2KWJA

Solution structures of the double phd fingers of human transcriptional protein dpf3 bound to a histone peptide containing acetylation at lysine 14
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
b'GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwjA00
2RSDA 1MM3A 5AIUA 2VJFB 3ASLA 5H1TA 4MVTA 2FUUA 5G05B 2HDPA 3KQIA 3N9QA 4PTBA 2YHOA 2L80A 3O35A 4UP0A 2CT2A 4NN2A 3KV5A 4QF2A 1WEQA 2F42A 2KU3A 5D1KB 5TDWA 4R8PK 2KYUA 1F62A 3N9NA 4I7BA 2D8SA 3U5NA 1N87A 2KR4A 2ECGA 1WFKA 2YW8A 4GB0A 3PUQA 2K17A 1VYXA 5JG6A 2LGVA 3HCUA 4L7XA 5D1LB 1VFYA 2LV9A 1IYMA 5H1UA 3ZNIA 3EB6A 5B75A 2VJFA 2L0BA 4R2YA 2LDRA 2KWOA 1WEUA 3V43A 3PURA 2L43A 2YU4A 2YUCA 3O70A 3ZVYA 3ZYQA 2L75A 2Y43A 4F52B 5C11A 5C13A 3HCTA 1U6GB 3N9OA 4XI1A 1BORA 2DX8A 2Y1NA 2MA6A 2LGGA 4FJCA 2JRJA 2I50A 1LDKC 1WGMA 4UP5A 4L58A 2KWJA 3GL6A 3N9MA 2H0DB 4FO9A 5DKAA 2LN0A 1FBVA 1WEWA 1X4JA 2YT5A 4X3GA 4CA1A 4AYCB 4AP4A 3FL2A 2LRIC 4LLBA 2C2VS 1WEVA 2YQLA 3I2DA 3KV6A 4N3WA 4QF3A 4YADA 1WE9A 3T6RA 3LQIA 4YBSA 3MHSA 1JOCA 1WEPA 5AITA 4O64A 2KWNA 2AN6A 4A4CA 2VJEB 2KGGA 5LKTA 2VPBA 2M1RA 2G43A 5H1VA 2F6NA 4YBMA 2YREA 5B76A 5LKUA 2MIQA 3SHBA 1WEMA 2H0DA 3HTKC 2M6MA 2IDAA 4LKAA 3DQVR 3C5KA 1JM7B 3C6WA 2MD7B 4AYCA 3ZPV1 2FUIA 4BHWA 2MT5A 5KH7A 4Q6FA 1X4IA 5B8DA 4YBTA 2LXPC 4ZUXU 2ECJA 5KH9A 1T1HA 2VJEA 5TABA 3U5OA 4S3OC 3O7AA 2LXHC 2JMJA 4LJNA 4P5OB 2ZETC 1RMDA 2K4DA 1VD4A 2M85A 4GNGA 1Z6UA 4FK5A 4LADB 3O34A 2MNYA 1JM7A 2MD8C 3M99A 3M62A 2YHNA 3SOWA 2LGLA 2MUMA 2LQ6A 5FERA 3ZVZB 3LQHA 3GV4A 4MSXA 5FEYA 4B7YC 1WEEA 2JMIA 5DINA 2KGIA 5LCWB 5G0FA 3KNVA 3LQJA 4GNFA 2G6QA 2UZGA 5B79A 5LKZA 2OXQC 1WESA 2RI7A 1X4UA 2QICA 2VNFA 3IHPA 3DPLR 2KFTA 4GNDA 4WZ3B 3L1ZB 1MM2A 2ECVA 3T7LA 3L1XA 2M3HA 5TDRA 1HYJA 4GNEA 2VPDA 5FB1A 3U5PA 2ECWA 2KREA 3VK6A 4A49A 5KH3A 1G25A 2KIZA 4ZDTA 4AUQB 2JMDA 3ZTGA 2CSZA 4A4BA 4YATA 3MHHA 1HYIA 2EGPA 2HYED 2XB1A 4PPEA 4YAXA 3ZPVE 3L11A 1WENA 2K16A 2ECNA 2LGKA 1XWHA 2VPEA 1LDJB 2BAYA 2L5UA 1WILA 5I3LA 3EB5A 2YSJA 5TRBA 4LK9A 3N9LA 1ZBDB 1DVPA 1WEOA 5FB0A 2C2LA 2EODA 2VP7A 4V3KC 3SOXA 3O33A 4WZ0A 4WZ2A 4R7EA 2MA5A 1CHCA 2YYRA 3HCSA 3O37A 2YQMA 3PHDA 2E6RA 3SOUA 4FIPA 3RTRB 2NAAA 3NG2A 5D1MB 2CKLB 4I7DA 4IC3A 3LRQA 4ZQLA 4CCGX 4S3OB 2F6JA 4IC2A 5B77A 2E6SA 3N9PA 4A0CD 2K1JA 4N4FA 3RPGC 2QIZA 5LKXA 2YSMA 3O36A 3QZVA 5B78A 5J3XA 4TKPB 2MNZA 4BBQA 4UI9B 3M63A 4WA6A 4YC9A 5EYAF 3RPGB 1E4UA 2CKLA 4B86C 2KWKA 2G45A 2ECIA 4AVXA 2FSAA 3U5MA 2PUYA 1Z2QA 2XEUA 4C9ZA 2KE1A 1Z60A 2PNXA 1WIMA 2YURA 5TBNA 5G04B 2EA6A 4I7CA 4W4UA 2CSYA 1FP0A 2Y1MA 1V87A 1K2FA 4YABA 4V3LC 2QJ0A 2VPGA 5H9MA 2ECTA
chains in the Genus database with same CATH superfamily
2RSDA 1MM3A 4O62A 5AIUA 2VJFB 3ASLA 5H1TA 4MVTA 2FUUA 5G05B 2HDPA 3KQIA 3N9QA 4PTBA 2YHOA 3FAOA 2L80A 3O35A 4UP0A 2CT2A 4NN2A 3KV5A 4QF2A 1WEQA 2F42A 2KU3A 5D1KB 5TDWA 4R8PK 2KYUA 1F62A 3N9NA 4I7BA 2D8SA 3U5NA 1N87A 2KR4A 2ECGA 1WFKA 2YW8A 4GB0A 3PUQA 2K17A 2OWAA 1VYXA 5JG6A 2LGVA 3HCUA 4L7XA 5D1LB 1VFYA 2LV9A 1IYMA 5H1UA 3ZNIA 3EB6A 5B75A 2VJFA 2L0BA 4R2YA 2LDRA 5K3QA 2KWOA 1WEUA 3V43A 3PURA 2L43A 2YU4A 4H9DA 2YUCA 3O70A 3ZVYA 3ZYQA 2L75A 2Y43A 4F52B 5C11A 5C13A 3LVQE 3HCTA 1U6GB 3N9OA 4XI1A 1BORA 2DX8A 2Y1NA 2MA6A 2LGGA 4FJCA 2JRJA 3M7KA 2I50A 1LDKC 1WGMA 2JM3A 3LDYA 3H7HA 4UP5A 4L58A 2KWJA 3FEHA 3GL6A 3N9MA 2XOCA 1MBMA 2H0DB 4FO9A 5DKAA 2LN0A 3Q1DA 5SVXA 1FBVA 1WEWA 1X4JA 2YT5A 4X3GA 4CA1A 4AYCB 2RR4A 4AP4A 3FL2A 2LRIC 4LLBA 5SVYA 2C2VS 1WEVA 2YQLA 4QQ4A 3I2DA 3KV6A 4N3WA 4QF3A 4YADA 1WE9A 3T6RA 3LQIA 4YBSA 3MHSA 1JOCA 1WEPA 5AITA 3MDBC 4O64A 2KWNA 3T9KA 2AN6A 4A4CA 2VJEB 2FD4A 2YVRA 2KGGA 5LKTA 2VPBA 2M1RA 2G43A 5H1VA 2F6NA 4YBMA 2YREA 5B76A 5LKUA 2MIQA 3SHBA 2IQJA 3PLWA 1WEMA 2CONA 2H0DA 3HTKC 2M6MA 2IDAA 4LKAA 3DQVR 3C5KA 4OGCA 1JM7B 3C6WA 2MD7B 4AYCA 3ZPV1 2FUIA 2CRRA 4BHWA 3FJUB 4Z0OA 2MT5A 5KH7A 4Q6FA 2KKXA 1X4IA 5B8DA 4YBTA 3E2DA 2LXPC 4ZUXU 2ECJA 5KH9A 2DJAA 2E61A 1T1HA 2DSMA 2VJEA 5TABA 3U5OA 4S3OC 3O7AA 2LXHC 2JMJA 4LJNA 2CSVA 4P5OB 2ZETC 1RMDA 4F1PA 2K4DA 1VD4A 2M85A 4GNGA 1Z6UA 4FK5A 4LADB 3O34A 2MNYA 1JM7A 2MD8C 3M99A 3M62A 2YHNA 3SOWA 2LGLA 2MUMA 2LQ6A 3LVRE 5FERA 3ZVZB 3LQHA 3GV4A 4MSXA 5FEYA 4B7YC 1WEEA 2JMIA 5DINA 2KGIA 5LCWB 5G0FA 3KDEC 2LAUA 3KNVA 3LQJA 2JUNA 2G6QA 2UZGA 4GNFA 5B79A 5LKZA 2OXQC 1WESA 2RI7A 1X4UA 2QICA 2VNFA 3IHPA 3DPLR 2EGMA 2KFTA 4GNDA 4WZ3B 3L1ZB 1MM2A 2ECVA 3T7LA 3L1XA 2M3HA 5TDRA 1HYJA 4GNEA 2VPDA 5FB1A 3U5PA 2ECWA 2KREA 3VK6A 4A49A 5KH3A 1G25A 2KIZA 4ZDTA 4AUQB 3FM8C 2JMDA 2MKEA 3ZTGA 2CSZA 4A4BA 4YATA 3MHHA 1HYIA 2EGPA 2HYED 2XB1A 4PPEA 4YAXA 3ZPVE 3L11A 4Z0RA 1WENA 2K16A 2ECNA 2LGKA 1XWHA 2VPEA 1LDJB 2KKYA 2BAYA 2L5UA 1WILA 5I3LA 2XOZA 3EB5A 2EXUA 2YSJA 5TRBA 4LK9A 3N9LA 1ZBDB 1DVPA 3SUBA 1WEOA 5FB0A 2C2LA 2EODA 2VP7A 4V3KC 3SOXA 3LJUX 3O33A 4WZ0A 2M13A 4WZ2A 4R7EA 2MA5A 1CHCA 2YYRA 3HCSA 3O37A 2YQMA 3PHDA 2E6RA 3SOUA 3DDTA 4FIPA 3RTRB 2NAAA 3NG2A 5D1MB 2CKLB 4I7DA 4IC3A 3LRQA 4ZQLA 2FFWA 4CCGX 4S3OB 2XOYA 2F6JA 5SVIB 4IC2A 5B77A 2E6SA 3N9PA 4A0CD 2K1JA 4N4FA 3RPGC 2QIZA 5LKXA 2XP0A 2YSMA 2CRWA 3O36A 3QZVA 5B78A 5J3XA 3FANA 4TKPB 2MNZA 4BBQA 2B0OE 4OGEA 4UI9B 3M63A 4WA6A 4YC9A 2P57A 5EYAF 2L7PA 3RPGB 1E4UA 2CKLA 4B86C 2KWKA 2G45A 2ECIA 4AVXA 2FSAA 3U5MA 2PUYA 2D8UA 1Z2QA 2XEUA 4C9ZA 2KE1A 5SVIA 3JUEA 1Z60A 2PNXA 1WIMA 2YURA 5TBNA 5G04B 2EA6A 4I7CA 4W4UA 2CSYA 1FP0A 2Y1MA 1V87A 1K2FA 3DWDA 4YABA 4V3LC 1DCQA 2QJ0A 2VPGA 5H9MA 3O47A 2ECTA
chains in the Genus database with same CATH topology
2RSDA 1MM3A 5AIUA 2VJFB 3ASLA 5H1TA 4MVTA 2FUUA 5G05B 2HDPA 3KQIA 3N9QA 4PTBA 2YHOA 2L80A 3O35A 4UP0A 2CT2A 4NN2A 3KV5A 4QF2A 1WEQA 2F42A 2KU3A 5D1KB 5TDWA 4R8PK 2KYUA 1F62A 3N9NA 4I7BA 2D8SA 3U5NA 1N87A 2KR4A 2ECGA 1WFKA 2YW8A 4GB0A 3PUQA 2K17A 1VYXA 5JG6A 2LGVA 3HCUA 4L7XA 5D1LB 1VFYA 2LV9A 1IYMA 5H1UA 3ZNIA 3EB6A 5B75A 2VJFA 2L0BA 4R2YA 2LDRA 2KWOA 1WEUA 3V43A 3PURA 2L43A 2YU4A 2YUCA 3O70A 3ZVYA 3ZYQA 2L75A 2Y43A 4F52B 5C11A 5C13A 3HCTA 1U6GB 3N9OA 4XI1A 1BORA 2DX8A 2Y1NA 2MA6A 2LGGA 4FJCA 2JRJA 2I50A 1LDKC 1WGMA 4UP5A 4L58A 2KWJA 3GL6A 3N9MA 2H0DB 4FO9A 5DKAA 2LN0A 1FBVA 1WEWA 1X4JA 2YT5A 4X3GA 4CA1A 4AYCB 4AP4A 3FL2A 2LRIC 4LLBA 2C2VS 1WEVA 2YQLA 3I2DA 3KV6A 4N3WA 4QF3A 4YADA 1WE9A 3T6RA 3LQIA 4YBSA 3MHSA 1JOCA 1WEPA 5AITA 4O64A 2KWNA 2AN6A 4A4CA 2VJEB 2KGGA 5LKTA 2VPBA 2M1RA 2G43A 5H1VA 2F6NA 4YBMA 2YREA 5B76A 5LKUA 2MIQA 3SHBA 1WEMA 2H0DA 3HTKC 2M6MA 2IDAA 4LKAA 3DQVR 3C5KA 1JM7B 3C6WA 2MD7B 4AYCA 3ZPV1 2FUIA 4BHWA 2MT5A 5KH7A 4Q6FA 1X4IA 5B8DA 4YBTA 2LXPC 4ZUXU 2ECJA 5KH9A 1T1HA 2VJEA 5TABA 3U5OA 4S3OC 3O7AA 2LXHC 2JMJA 4LJNA 4P5OB 2ZETC 1RMDA 2K4DA 1VD4A 2M85A 4GNGA 1Z6UA 4FK5A 4LADB 3O34A 2MNYA 1JM7A 2MD8C 3M99A 3M62A 2YHNA 3SOWA 2LGLA 2MUMA 2LQ6A 5FERA 3ZVZB 3LQHA 3GV4A 4MSXA 5FEYA 4B7YC 1WEEA 2JMIA 5DINA 2KGIA 5LCWB 5G0FA 3KNVA 3LQJA 4GNFA 2G6QA 2UZGA 5B79A 5LKZA 2OXQC 1WESA 2RI7A 1X4UA 2QICA 2VNFA 3IHPA 3DPLR 2KFTA 4GNDA 4WZ3B 3L1ZB 1MM2A 2ECVA 3T7LA 3L1XA 2M3HA 5TDRA 1HYJA 4GNEA 2VPDA 5FB1A 3U5PA 2ECWA 2KREA 3VK6A 4A49A 5KH3A 1G25A 2KIZA 4ZDTA 4AUQB 2JMDA 3ZTGA 2CSZA 4A4BA 4YATA 3MHHA 1HYIA 2EGPA 2HYED 2XB1A 4PPEA 4YAXA 3ZPVE 3L11A 1WENA 2K16A 2ECNA 2LGKA 1XWHA 2VPEA 1LDJB 2BAYA 2L5UA 1WILA 5I3LA 3EB5A 2YSJA 5TRBA 4LK9A 3N9LA 1ZBDB 1DVPA 1WEOA 5FB0A 2C2LA 2EODA 2VP7A 4V3KC 3SOXA 3O33A 4WZ0A 4WZ2A 4R7EA 2MA5A 1CHCA 2YYRA 3HCSA 3O37A 2YQMA 3PHDA 2E6RA 3SOUA 4FIPA 3RTRB 2NAAA 3NG2A 5D1MB 2CKLB 4I7DA 4IC3A 3LRQA 4ZQLA 4CCGX 4S3OB 2F6JA 4IC2A 5B77A 2E6SA 3N9PA 4A0CD 2K1JA 4N4FA 3RPGC 2QIZA 5LKXA 2YSMA 3O36A 3QZVA 5B78A 5J3XA 4TKPB 2MNZA 4BBQA 4UI9B 3M63A 4WA6A 4YC9A 5EYAF 3RPGB 1E4UA 2CKLA 4B86C 2KWKA 2G45A 2ECIA 4AVXA 2FSAA 3U5MA 2PUYA 1Z2QA 2XEUA 4C9ZA 2KE1A 1Z60A 2PNXA 1WIMA 2YURA 5TBNA 5G04B 2EA6A 4I7CA 4W4UA 2CSYA 1FP0A 2Y1MA 1V87A 1K2FA 4YABA 4V3LC 2QJ0A 2VPGA 5H9MA 2ECTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSD A;  1MM3 A;  5AIU A;  2VJF B;  3ASL A;  5H1T A;  4MVT A;  2FUU A;  5G05 B;  2HDP A;  3KQI A;  3N9Q A;  4PTB A;  2YHO A;  2L80 A;  3O35 A;  4UP0 A;  2CT2 A;  4NN2 A;  3KV5 A;  4QF2 A;  1WEQ A;  2F42 A;  2KU3 A;  5D1K B;  5TDW A;  4R8P K;  2KYU A;  1F62 A;  3N9N A;  4I7B A;  2D8S A;  3U5N A;  1N87 A;  2KR4 A;  2ECG A;  1WFK A;  2YW8 A;  4GB0 A;  3PUQ A;  2K17 A;  1VYX A;  5JG6 A;  2LGV A;  3HCU A;  4L7X A;  5D1L B;  1VFY A;  2LV9 A;  1IYM A;  5H1U A;  3ZNI A;  3EB6 A;  5B75 A;  2VJF A;  2L0B A;  4R2Y A;  2LDR A;  2KWO A;  1WEU A;  3V43 A;  3PUR A;  2L43 A;  2YU4 A;  2YUC A;  3O70 A;  3ZVY A;  3ZYQ A;  2L75 A;  2Y43 A;  4F52 B;  5C11 A;  5C13 A;  3HCT A;  1U6G B;  3N9O A;  4XI1 A;  1BOR A;  2DX8 A;  2Y1N A;  2MA6 A;  2LGG A;  4FJC A;  2JRJ A;  2I50 A;  1LDK C;  1WGM A;  4UP5 A;  4L58 A;  2KWJ A;  3GL6 A;  3N9M A;  2H0D B;  4FO9 A;  5DKA A;  2LN0 A;  1FBV A;  1WEW A;  1X4J A;  2YT5 A;  4X3G A;  4CA1 A;  4AYC B;  4AP4 A;  3FL2 A;  2LRI C;  4LLB A;  2C2V S;  1WEV A;  2YQL A;  3I2D A;  3KV6 A;  4N3W A;  4QF3 A;  4YAD A;  1WE9 A;  3T6R A;  3LQI A;  4YBS A;  3MHS A;  1JOC A;  1WEP A;  5AIT A;  4O64 A;  2KWN A;  2AN6 A;  4A4C A;  2VJE B;  2KGG A;  5LKT A;  2VPB A;  2M1R A;  2G43 A;  5H1V A;  2F6N A;  4YBM A;  2YRE A;  5B76 A;  5LKU A;  2MIQ A;  3SHB A;  1WEM A;  2H0D A;  3HTK C;  2M6M A;  2IDA A;  4LKA A;  3DQV R;  3C5K A;  1JM7 B;  3C6W A;  2MD7 B;  4AYC A;  3ZPV 1;  2FUI A;  4BHW A;  2MT5 A;  5KH7 A;  4Q6F A;  1X4I A;  5B8D A;  4YBT A;  2LXP C;  4ZUX U;  2ECJ A;  5KH9 A;  1T1H A;  2VJE A;  5TAB A;  3U5O A;  4S3O C;  3O7A A;  2LXH C;  2JMJ A;  4LJN A;  4P5O B;  2ZET C;  1RMD A;  2K4D A;  1VD4 A;  2M85 A;  4GNG A;  1Z6U A;  4FK5 A;  4LAD B;  3O34 A;  2MNY A;  1JM7 A;  2MD8 C;  3M99 A;  3M62 A;  2YHN A;  3SOW A;  2LGL A;  2MUM A;  2LQ6 A;  5FER A;  3ZVZ B;  3LQH A;  3GV4 A;  4MSX A;  5FEY A;  4B7Y C;  1WEE A;  2JMI A;  5DIN A;  2KGI A;  5LCW B;  5G0F A;  3KNV A;  3LQJ A;  4GNF A;  2G6Q A;  2UZG A;  5B79 A;  5LKZ A;  2OXQ C;  1WES A;  2RI7 A;  1X4U A;  2QIC A;  2VNF A;  3IHP A;  3DPL R;  2KFT A;  4GND A;  4WZ3 B;  3L1Z B;  1MM2 A;  2ECV A;  3T7L A;  3L1X A;  2M3H A;  5TDR A;  1HYJ A;  4GNE A;  2VPD A;  5FB1 A;  3U5P A;  2ECW A;  2KRE A;  3VK6 A;  4A49 A;  5KH3 A;  1G25 A;  2KIZ A;  4ZDT A;  4AUQ B;  2JMD A;  3ZTG A;  2CSZ A;  4A4B A;  4YAT A;  3MHH A;  1HYI A;  2EGP A;  2HYE D;  2XB1 A;  4PPE A;  4YAX A;  3ZPV E;  3L11 A;  1WEN A;  2K16 A;  2ECN A;  2LGK A;  1XWH A;  2VPE A;  1LDJ B;  2BAY A;  2L5U A;  1WIL A;  5I3L A;  3EB5 A;  2YSJ A;  5TRB A;  4LK9 A;  3N9L A;  1ZBD B;  1DVP A;  1WEO A;  5FB0 A;  2C2L A;  2EOD A;  2VP7 A;  4V3K C;  3SOX A;  3O33 A;  4WZ0 A;  4WZ2 A;  4R7E A;  2MA5 A;  1CHC A;  2YYR A;  3HCS A;  3O37 A;  2YQM A;  3PHD A;  2E6R A;  3SOU A;  4FIP A;  3RTR B;  2NAA A;  3NG2 A;  5D1M B;  2CKL B;  4I7D A;  4IC3 A;  3LRQ A;  4ZQL A;  4CCG X;  4S3O B;  2F6J A;  4IC2 A;  5B77 A;  2E6S A;  3N9P A;  4A0C D;  2K1J A;  4N4F A;  3RPG C;  2QIZ A;  5LKX A;  2YSM A;  3O36 A;  3QZV A;  5B78 A;  5J3X A;  4TKP B;  2MNZ A;  4BBQ A;  4UI9 B;  3M63 A;  4WA6 A;  4YC9 A;  5EYA F;  3RPG B;  1E4U A;  2CKL A;  4B86 C;  2KWK A;  2G45 A;  2ECI A;  4AVX A;  2FSA A;  3U5M A;  2PUY A;  1Z2Q A;  2XEU A;  4C9Z A;  2KE1 A;  1Z60 A;  2PNX A;  1WIM A;  2YUR A;  5TBN A;  5G04 B;  2EA6 A;  4I7C A;  4W4U A;  2CSY A;  1FP0 A;  2Y1M A;  1V87 A;  1K2F A;  4YAB A;  4V3L C;  2QJ0 A;  2VPG A;  5H9M A;  2ECT A; 
#chains in the Genus database with same CATH topology
 2RSD A;  1MM3 A;  4O62 A;  5AIU A;  2VJF B;  3ASL A;  5H1T A;  4MVT A;  2FUU A;  5G05 B;  2HDP A;  3KQI A;  3N9Q A;  4PTB A;  2YHO A;  3FAO A;  2L80 A;  3O35 A;  4UP0 A;  2CT2 A;  4NN2 A;  3KV5 A;  4QF2 A;  1WEQ A;  2F42 A;  2KU3 A;  5D1K B;  5TDW A;  4R8P K;  2KYU A;  1F62 A;  3N9N A;  4I7B A;  2D8S A;  3U5N A;  1N87 A;  2KR4 A;  2ECG A;  1WFK A;  2YW8 A;  4GB0 A;  3PUQ A;  2K17 A;  2OWA A;  1VYX A;  5JG6 A;  2LGV A;  3HCU A;  4L7X A;  5D1L B;  1VFY A;  2LV9 A;  1IYM A;  5H1U A;  3ZNI A;  3EB6 A;  5B75 A;  2VJF A;  2L0B A;  4R2Y A;  2LDR A;  5K3Q A;  2KWO A;  1WEU A;  3V43 A;  3PUR A;  2L43 A;  2YU4 A;  4H9D A;  2YUC A;  3O70 A;  3ZVY A;  3ZYQ A;  2L75 A;  2Y43 A;  4F52 B;  5C11 A;  5C13 A;  3LVQ E;  3HCT A;  1U6G B;  3N9O A;  4XI1 A;  1BOR A;  2DX8 A;  2Y1N A;  2MA6 A;  2LGG A;  4FJC A;  2JRJ A;  3M7K A;  2I50 A;  1LDK C;  1WGM A;  2JM3 A;  3LDY A;  3H7H A;  4UP5 A;  4L58 A;  2KWJ A;  3FEH A;  3GL6 A;  3N9M A;  2XOC A;  1MBM A;  2H0D B;  4FO9 A;  5DKA A;  2LN0 A;  3Q1D A;  5SVX A;  1FBV A;  1WEW A;  1X4J A;  2YT5 A;  4X3G A;  4CA1 A;  4AYC B;  2RR4 A;  4AP4 A;  3FL2 A;  2LRI C;  4LLB A;  5SVY A;  2C2V S;  1WEV A;  2YQL A;  4QQ4 A;  3I2D A;  3KV6 A;  4N3W A;  4QF3 A;  4YAD A;  1WE9 A;  3T6R A;  3LQI A;  4YBS A;  3MHS A;  1JOC A;  1WEP A;  5AIT A;  3MDB C;  4O64 A;  2KWN A;  3T9K A;  2AN6 A;  4A4C A;  2VJE B;  2FD4 A;  2YVR A;  2KGG A;  5LKT A;  2VPB A;  2M1R A;  2G43 A;  5H1V A;  2F6N A;  4YBM A;  2YRE A;  5B76 A;  5LKU A;  2MIQ A;  3SHB A;  2IQJ A;  3PLW A;  1WEM A;  2CON A;  2H0D A;  3HTK C;  2M6M A;  2IDA A;  4LKA A;  3DQV R;  3C5K A;  4OGC A;  1JM7 B;  3C6W A;  2MD7 B;  4AYC A;  3ZPV 1;  2FUI A;  2CRR A;  4BHW A;  3FJU B;  4Z0O A;  2MT5 A;  5KH7 A;  4Q6F A;  2KKX A;  1X4I A;  5B8D A;  4YBT A;  3E2D A;  2LXP C;  4ZUX U;  2ECJ A;  5KH9 A;  2DJA A;  2E61 A;  1T1H A;  2DSM A;  2VJE A;  5TAB A;  3U5O A;  4S3O C;  3O7A A;  2LXH C;  2JMJ A;  4LJN A;  2CSV A;  4P5O B;  2ZET C;  1RMD A;  4F1P A;  2K4D A;  1VD4 A;  2M85 A;  4GNG A;  1Z6U A;  4FK5 A;  4LAD B;  3O34 A;  2MNY A;  1JM7 A;  2MD8 C;  3M99 A;  3M62 A;  2YHN A;  3SOW A;  2LGL A;  2MUM A;  2LQ6 A;  3LVR E;  5FER A;  3ZVZ B;  3LQH A;  3GV4 A;  4MSX A;  5FEY A;  4B7Y C;  1WEE A;  2JMI A;  5DIN A;  2KGI A;  5LCW B;  5G0F A;  3KDE C;  2LAU A;  3KNV A;  3LQJ A;  2JUN A;  2G6Q A;  2UZG A;  4GNF A;  5B79 A;  5LKZ A;  2OXQ C;  1WES A;  2RI7 A;  1X4U A;  2QIC A;  2VNF A;  3IHP A;  3DPL R;  2EGM A;  2KFT A;  4GND A;  4WZ3 B;  3L1Z B;  1MM2 A;  2ECV A;  3T7L A;  3L1X A;  2M3H A;  5TDR A;  1HYJ A;  4GNE A;  2VPD A;  5FB1 A;  3U5P A;  2ECW A;  2KRE A;  3VK6 A;  4A49 A;  5KH3 A;  1G25 A;  2KIZ A;  4ZDT A;  4AUQ B;  3FM8 C;  2JMD A;  2MKE A;  3ZTG A;  2CSZ A;  4A4B A;  4YAT A;  3MHH A;  1HYI A;  2EGP A;  2HYE D;  2XB1 A;  4PPE A;  4YAX A;  3ZPV E;  3L11 A;  4Z0R A;  1WEN A;  2K16 A;  2ECN A;  2LGK A;  1XWH A;  2VPE A;  1LDJ B;  2KKY A;  2BAY A;  2L5U A;  1WIL A;  5I3L A;  2XOZ A;  3EB5 A;  2EXU A;  2YSJ A;  5TRB A;  4LK9 A;  3N9L A;  1ZBD B;  1DVP A;  3SUB A;  1WEO A;  5FB0 A;  2C2L A;  2EOD A;  2VP7 A;  4V3K C;  3SOX A;  3LJU X;  3O33 A;  4WZ0 A;  2M13 A;  4WZ2 A;  4R7E A;  2MA5 A;  1CHC A;  2YYR A;  3HCS A;  3O37 A;  2YQM A;  3PHD A;  2E6R A;  3SOU A;  3DDT A;  4FIP A;  3RTR B;  2NAA A;  3NG2 A;  5D1M B;  2CKL B;  4I7D A;  4IC3 A;  3LRQ A;  4ZQL A;  2FFW A;  4CCG X;  4S3O B;  2XOY A;  2F6J A;  5SVI B;  4IC2 A;  5B77 A;  2E6S A;  3N9P A;  4A0C D;  2K1J A;  4N4F A;  3RPG C;  2QIZ A;  5LKX A;  2XP0 A;  2YSM A;  2CRW A;  3O36 A;  3QZV A;  5B78 A;  5J3X A;  3FAN A;  4TKP B;  2MNZ A;  4BBQ A;  2B0O E;  4OGE A;  4UI9 B;  3M63 A;  4WA6 A;  4YC9 A;  2P57 A;  5EYA F;  2L7P A;  3RPG B;  1E4U A;  2CKL A;  4B86 C;  2KWK A;  2G45 A;  2ECI A;  4AVX A;  2FSA A;  3U5M A;  2PUY A;  2D8U A;  1Z2Q A;  2XEU A;  4C9Z A;  2KE1 A;  5SVI A;  3JUE A;  1Z60 A;  2PNX A;  1WIM A;  2YUR A;  5TBN A;  5G04 B;  2EA6 A;  4I7C A;  4W4U A;  2CSY A;  1FP0 A;  2Y1M A;  1V87 A;  1K2F A;  3DWD A;  4YAB A;  4V3L C;  1DCQ A;  2QJ0 A;  2VPG A;  5H9M A;  3O47 A;  2ECT A; 
#chains in the Genus database with same CATH homology
 2RSD A;  1MM3 A;  5AIU A;  2VJF B;  3ASL A;  5H1T A;  4MVT A;  2FUU A;  5G05 B;  2HDP A;  3KQI A;  3N9Q A;  4PTB A;  2YHO A;  2L80 A;  3O35 A;  4UP0 A;  2CT2 A;  4NN2 A;  3KV5 A;  4QF2 A;  1WEQ A;  2F42 A;  2KU3 A;  5D1K B;  5TDW A;  4R8P K;  2KYU A;  1F62 A;  3N9N A;  4I7B A;  2D8S A;  3U5N A;  1N87 A;  2KR4 A;  2ECG A;  1WFK A;  2YW8 A;  4GB0 A;  3PUQ A;  2K17 A;  1VYX A;  5JG6 A;  2LGV A;  3HCU A;  4L7X A;  5D1L B;  1VFY A;  2LV9 A;  1IYM A;  5H1U A;  3ZNI A;  3EB6 A;  5B75 A;  2VJF A;  2L0B A;  4R2Y A;  2LDR A;  2KWO A;  1WEU A;  3V43 A;  3PUR A;  2L43 A;  2YU4 A;  2YUC A;  3O70 A;  3ZVY A;  3ZYQ A;  2L75 A;  2Y43 A;  4F52 B;  5C11 A;  5C13 A;  3HCT A;  1U6G B;  3N9O A;  4XI1 A;  1BOR A;  2DX8 A;  2Y1N A;  2MA6 A;  2LGG A;  4FJC A;  2JRJ A;  2I50 A;  1LDK C;  1WGM A;  4UP5 A;  4L58 A;  2KWJ A;  3GL6 A;  3N9M A;  2H0D B;  4FO9 A;  5DKA A;  2LN0 A;  1FBV A;  1WEW A;  1X4J A;  2YT5 A;  4X3G A;  4CA1 A;  4AYC B;  4AP4 A;  3FL2 A;  2LRI C;  4LLB A;  2C2V S;  1WEV A;  2YQL A;  3I2D A;  3KV6 A;  4N3W A;  4QF3 A;  4YAD A;  1WE9 A;  3T6R A;  3LQI A;  4YBS A;  3MHS A;  1JOC A;  1WEP A;  5AIT A;  4O64 A;  2KWN A;  2AN6 A;  4A4C A;  2VJE B;  2KGG A;  5LKT A;  2VPB A;  2M1R A;  2G43 A;  5H1V A;  2F6N A;  4YBM A;  2YRE A;  5B76 A;  5LKU A;  2MIQ A;  3SHB A;  1WEM A;  2H0D A;  3HTK C;  2M6M A;  2IDA A;  4LKA A;  3DQV R;  3C5K A;  1JM7 B;  3C6W A;  2MD7 B;  4AYC A;  3ZPV 1;  2FUI A;  4BHW A;  2MT5 A;  5KH7 A;  4Q6F A;  1X4I A;  5B8D A;  4YBT A;  2LXP C;  4ZUX U;  2ECJ A;  5KH9 A;  1T1H A;  2VJE A;  5TAB A;  3U5O A;  4S3O C;  3O7A A;  2LXH C;  2JMJ A;  4LJN A;  4P5O B;  2ZET C;  1RMD A;  2K4D A;  1VD4 A;  2M85 A;  4GNG A;  1Z6U A;  4FK5 A;  4LAD B;  3O34 A;  2MNY A;  1JM7 A;  2MD8 C;  3M99 A;  3M62 A;  2YHN A;  3SOW A;  2LGL A;  2MUM A;  2LQ6 A;  5FER A;  3ZVZ B;  3LQH A;  3GV4 A;  4MSX A;  5FEY A;  4B7Y C;  1WEE A;  2JMI A;  5DIN A;  2KGI A;  5LCW B;  5G0F A;  3KNV A;  3LQJ A;  4GNF A;  2G6Q A;  2UZG A;  5B79 A;  5LKZ A;  2OXQ C;  1WES A;  2RI7 A;  1X4U A;  2QIC A;  2VNF A;  3IHP A;  3DPL R;  2KFT A;  4GND A;  4WZ3 B;  3L1Z B;  1MM2 A;  2ECV A;  3T7L A;  3L1X A;  2M3H A;  5TDR A;  1HYJ A;  4GNE A;  2VPD A;  5FB1 A;  3U5P A;  2ECW A;  2KRE A;  3VK6 A;  4A49 A;  5KH3 A;  1G25 A;  2KIZ A;  4ZDT A;  4AUQ B;  2JMD A;  3ZTG A;  2CSZ A;  4A4B A;  4YAT A;  3MHH A;  1HYI A;  2EGP A;  2HYE D;  2XB1 A;  4PPE A;  4YAX A;  3ZPV E;  3L11 A;  1WEN A;  2K16 A;  2ECN A;  2LGK A;  1XWH A;  2VPE A;  1LDJ B;  2BAY A;  2L5U A;  1WIL A;  5I3L A;  3EB5 A;  2YSJ A;  5TRB A;  4LK9 A;  3N9L A;  1ZBD B;  1DVP A;  1WEO A;  5FB0 A;  2C2L A;  2EOD A;  2VP7 A;  4V3K C;  3SOX A;  3O33 A;  4WZ0 A;  4WZ2 A;  4R7E A;  2MA5 A;  1CHC A;  2YYR A;  3HCS A;  3O37 A;  2YQM A;  3PHD A;  2E6R A;  3SOU A;  4FIP A;  3RTR B;  2NAA A;  3NG2 A;  5D1M B;  2CKL B;  4I7D A;  4IC3 A;  3LRQ A;  4ZQL A;  4CCG X;  4S3O B;  2F6J A;  4IC2 A;  5B77 A;  2E6S A;  3N9P A;  4A0C D;  2K1J A;  4N4F A;  3RPG C;  2QIZ A;  5LKX A;  2YSM A;  3O36 A;  3QZV A;  5B78 A;  5J3X A;  4TKP B;  2MNZ A;  4BBQ A;  4UI9 B;  3M63 A;  4WA6 A;  4YC9 A;  5EYA F;  3RPG B;  1E4U A;  2CKL A;  4B86 C;  2KWK A;  2G45 A;  2ECI A;  4AVX A;  2FSA A;  3U5M A;  2PUY A;  1Z2Q A;  2XEU A;  4C9Z A;  2KE1 A;  1Z60 A;  2PNX A;  1WIM A;  2YUR A;  5TBN A;  5G04 B;  2EA6 A;  4I7C A;  4W4U A;  2CSY A;  1FP0 A;  2Y1M A;  1V87 A;  1K2F A;  4YAB A;  4V3L C;  2QJ0 A;  2VPG A;  5H9M A;  2ECT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...