM A;  3O34 A;  2Y43 A;  2HYE D;  4OGE A;  4C9Z A;  1WIM A;  2PUY A;  3FEH A;  3PLW A;  4AP4 A;  1K2F A;  2MIQ A;  4H9D A;  3PHD A;  2QIC A;  4I7C A;  2EGM A;  2L0B A;  2F6J A;  1WEE A;  2CKL A;  2QJ0 A;  5LCW B;  4L58 A;  2CSY A;  5AIU A;  3RPG B;  3NG2 A;  4ZDT A;  3LDY A;  2KWN A;  4YC9 A;  3O7A A;  2E61 A;  1X4U A;  3HTK C;  4S3O C;  2LGK A;  1V87 A;  3MHH A;  2KKX A;  2AN6 A;  4F1P A;  2KRE A;  2YYR A;  4QQ4 A;  1X4J A;  3DQV R;  3M99 A;  4I7D A;  3SOX A;  1G25 A;  2HDP A;  5K3Q A;  2Y1M A;  5TDR A;  5DKA A;  2L75 A;  3T7L A;  4OGC A;  3C6W A;  1MM2 A;  2G45 A;  2KGG A;  4L7X A;  4UP0 A;  5H9M A;  4UP5 A;  3PUR A;  2D8U A;  4TKP B;  2DJA A;  5TAB A;  2VP7 A;  3L1Z B;  2ECJ A;  5SVY A;  4Z0O A;  3ZVZ B;  2ECV A;  4GNE A;  4YAD A;  4WA6 A;  4X3G A;  1VYX A;  1U6G B;  2M85 A;  5J3X A;  2ECI A;  2YQL A;  2L5U A;  4LAD B;  1JOC A;  2MD7 B;  2IQJ A;  4YAX A;  1JM7 A;  3L11 A;  3C5K A;  3JUE A;  2FD4 A;  2B0O E;  2L80 A;  3GL6 A;  5H1T A;  4I7B A;  3O36 A;  3E2D A;  3ZPV E;  1WES A;  2KWO A;  1WIL A;  4YBT A;  4NN2 A;  2YT5 A;  4IC3 A;  3ZTG A;  3L1X A;  1WEV A;  1FP0 A;  3SUB A;  5SVI B;  2L43 A;  3HCS A;  2XEU A;  2LAU A;  3LJU X;  3FL2 A;  3T6R A;  2LGV A;  5G05 B;  2K1J A;  2MD8 C;  4YAT A;  5SVX A;  1X4I A;  2M13 A;  2CKL B;  5C11 A;  4LLB A;  1HYJ A;  2RR4 A;  2DX8 A;  2MA5 A;  2XOZ A;  1WEU A;  2YSJ A;  4S3O B;  2JUN A;  3KQI A;  2KKY A;  1LDJ B;  3LQH A;  2C2V S;  2LN0 A;  5LKT A;  4O62 A;  3LQI A;  2C2L A;  5D1L B;  3LVQ E;  2YW8 A;  2RI7 A;  2K4D A;  4CA1 A;  1RMD A;  2LQ6 A;  3FJU B;  4YBS A;  1FBV A;  4A4B A;  2MT5 A;  2VNF A;  4GB0 A;  4A0C D;  5G04 B;  3DPL R;  1XWH A;  4YBM A;  2LDR A;  3RTR B;  2H0D A;  5LKZ A;  5I3L A;  2F42 A;  2LGL A;  4V3K C;  1CHC A;  3EB5 A;  3KDE C;  3VK6 A;  1JM7 B;  2KYU A;  2OWA A;  2CRR A;  2OXQ C;  5B76 A;  2XP0 A;  3I2D A;  2P57 A;  1WE9 A;  3U5O A;  5H1U A;  4XI1 A;  4GNF A;  4AYC A;  4LJN A;  3SHB A;  2VJF A;  5TRB A;  5TBN A;  2XOY A;  5FEY A;  2CRW A;  2XB1 A;  2M3H A;  2ECN A;  1F62 A;  2JRJ A;  3KV6 A;  4AUQ B;  3DDT A;  2L7P A;  1WEO A;  4PTB A;  2LXH C;  2FFW A;  3M63 A;  2Y1N A;  4FIP A;  4FJC A;  4QF3 A;  2VPD A;  4BHW A;  4IC2 A;  2VPE A;  2YU4 A;  1WEM A;  2CON A;  2UZG A;  2MNZ A;  4WZ0 A;  2E6R A;  2LV9 A;  5KH3 A;  3O33 A;  2I50 A;  3FAO A;  3PUQ A;  3GV4 A;  2IDA A;  3O35 A;  4MSX A;  1WEQ A;  2QIZ A;  1LDK C;  3M7K A;  5H1V A;  3ZYQ A;  2K17 A;  2LXP C;  4O64 A;  2VJE A;  2NAA A;  2YVR A;  1HYI A;  3LVR E;  1DCQ A;  4FO9 A;  2H0D B;  2M1R A;  5C13 A;  4R7E A;  3EB6 A;  2FUI A;  2YHO A;  2G43 A;  2K16 A;  1N87 A;  3ASL A;  3KNV A;  2KE1 A;  3LQJ A;  4ZUX U;  1IYM A;  3ZNI A;  5TDW A;  4MVT A;  4PPE A;  4R8P K;  3N9O A;  2KU3 A;  3U5P A;  4ZQL A;  3O70 A;  4AYC B;  3LRQ A;  2VJF B;  5DIN A;  2JMI A;  5EYA F;  2BAY A;  4GND A;  4WZ2 A;  1BOR A;  3KV5 A;  4A4C A;  3N9P A;  2KWJ A;  2ECG A;  5B78 A;  2EXU A;  4CCG X;  3ZVY A;  3N9N A;  5G0F A;  5LKX A;  4B86 C;  2F6N A;  2JM3 A;  2KFT A;  3HCT A;  1T1H A;  2KWK A;  4FK5 A;  4QF2 A;  3ZPV 1;  1Z60 A;  3N9Q A;  2LGG A;  2MA6 A;  3SOW A;  3O47 A;  1Z6U A;  2RSD A;  5LKU A;  4LK9 A;  4V3L C;  2LRI C;  4A49 A;  3FAN A;  1WGM A;  3U5N A;  4Z0R A;  3RPG C;  3Q1D A;  2YUC A;  2JMD A;  2VJE B;  4B7Y C;  3SOU A;  5B77 A;  5D1M B;  1ZBD B;  2MNY A;  2XOC A;  2DSM A;  2MKE A;  2KGI A;  5FB1 A;  3HCU A;  5B79 A;  2FUU A;  2YRE A;  2D8S A;  4GNG A;  1WEN A;  4AVX A;  2G6Q A;  2YQM A;  1VD4 A;  4W4U A;  3MDB C;  5B75 A;  2CSZ A;  3T9K A;  5B8D A;  3DWD A;  3U5M A;  1WFK A;  1E4U A;  2CT2 A;  2PNX A;  4BBQ A;  3N9M A;  2CSV A;  3H7H A;  4N4F A;  3FM8 C;  2M6M A;  2EOD A;  5AIT A;  3M62 A;  3N9L A;  5KH7 A; 
#chains in the Genus database with same CATH homology
 2YUR A;  3MHS A;  5D1K B;  1WEP A;  1DVP A;  2ZET C;  2EGP A;  3IHP A;  5FB0 A;  2VPB A;  4R2Y A;  4F52 B;  2VPG A;  1MM3 A;  2YHN A;  1WEW A;  2KR4 A;  2MUM A;  4UI9 B;  5KH9 A;  2FSA A;  5JG6 A;  2ECT A;  3O37 A;  3V43 A;  2KIZ A;  3QZV A;  2ECW A;  1VFY A;  4YAB A;  2E6S A;  4Q6F A;  4WZ3 B;  4N3W A;  2EA6 A;  5FER A;  4LKA A;  4P5O B;  1Z2Q A;  2JMJ A;  2YSM A;  3O34 A;  2Y43 A;  2HYE D;  4C9Z A;  1WIM A;  2PUY A;  4AP4 A;  1K2F A;  2MIQ A;  3PHD A;  2QIC A;  4I7C A;  2L0B A;  2F6J A;  1WEE A;  2CKL A;  2QJ0 A;  5LCW B;  4L58 A;  2CSY A;  5AIU A;  3RPG B;  3NG2 A;  4ZDT A;  2KWN A;  4YC9 A;  3O7A A;  1X4U A;  3HTK C;  4S3O C;  2LGK A;  1V87 A;  3MHH A;  2AN6 A;  2KRE A;  2YYR A;  1X4J A;  3DQV R;  3M99 A;  4I7D A;  3SOX A;  1G25 A;  2HDP A;  2Y1M A;  5TDR A;  5DKA A;  2L75 A;  3T7L A;  3C6W A;  1MM2 A;  2G45 A;  2KGG A;  4L7X A;  4UP0 A;  5H9M A;  4UP5 A;  3PUR A;  4TKP B;  5TAB A;  2VP7 A;  3L1Z B;  2ECJ A;  3ZVZ B;  2ECV A;  4GNE A;  4YAD A;  4WA6 A;  4X3G A;  1VYX A;  1U6G B;  2M85 A;  5J3X A;  2ECI A;  2YQL A;  2L5U A;  4LAD B;  1JOC A;  2MD7 B;  4YAX A;  1JM7 A;  3L11 A;  3C5K A;  2L80 A;  3GL6 A;  5H1T A;  4I7B A;  3O36 A;  3ZPV E;  1WES A;  2KWO A;  1WIL A;  4YBT A;  4NN2 A;  2YT5 A;  4IC3 A;  3ZTG A;  3L1X A;  1WEV A;  1FP0 A;  2L43 A;  3HCS A;  2XEU A;  3FL2 A;  3T6R A;  2LGV A;  5G05 B;  2K1J A;  2MD8 C;  4YAT A;  1X4I A;  2CKL B;  5C11 A;  4LLB A;  1HYJ A;  2DX8 A;  2MA5 A;  1WEU A;  2YSJ A;  4S3O B;  3KQI A;  1LDJ B;  3LQH A;  2C2V S;  2LN0 A;  5LKT A;  3LQI A;  2C2L A;  5D1L B;  2YW8 A;  2RI7 A;  2K4D A;  4CA1 A;  1RMD A;  2LQ6 A;  4YBS A;  1FBV A;  4A4B A;  2MT5 A;  2VNF A;  4GB0 A;  4A0C D;  5G04 B;  3DPL R;  1XWH A;  4YBM A;  2LDR A;  3RTR B;  2H0D A;  5LKZ A;  5I3L A;  2F42 A;  2LGL A;  4V3K C;  1CHC A;  3EB5 A;  3VK6 A;  1JM7 B;  2KYU A;  2OXQ C;  5B76 A;  3I2D A;  1WE9 A;  3U5O A;  5H1U A;  4XI1 A;  4GNF A;  4AYC A;  4LJN A;  3SHB A;  2VJF A;  5TRB A;  5TBN A;  5FEY A;  2XB1 A;  2M3H A;  2ECN A;  1F62 A;  2JRJ A;  3KV6 A;  4AUQ B;  1WEO A;  4PTB A;  2LXH C;  3M63 A;  2Y1N A;  4FIP A;  4FJC A;  4QF3 A;  2VPD A;  4BHW A;  4IC2 A;  2VPE A;  2YU4 A;  1WEM A;  4WZ0 A;  2UZG A;  2MNZ A;  2E6R A;  2LV9 A;  5KH3 A;  3O33 A;  2I50 A;  3PUQ A;  3GV4 A;  2IDA A;  3O35 A;  4MSX A;  1WEQ A;  2QIZ A;  1LDK C;  5H1V A;  3ZYQ A;  2K17 A;  2LXP C;  4O64 A;  2VJE A;  2NAA A;  1HYI A;  4FO9 A;  2H0D B;  2M1R A;  5C13 A;  4R7E A;  3EB6 A;  2FUI A;  2YHO A;  2G43 A;  2K16 A;  1N87 A;  3ASL A;  3KNV A;  2KE1 A;  3LQJ A;  4ZUX U;  1IYM A;  3ZNI A;  5TDW A;  4MVT A;  4PPE A;  4R8P K;  3N9O A;  2KU3 A;  3U5P A;  4ZQL A;  3O70 A;  4AYC B;  3LRQ A;  2VJF B;  5DIN A;  2JMI A;  5EYA F;  2BAY A;  4GND A;  4WZ2 A;  1BOR A;  3KV5 A;  4A4C A;  3N9P A;  2KWJ A;  2ECG A;  5B78 A;  4CCG X;  3ZVY A;  3N9N A;  5G0F A;  5LKX A;  4B86 C;  2F6N A;  2KFT A;  3HCT A;  1T1H A;  2KWK A;  4FK5 A;  4QF2 A;  3ZPV 1;  1Z60 A;  3N9Q A;  2LGG A;  2MA6 A;  3SOW A;  1Z6U A;  2RSD A;  5LKU A;  4LK9 A;  4V3L C;  2LRI C;  4A49 A;  1WGM A;  3U5N A;  3RPG C;  2YUC A;  2JMD A;  2VJE B;  4B7Y C;  3SOU A;  5B77 A;  5D1M B;  1ZBD B;  2MNY A;  2KGI A;  5FB1 A;  3HCU A;  5B79 A;  2FUU A;  2YRE A;  2D8S A;  4GNG A;  1WEN A;  4AVX A;  2G6Q A;  2YQM A;  1VD4 A;  4W4U A;  5B75 A;  2CSZ A;  5B8D A;  3U5M A;  1WFK A;  1E4U A;  2CT2 A;  2PNX A;  4BBQ A;  3N9M A;  4N4F A;  2M6M A;  2EOD A;  5AIT A;  3M62 A;  3N9L A;  5KH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...