2VJFB

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
EDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the Mdm2/Mdmx Ring Domain Heterodimer Reveals Dimerization is Required for Their Ubiquitylation in Trans.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjfB00
2ECJA 5H1TA 3ASLA 4YC9A 3SOWA 3M63A 5B78A 1WESA 5B79A 3L11A 5TABA 1Z2QA 5D1MB 2YU4A 2ECGA 2RSDA 4FO9A 1N87A 2MIQA 2CKLB 3O7AA 1XWHA 2FUUA 2YSMA 2OXQC 3KV6A 1MM2A 1WEWA 2FSAA 2JMIA 2KGIA 4W4UA 2C2VS 4R2YA 2ECWA 1CHCA 1WEUA 2CSZA 5FERA 1WEVA 2H0DA 2JMDA 3HCSA 3PURA 2YT5A 3RPGB 2VJEA 4MSXA 3DPLR 2E6RA 3I2DA 4QF2A 1JM7B 2JMJA 4AYCA 3N9LA 2LRIC 3PUQA 3KV5A 3SOXA 5LCWB 2EODA 3KQIA 5B76A 4R7EA 5D1KB 5DKAA 5C11A 2M1RA 2VP7A 2UZGA 3LQJA 1FBVA 4WA6A 2K16A 2F6JA 4YBSA 2MUMA 4CA1A 1LDKC 1HYIA 2KR4A 3N9QA 2K1JA 2G43A 2AN6A 3ZPV1 4UP0A 1V87A 4A0CD 2MNZA 2C2LA 5H1UA 4I7BA 4XI1A 2BAYA 4I7DA 4ZQLA 1WIMA 2MD8C 4R8PK 4AP4A 3M99A 3ZYQA 3RTRB 1WE9A 2K17A 1X4JA 1WGMA 2H0DB 4L58A 2VJEB 5LKTA 3LQHA 5LKUA 2KWNA 5B8DA 2KYUA 2KU3A 2MA5A 5B77A 5DINA 2XB1A 2KWJA 2M85A 2CT2A 2LV9A 4LADB 4LJNA 2VJFB 5FB1A 1MM3A 4GNDA 3O34A 5JG6A 4PPEA 2HDPA 4WZ0A 2VPGA 1WFKA 2JRJA 3N9NA 3QZVA 1FP0A 2F42A 4FJCA 2L5UA 5G05B 3ZNIA 2PUYA 3N9OA 4Q6FA 4LK9A 3N9MA 4YAXA 4YBMA 2LDRA 1WEPA 2YUCA 4B7YC 4S3OB 3U5MA 3T6RA 4YBTA 5TDRA 4O64A 5J3XA 2YHNA 1VD4A 4A4BA 2MA6A 4WZ2A 2VPDA 2KWKA 1WEOA 2Y1NA 1WEQA 4TKPB 2M6MA 5H1VA 3T7LA 2G45A 4FIPA 5TDWA 3GL6A 2YQMA 2LXHC 1VFYA 2IDAA 3MHSA 3O33A 3DQVR 5KH7A 2QIZA 3LQIA 2MD7B 1F62A 3VK6A 1DVPA 2D8SA 2Y1MA 5KH9A 5EYAF 2ZETC 1JOCA 3C5KA 4PTBA 4ZUXU 2F6NA 3ZTGA 2M3HA 1X4IA 2KFTA 4YATA 5G0FA 5FEYA 3U5NA 4YADA 3ZVYA 2KWOA 4FK5A 5AITA 2L75A 1WEMA 3RPGC 3GV4A 5B75A 2LGLA 3ZVZB 2L43A 4WZ3B 1LDJB 3M62A 3HCUA 4X3GA 4AYCB 1HYJA 2YHOA 3NG2A 4BBQA 4GB0A 2YW8A 3O35A 2KIZA 4GNEA 3U5OA 4N4FA 2L0BA 2Y43A 5LKXA 3ZPVE 5TBNA 5C13A 3EB6A 2I50A 2EA6A 3KNVA 4V3KC 4CCGX 1Z60A 4BHWA 2EGPA 2K4DA 5G04B 4V3LC 5D1LB 2QJ0A 4IC3A 3EB5A 4AVXA 1RMDA 4L7XA 3SHBA 1BORA 2NAAA 2VPBA 3HCTA 3MHHA 4I7CA 2YREA 4P5OB 3SOUA 4F52B 4UI9B 5H9MA 2ECVA 2RI7A 2LGKA 2DX8A 5TRBA 1U6GB 1ZBDB 4AUQB 3L1XA 4UP5A 5AIUA 3PHDA 2LGVA 3O37A 2ECTA 2G6QA 1T1HA 5LKZA 2L80A 2VPEA 4A4CA 3N9PA 2YQLA 1E4UA 4GNFA 1K2FA 2PNXA 2QICA 2MNYA 4C9ZA 2MT5A 3O70A 1VYXA 2CSYA 3V43A 1Z6UA 2LXPC 5FB0A 2VJFA 2LN0A 5I3LA 1X4UA 2E6SA 2ECIA 4N3WA 2LQ6A 3LRQA 3IHPA 2CKLA 4QF3A 1WEEA 3C6WA 4S3OC 4B86C 2FUIA 4NN2A 5KH3A 2YURA 3FL2A 3U5PA 1WENA 3HTKC 4GNGA 2KE1A 4ZDTA 2KGGA 3O36A 4A49A 2LGGA 2HYED 4LKAA 4LLBA 2VNFA 4MVTA 1IYMA 1G25A 2KREA 4IC2A 3L1ZB 1JM7A 4YABA 2ECNA 2YSJA 1WILA 2XEUA 2YYRA
chains in the Genus database with same CATH superfamily
2ECJA 5H1TA 3ASLA 4YC9A 3FANA 2FFWA 3SOWA 3M63A 5B78A 1WESA 5B79A 3L11A 5TABA 1Z2QA 5D1MB 2YU4A 2ECGA 2RSDA 4FO9A 1N87A 3LVQE 2MIQA 2CKLB 3O7AA 1XWHA 2FUUA 2YSMA 3FJUB 2OXQC 3JUEA 3KV6A 1MM2A 1WEWA 2FSAA 2DJAA 2IQJA 2JMIA 3FM8C 2KGIA 4W4UA 2C2VS 4R2YA 2ECWA 1CHCA 4F1PA 1WEUA 2CSZA 5FERA 1WEVA 2CRRA 2H0DA 2JMDA 3HCSA 3PURA 2YT5A 3RPGB 2VJEA 4MSXA 1DCQA 3DPLR 2E6RA 3I2DA 4QF2A 2D8UA 3LVRE 2YVRA 1JM7B 2JMJA 4AYCA 3N9LA 2LRIC 3PUQA 3KV5A 3SOXA 5LCWB 2EODA 3KQIA 5B76A 4R7EA 5D1KB 5DKAA 2CONA 5C11A 2M1RA 2KKYA 2VP7A 4Z0RA 2UZGA 3LQJA 1FBVA 4WA6A 2K16A 5SVXA 2F6JA 4YBSA 2MUMA 4CA1A 1LDKC 1HYIA 2KR4A 3N9QA 2K1JA 2G43A 2AN6A 3ZPV1 4UP0A 1V87A 4A0CD 2MNZA 2C2LA 3Q1DA 5H1UA 4I7BA 2EGMA 2BAYA 2CSVA 4XI1A 4I7DA 4ZQLA 1WIMA 2MD8C 4R8PK 2MKEA 3M99A 4AP4A 2RR4A 3ZYQA 3RTRB 1WE9A 2K17A 1X4JA 1WGMA 2H0DB 3FAOA 4L58A 2VJEB 5LKTA 3LQHA 5LKUA 2KWNA 5B8DA 2KYUA 3SUBA 2KU3A 2MA5A 2XOZA 4QQ4A 5B77A 5DINA 2OWAA 2XB1A 2KWJA 2M85A 2CT2A 2LV9A 4LADB 4LJNA 2VJFB 5FB1A 1MM3A 4GNDA 3O34A 5JG6A 4PPEA 2HDPA 4WZ0A 2VPGA 1WFKA 2JRJA 3N9NA 3QZVA 1FP0A 2F42A 4FJCA 2L5UA 5G05B 3ZNIA 2PUYA 3N9OA 2B0OE 4Q6FA 4LK9A 3N9MA 4YAXA 4YBMA 2LDRA 1WEPA 2YUCA 4OGEA 4S3OB 4B7YC 3U5MA 3O47A 3T6RA 4YBTA 5TDRA 4O64A 5J3XA 2YHNA 1VD4A 4A4BA 2MA6A 4WZ2A 2VPDA 2KWKA 3MDBC 1WEOA 2Y1NA 1WEQA 4TKPB 2M6MA 5H1VA 3T7LA 2G45A 4FIPA 5TDWA 3GL6A 2YQMA 2LXHC 2KKXA 1VFYA 2IDAA 3MHSA 3O33A 3DQVR 5KH7A 2QIZA 3LQIA 2MD7B 1F62A 5SVIA 3VK6A 1DVPA 2D8SA 2Y1MA 5KH9A 5EYAF 2ZETC 1JOCA 3C5KA 4PTBA 3DWDA 2F6NA 4ZUXU 3ZTGA 3FEHA 2M3HA 1X4IA 2LAUA 2KFTA 2M13A 4YATA 5G0FA 5FEYA 3U5NA 4YADA 3ZVYA 2KWOA 4FK5A 5AITA 2L75A 1WEMA 3RPGC 3GV4A 5B75A 2LGLA 3ZVZB 2L43A 4WZ3B 3LJUX 1LDJB 3M62A 4O62A 3HCUA 4X3GA 4AYCB 1HYJA 4H9DA 2YHOA 3NG2A 4BBQA 4GB0A 2YW8A 3O35A 2KIZA 4GNEA 3DDTA 3U5OA 2JM3A 4N4FA 2L0BA 2Y43A 5LKXA 3ZPVE 5TBNA 5C13A 3EB6A 2I50A 2EA6A 3KNVA 2XOCA 2P57A 4V3KC 4CCGX 1Z60A 4OGCA 4BHWA 2EGPA 2K4DA 5G04B 5SVIB 4V3LC 5D1LB 2QJ0A 4IC3A 3EB5A 4AVXA 1RMDA 2XP0A 4L7XA 3SHBA 2JUNA 1BORA 2NAAA 2VPBA 3HCTA 3MHHA 4I7CA 2YREA 4P5OB 3SOUA 4F52B 4UI9B 5H9MA 3M7KA 2ECVA 2RI7A 2LGKA 2DX8A 3PLWA 5TRBA 1U6GB 1ZBDB 4AUQB 2FD4A 3L1XA 4UP5A 5AIUA 3PHDA 2LGVA 3O37A 2ECTA 2G6QA 1T1HA 5LKZA 2L80A 2VPEA 4A4CA 3N9PA 2E61A 2YQLA 1E4UA 4GNFA 1K2FA 2PNXA 2QICA 2MNYA 4C9ZA 2MT5A 3O70A 4Z0OA 1VYXA 2CSYA 3V43A 1Z6UA 2LXPC 5FB0A 2L7PA 2DSMA 3T9KA 2VJFA 1MBMA 3E2DA 2LN0A 5I3LA 1X4UA 2E6SA 2ECIA 4N3WA 2LQ6A 3LRQA 3IHPA 4QF3A 2CKLA 1WEEA 3C6WA 4S3OC 4B86C 2FUIA 4NN2A 5KH3A 2YURA 3FL2A 2XOYA 2EXUA 3U5PA 1WENA 3HTKC 4GNGA 2KE1A 4ZDTA 2KGGA 3O36A 3H7HA 5K3QA 4A49A 2LGGA 2CRWA 3KDEC 2HYED 4LKAA 3LDYA 4LLBA 2VNFA 4MVTA 1IYMA 5SVYA 1G25A 2KREA 4IC2A 3L1ZB 1JM7A 4YABA 2ECNA 2YSJA 1WILA 2XEUA 2YYRA
chains in the Genus database with same CATH topology
2ECJA 5H1TA 3ASLA 4YC9A 3SOWA 3M63A 5B78A 1WESA 5B79A 3L11A 5TABA 1Z2QA 5D1MB 2YU4A 2ECGA 2RSDA 4FO9A 1N87A 2MIQA 2CKLB 3O7AA 1XWHA 2FUUA 2YSMA 2OXQC 3KV6A 1MM2A 1WEWA 2FSAA 2JMIA 2KGIA 4W4UA 2C2VS 4R2YA 2ECWA 1CHCA 1WEUA 2CSZA 5FERA 1WEVA 2H0DA 2JMDA 3HCSA 3PURA 2YT5A 3RPGB 2VJEA 4MSXA 3DPLR 2E6RA 3I2DA 4QF2A 1JM7B 2JMJA 4AYCA 3N9LA 2LRIC 3PUQA 3KV5A 3SOXA 5LCWB 2EODA 3KQIA 5B76A 4R7EA 5D1KB 5DKAA 5C11A 2M1RA 2VP7A 2UZGA 3LQJA 1FBVA 4WA6A 2K16A 2F6JA 4YBSA 2MUMA 4CA1A 1LDKC 1HYIA 2KR4A 3N9QA 2K1JA 2G43A 2AN6A 3ZPV1 4UP0A 1V87A 4A0CD 2MNZA 2C2LA 5H1UA 4I7BA 4XI1A 2BAYA 4I7DA 4ZQLA 1WIMA 2MD8C 4R8PK 4AP4A 3M99A 3ZYQA 3RTRB 1WE9A 2K17A 1X4JA 1WGMA 2H0DB 4L58A 2VJEB 5LKTA 3LQHA 5LKUA 2KWNA 5B8DA 2KYUA 2KU3A 2MA5A 5B77A 5DINA 2XB1A 2KWJA 2M85A 2CT2A 2LV9A 4LADB 4LJNA 2VJFB 5FB1A 1MM3A 4GNDA 3O34A 5JG6A 4PPEA 2HDPA 4WZ0A 2VPGA 1WFKA 2JRJA 3N9NA 3QZVA 1FP0A 2F42A 4FJCA 2L5UA 5G05B 3ZNIA 2PUYA 3N9OA 4Q6FA 4LK9A 3N9MA 4YAXA 4YBMA 2LDRA 1WEPA 2YUCA 4B7YC 4S3OB 3U5MA 3T6RA 4YBTA 5TDRA 4O64A 5J3XA 2YHNA 1VD4A 4A4BA 2MA6A 4WZ2A 2VPDA 2KWKA 1WEOA 2Y1NA 1WEQA 4TKPB 2M6MA 5H1VA 3T7LA 2G45A 4FIPA 5TDWA 3GL6A 2YQMA 2LXHC 1VFYA 2IDAA 3MHSA 3O33A 3DQVR 5KH7A 2QIZA 3LQIA 2MD7B 1F62A 3VK6A 1DVPA 2D8SA 2Y1MA 5KH9A 5EYAF 2ZETC 1JOCA 3C5KA 4PTBA 4ZUXU 2F6NA 3ZTGA 2M3HA 1X4IA 2KFTA 4YATA 5G0FA 5FEYA 3U5NA 4YADA 3ZVYA 2KWOA 4FK5A 5AITA 2L75A 1WEMA 3RPGC 3GV4A 5B75A 2LGLA 3ZVZB 2L43A 4WZ3B 1LDJB 3M62A 3HCUA 4X3GA 4AYCB 1HYJA 2YHOA 3NG2A 4BBQA 4GB0A 2YW8A 3O35A 2KIZA 4GNEA 3U5OA 4N4FA 2L0BA 2Y43A 5LKXA 3ZPVE 5TBNA 5C13A 3EB6A 2I50A 2EA6A 3KNVA 4V3KC 4CCGX 1Z60A 4BHWA 2EGPA 2K4DA 5G04B 4V3LC 5D1LB 2QJ0A 4IC3A 3EB5A 4AVXA 1RMDA 4L7XA 3SHBA 1BORA 2NAAA 2VPBA 3HCTA 3MHHA 4I7CA 2YREA 4P5OB 3SOUA 4F52B 4UI9B 5H9MA 2ECVA 2RI7A 2LGKA 2DX8A 5TRBA 1U6GB 1ZBDB 4AUQB 3L1XA 4UP5A 5AIUA 3PHDA 2LGVA 3O37A 2ECTA 2G6QA 1T1HA 5LKZA 2L80A 2VPEA 4A4CA 3N9PA 2YQLA 1E4UA 4GNFA 1K2FA 2PNXA 2QICA 2MNYA 4C9ZA 2MT5A 3O70A 1VYXA 2CSYA 3V43A 1Z6UA 2LXPC 5FB0A 2VJFA 2LN0A 5I3LA 1X4UA 2E6SA 2ECIA 4N3WA 2LQ6A 3LRQA 3IHPA 2CKLA 4QF3A 1WEEA 3C6WA 4S3OC 4B86C 2FUIA 4NN2A 5KH3A 2YURA 3FL2A 3U5PA 1WENA 3HTKC 4GNGA 2KE1A 4ZDTA 2KGGA 3O36A 4A49A 2LGGA 2HYED 4LKAA 4LLBA 2VNFA 4MVTA 1IYMA 1G25A 2KREA 4IC2A 3L1ZB 1JM7A 4YABA 2ECNA 2YSJA 1WILA 2XEUA 2YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECJ A;  5H1T A;  3ASL A;  4YC9 A;  3SOW A;  3M63 A;  5B78 A;  1WES A;  5B79 A;  3L11 A;  5TAB A;  1Z2Q A;  5D1M B;  2YU4 A;  2ECG A;  2RSD A;  4FO9 A;  1N87 A;  2MIQ A;  2CKL B;  3O7A A;  1XWH A;  2FUU A;  2YSM A;  2OXQ C;  3KV6 A;  1MM2 A;  1WEW A;  2FSA A;  2JMI A;  2KGI A;  4W4U A;  2C2V S;  4R2Y A;  2ECW A;  1CHC A;  1WEU A;  2CSZ A;  5FER A;  1WEV A;  2H0D A;  2JMD A;  3HCS A;  3PUR A;  2YT5 A;  3RPG B;  2VJE A;  4MSX A;  3DPL R;  2E6R A;  3I2D A;  4QF2 A;  1JM7 B;  2JMJ A;  4AYC A;  3N9L A;  2LRI C;  3PUQ A;  3KV5 A;  3SOX A;  5LCW B;  2EOD A;  3KQI A;  5B76 A;  4R7E A;  5D1K B;  5DKA A;  5C11 A;  2M1R A;  2VP7 A;  2UZG A;  3LQJ A;  1FBV A;  4WA6 A;  2K16 A;  2F6J A;  4YBS A;  2MUM A;  4CA1 A;  1LDK C;  1HYI A;  2KR4 A;  3N9Q A;  2K1J A;  2G43 A;  2AN6 A;  3ZPV 1;  4UP0 A;  1V87 A;  4A0C D;  2MNZ A;  2C2L A;  5H1U A;  4I7B A;  4XI1 A;  2BAY A;  4I7D A;  4ZQL A;  1WIM A;  2MD8 C;  4R8P K;  4AP4 A;  3M99 A;  3ZYQ A;  3RTR B;  1WE9 A;  2K17 A;  1X4J A;  1WGM A;  2H0D B;  4L58 A;  2VJE B;  5LKT A;  3LQH A;  5LKU A;  2KWN A;  5B8D A;  2KYU A;  2KU3 A;  2MA5 A;  5B77 A;  5DIN A;  2XB1 A;  2KWJ A;  2M85 A;  2CT2 A;  2LV9 A;  4LAD B;  4LJN A;  2VJF B;  5FB1 A;  1MM3 A;  4GND A;  3O34 A;  5JG6 A;  4PPE A;  2HDP A;  4WZ0 A;  2VPG A;  1WFK A;  2JRJ A;  3N9N A;  3QZV A;  1FP0 A;  2F42 A;  4FJC A;  2L5U A;  5G05 B;  3ZNI A;  2PUY A;  3N9O A;  4Q6F A;  4LK9 A;  3N9M A;  4YAX A;  4YBM A;  2LDR A;  1WEP A;  2YUC A;  4B7Y C;  4S3O B;  3U5M A;  3T6R A;  4YBT A;  5TDR A;  4O64 A;  5J3X A;  2YHN A;  1VD4 A;  4A4B A;  2MA6 A;  4WZ2 A;  2VPD A;  2KWK A;  1WEO A;  2Y1N A;  1WEQ A;  4TKP B;  2M6M A;  5H1V A;  3T7L A;  2G45 A;  4FIP A;  5TDW A;  3GL6 A;  2YQM A;  2LXH C;  1VFY A;  2IDA A;  3MHS A;  3O33 A;  3DQV R;  5KH7 A;  2QIZ A;  3LQI A;  2MD7 B;  1F62 A;  3VK6 A;  1DVP A;  2D8S A;  2Y1M A;  5KH9 A;  5EYA F;  2ZET C;  1JOC A;  3C5K A;  4PTB A;  4ZUX U;  2F6N A;  3ZTG A;  2M3H A;  1X4I A;  2KFT A;  4YAT A;  5G0F A;  5FEY A;  3U5N A;  4YAD A;  3ZVY A;  2KWO A;  4FK5 A;  5AIT A;  2L75 A;  1WEM A;  3RPG C;  3GV4 A;  5B75 A;  2LGL A;  3ZVZ B;  2L43 A;  4WZ3 B;  1LDJ B;  3M62 A;  3HCU A;  4X3G A;  4AYC B;  1HYJ A;  2YHO A;  3NG2 A;  4BBQ A;  4GB0 A;  2YW8 A;  3O35 A;  2KIZ A;  4GNE A;  3U5O A;  4N4F A;  2L0B A;  2Y43 A;  5LKX A;  3ZPV E;  5TBN A;  5C13 A;  3EB6 A;  2I50 A;  2EA6 A;  3KNV A;  4V3K C;  4CCG X;  1Z60 A;  4BHW A;  2EGP A;  2K4D A;  5G04 B;  4V3L C;  5D1L B;  2QJ0 A;  4IC3 A;  3EB5 A;  4AVX A;  1RMD A;  4L7X A;  3SHB A;  1BOR A;  2NAA A;  2VPB A;  3HCT A;  3MHH A;  4I7C A;  2YRE A;  4P5O B;  3SOU A;  4F52 B;  4UI9 B;  5H9M A;  2ECV A;  2RI7 A;  2LGK A;  2DX8 A;  5TRB A;  1U6G B;  1ZBD B;  4AUQ B;  3L1X A;  4UP5 A;  5AIU A;  3PHD A;  2LGV A;  3O37 A;  2ECT A;  2G6Q A;  1T1H A;  5LKZ A;  2L80 A;  2VPE A;  4A4C A;  3N9P A;  2YQL A;  1E4U A;  4GNF A;  1K2F A;  2PNX A;  2QIC A;  2MNY A;  4C9Z A;  2MT5 A;  3O70 A;  1VYX A;  2CSY A;  3V43 A;  1Z6U A;  2LXP C;  5FB0 A;  2VJF A;  2LN0 A;  5I3L A;  1X4U A;  2E6S A;  2ECI A;  4N3W A;  2LQ6 A;  3LRQ A;  3IHP A;  2CKL A;  4QF3 A;  1WEE A;  3C6W A;  4S3O C;  4B86 C;  2FUI A;  4NN2 A;  5KH3 A;  2YUR A;  3FL2 A;  3U5P A;  1WEN A;  3HTK C;  4GNG A;  2KE1 A;  4ZDT A;  2KGG A;  3O36 A;  4A49 A;  2LGG A;  2HYE D;  4LKA A;  4LLB A;  2VNF A;  4MVT A;  1IYM A;  1G25 A;  2KRE A;  4IC2 A;  3L1Z B;  1JM7 A;  4YAB A;  2ECN A;  2YSJ A;  1WIL A;  2XEU A;  2YYR A; 
#chains in the Genus database with same CATH topology
 2ECJ A;  5H1T A;  3ASL A;  4YC9 A;  3FAN A;  2FFW A;  3SOW A;  3M63 A;  5B78 A;  1WES A;  5B79 A;  3L11 A;  5TAB A;  1Z2Q A;  5D1M B;  2YU4 A;  2ECG A;  2RSD A;  4FO9 A;  1N87 A;  3LVQ E;  2MIQ A;  2CKL B;  3O7A A;  1XWH A;  2FUU A;  2YSM A;  3FJU B;  2OXQ C;  3JUE A;  3KV6 A;  1MM2 A;  1WEW A;  2FSA A;  2DJA A;  2IQJ A;  2JMI A;  3FM8 C;  2KGI A;  4W4U A;  2C2V S;  4R2Y A;  2ECW A;  1CHC A;  4F1P A;  1WEU A;  2CSZ A;  5FER A;  1WEV A;  2CRR A;  2H0D A;  2JMD A;  3HCS A;  3PUR A;  2YT5 A;  3RPG B;  2VJE A;  4MSX A;  1DCQ A;  3DPL R;  2E6R A;  3I2D A;  4QF2 A;  2D8U A;  3LVR E;  2YVR A;  1JM7 B;  2JMJ A;  4AYC A;  3N9L A;  2LRI C;  3PUQ A;  3KV5 A;  3SOX A;  5LCW B;  2EOD A;  3KQI A;  5B76 A;  4R7E A;  5D1K B;  5DKA A;  2CON A;  5C11 A;  2M1R A;  2KKY A;  2VP7 A;  4Z0R A;  2UZG A;  3LQJ A;  1FBV A;  4WA6 A;  2K16 A;  5SVX A;  2F6J A;  4YBS A;  2MUM A;  4CA1 A;  1LDK C;  1HYI A;  2KR4 A;  3N9Q A;  2K1J A;  2G43 A;  2AN6 A;  3ZPV 1;  4UP0 A;  1V87 A;  4A0C D;  2MNZ A;  2C2L A;  3Q1D A;  5H1U A;  4I7B A;  2EGM A;  2BAY A;  2CSV A;  4XI1 A;  4I7D A;  4ZQL A;  1WIM A;  2MD8 C;  4R8P K;  2MKE A;  3M99 A;  4AP4 A;  2RR4 A;  3ZYQ A;  3RTR B;  1WE9 A;  2K17 A;  1X4J A;  1WGM A;  2H0D B;  3FAO A;  4L58 A;  2VJE B;  5LKT A;  3LQH A;  5LKU A;  2KWN A;  5B8D A;  2KYU A;  3SUB A;  2KU3 A;  2MA5 A;  2XOZ A;  4QQ4 A;  5B77 A;  5DIN A;  2OWA A;  2XB1 A;  2KWJ A;  2M85 A;  2CT2 A;  2LV9 A;  4LAD B;  4LJN A;  2VJF B;  5FB1 A;  1MM3 A;  4GND A;  3O34 A;  5JG6 A;  4PPE A;  2HDP A;  4WZ0 A;  2VPG A;  1WFK A;  2JRJ A;  3N9N A;  3QZV A;  1FP0 A;  2F42 A;  4FJC A;  2L5U A;  5G05 B;  3ZNI A;  2PUY A;  3N9O A;  2B0O E;  4Q6F A;  4LK9 A;  3N9M A;  4YAX A;  4YBM A;  2LDR A;  1WEP A;  2YUC A;  4OGE A;  4S3O B;  4B7Y C;  3U5M A;  3O47 A;  3T6R A;  4YBT A;  5TDR A;  4O64 A;  5J3X A;  2YHN A;  1VD4 A;  4A4B A;  2MA6 A;  4WZ2 A;  2VPD A;  2KWK A;  3MDB C;  1WEO A;  2Y1N A;  1WEQ A;  4TKP B;  2M6M A;  5H1V A;  3T7L A;  2G45 A;  4FIP A;  5TDW A;  3GL6 A;  2YQM A;  2LXH C;  2KKX A;  1VFY A;  2IDA A;  3MHS A;  3O33 A;  3DQV R;  5KH7 A;  2QIZ A;  3LQI A;  2MD7 B;  1F62 A;  5SVI A;  3VK6 A;  1DVP A;  2D8S A;  2Y1M A;  5KH9 A;  5EYA F;  2ZET C;  1JOC A;  3C5K A;  4PTB A;  3DWD A;  2F6N A;  4ZUX U;  3ZTG A;  3FEH A;  2M3H A;  1X4I A;  2LAU A;  2KFT A;  2M13 A;  4YAT A;  5G0F A;  5FEY A;  3U5N A;  4YAD A;  3ZVY A;  2KWO A;  4FK5 A;  5AIT A;  2L75 A;  1WEM A;  3RPG C;  3GV4 A;  5B75 A;  2LGL A;  3ZVZ B;  2L43 A;  4WZ3 B;  3LJU X;  1LDJ B;  3M62 A;  4O62 A;  3HCU A;  4X3G A;  4AYC B;  1HYJ A;  4H9D A;  2YHO A;  3NG2 A;  4BBQ A;  4GB0 A;  2YW8 A;  3O35 A;  2KIZ A;  4GNE A;  3DDT A;  3U5O A;  2JM3 A;  4N4F A;  2L0B A;  2Y43 A;  5LKX A;  3ZPV E;  5TBN A;  5C13 A;  3EB6 A;  2I50 A;  2EA6 A;  3KNV A;  2XOC A;  2P57 A;  4V3K C;  4CCG X;  1Z60 A;  4OGC A;  4BHW A;  2EGP A;  2K4D A;  5G04 B;  5SVI B;  4V3L C;  5D1L B;  2QJ0 A;  4IC3 A;  3EB5 A;  4AVX A;  1RMD A;  2XP0 A;  4L7X A;  3SHB A;  2JUN A;  1BOR A;  2NAA A;  2VPB A;  3HCT A;  3MHH A;  4I7C A;  2YRE A;  4P5O B;  3SOU A;  4F52 B;  4UI9 B;  5H9M A;  3M7K A;  2ECV A;  2RI7 A;  2LGK A;  2DX8 A;  3PLW A;  5TRB A;  1U6G B;  1ZBD B;  4AUQ B;  2FD4 A;  3L1X A;  4UP5 A;  5AIU A;  3PHD A;  2LGV A;  3O37 A;  2ECT A;  2G6Q A;  1T1H A;  5LKZ A;  2L80 A;  2VPE A;  4A4C A;  3N9P A;  2E61 A;  2YQL A;  1E4U A;  4GNF A;  1K2F A;  2PNX A;  2QIC A;  2MNY A;  4C9Z A;  2MT5 A;  3O70 A;  4Z0O A;  1VYX A;  2CSY A;  3V43 A;  1Z6U A;  2LXP C;  5FB0 A;  2L7P A;  2DSM A;  3T9K A;  2VJF A;  1MBM A;  3E2D A;  2LN0 A;  5I3L A;  1X4U A;  2E6S A;  2ECI A;  4N3W A;  2LQ6 A;  3LRQ A;  3IHP A;  4QF3 A;  2CKL A;  1WEE A;  3C6W A;  4S3O C;  4B86 C;  2FUI A;  4NN2 A;  5KH3 A;  2YUR A;  3FL2 A;  2XOY A;  2EXU A;  3U5P A;  1WEN A;  3HTK C;  4GNG A;  2KE1 A;  4ZDT A;  2KGG A;  3O36 A;  3H7H A;  5K3Q A;  4A49 A;  2LGG A;  2CRW A;  3KDE C;  2HYE D;  4LKA A;  3LDY A;  4LLB A;  2VNF A;  4MVT A;  1IYM A;  5SVY A;  1G25 A;  2KRE A;  4IC2 A;  3L1Z B;  1JM7 A;  4YAB A;  2ECN A;  2YSJ A;  1WIL A;  2XEU A;  2YYR A; 
#chains in the Genus database with same CATH homology
 2ECJ A;  5H1T A;  3ASL A;  4YC9 A;  3SOW A;  3M63 A;  5B78 A;  1WES A;  5B79 A;  3L11 A;  5TAB A;  1Z2Q A;  5D1M B;  2YU4 A;  2ECG A;  2RSD A;  4FO9 A;  1N87 A;  2MIQ A;  2CKL B;  3O7A A;  1XWH A;  2FUU A;  2YSM A;  2OXQ C;  3KV6 A;  1MM2 A;  1WEW A;  2FSA A;  2JMI A;  2KGI A;  4W4U A;  2C2V S;  4R2Y A;  2ECW A;  1CHC A;  1WEU A;  2CSZ A;  5FER A;  1WEV A;  2H0D A;  2JMD A;  3HCS A;  3PUR A;  2YT5 A;  3RPG B;  2VJE A;  4MSX A;  3DPL R;  2E6R A;  3I2D A;  4QF2 A;  1JM7 B;  2JMJ A;  4AYC A;  3N9L A;  2LRI C;  3PUQ A;  3KV5 A;  3SOX A;  5LCW B;  2EOD A;  3KQI A;  5B76 A;  4R7E A;  5D1K B;  5DKA A;  5C11 A;  2M1R A;  2VP7 A;  2UZG A;  3LQJ A;  1FBV A;  4WA6 A;  2K16 A;  2F6J A;  4YBS A;  2MUM A;  4CA1 A;  1LDK C;  1HYI A;  2KR4 A;  3N9Q A;  2K1J A;  2G43 A;  2AN6 A;  3ZPV 1;  4UP0 A;  1V87 A;  4A0C D;  2MNZ A;  2C2L A;  5H1U A;  4I7B A;  4XI1 A;  2BAY A;  4I7D A;  4ZQL A;  1WIM A;  2MD8 C;  4R8P K;  4AP4 A;  3M99 A;  3ZYQ A;  3RTR B;  1WE9 A;  2K17 A;  1X4J A;  1WGM A;  2H0D B;  4L58 A;  2VJE B;  5LKT A;  3LQH A;  5LKU A;  2KWN A;  5B8D A;  2KYU A;  2KU3 A;  2MA5 A;  5B77 A;  5DIN A;  2XB1 A;  2KWJ A;  2M85 A;  2CT2 A;  2LV9 A;  4LAD B;  4LJN A;  2VJF B;  5FB1 A;  1MM3 A;  4GND A;  3O34 A;  5JG6 A;  4PPE A;  2HDP A;  4WZ0 A;  2VPG A;  1WFK A;  2JRJ A;  3N9N A;  3QZV A;  1FP0 A;  2F42 A;  4FJC A;  2L5U A;  5G05 B;  3ZNI A;  2PUY A;  3N9O A;  4Q6F A;  4LK9 A;  3N9M A;  4YAX A;  4YBM A;  2LDR A;  1WEP A;  2YUC A;  4B7Y C;  4S3O B;  3U5M A;  3T6R A;  4YBT A;  5TDR A;  4O64 A;  5J3X A;  2YHN A;  1VD4 A;  4A4B A;  2MA6 A;  4WZ2 A;  2VPD A;  2KWK A;  1WEO A;  2Y1N A;  1WEQ A;  4TKP B;  2M6M A;  5H1V A;  3T7L A;  2G45 A;  4FIP A;  5TDW A;  3GL6 A;  2YQM A;  2LXH C;  1VFY A;  2IDA A;  3MHS A;  3O33 A;  3DQV R;  5KH7 A;  2QIZ A;  3LQI A;  2MD7 B;  1F62 A;  3VK6 A;  1DVP A;  2D8S A;  2Y1M A;  5KH9 A;  5EYA F;  2ZET C;  1JOC A;  3C5K A;  4PTB A;  4ZUX U;  2F6N A;  3ZTG A;  2M3H A;  1X4I A;  2KFT A;  4YAT A;  5G0F A;  5FEY A;  3U5N A;  4YAD A;  3ZVY A;  2KWO A;  4FK5 A;  5AIT A;  2L75 A;  1WEM A;  3RPG C;  3GV4 A;  5B75 A;  2LGL A;  3ZVZ B;  2L43 A;  4WZ3 B;  1LDJ B;  3M62 A;  3HCU A;  4X3G A;  4AYC B;  1HYJ A;  2YHO A;  3NG2 A;  4BBQ A;  4GB0 A;  2YW8 A;  3O35 A;  2KIZ A;  4GNE A;  3U5O A;  4N4F A;  2L0B A;  2Y43 A;  5LKX A;  3ZPV E;  5TBN A;  5C13 A;  3EB6 A;  2I50 A;  2EA6 A;  3KNV A;  4V3K C;  4CCG X;  1Z60 A;  4BHW A;  2EGP A;  2K4D A;  5G04 B;  4V3L C;  5D1L B;  2QJ0 A;  4IC3 A;  3EB5 A;  4AVX A;  1RMD A;  4L7X A;  3SHB A;  1BOR A;  2NAA A;  2VPB A;  3HCT A;  3MHH A;  4I7C A;  2YRE A;  4P5O B;  3SOU A;  4F52 B;  4UI9 B;  5H9M A;  2ECV A;  2RI7 A;  2LGK A;  2DX8 A;  5TRB A;  1U6G B;  1ZBD B;  4AUQ B;  3L1X A;  4UP5 A;  5AIU A;  3PHD A;  2LGV A;  3O37 A;  2ECT A;  2G6Q A;  1T1H A;  5LKZ A;  2L80 A;  2VPE A;  4A4C A;  3N9P A;  2YQL A;  1E4U A;  4GNF A;  1K2F A;  2PNX A;  2QIC A;  2MNY A;  4C9Z A;  2MT5 A;  3O70 A;  1VYX A;  2CSY A;  3V43 A;  1Z6U A;  2LXP C;  5FB0 A;  2VJF A;  2LN0 A;  5I3L A;  1X4U A;  2E6S A;  2ECI A;  4N3W A;  2LQ6 A;  3LRQ A;  3IHP A;  2CKL A;  4QF3 A;  1WEE A;  3C6W A;  4S3O C;  4B86 C;  2FUI A;  4NN2 A;  5KH3 A;  2YUR A;  3FL2 A;  3U5P A;  1WEN A;  3HTK C;  4GNG A;  2KE1 A;  4ZDT A;  2KGG A;  3O36 A;  4A49 A;  2LGG A;  2HYE D;  4LKA A;  4LLB A;  2VNF A;  4MVT A;  1IYM A;  1G25 A;  2KRE A;  4IC2 A;  3L1Z B;  1JM7 A;  4YAB A;  2ECN A;  2YSJ A;  1WIL A;  2XEU A;  2YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...