2VJFB

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
EDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Mdm2/Mdmx Ring Domain Heterodimer Reveals Dimerization is Required for Their Ubiquitylation in Trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
total genus 13
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjfB00
2XB1A 3DQVR 5C13A 3C6WA 3L1XA 1WEVA 2KR4A 5H9MA 2G6QA 4LK9A 4AP4A 5FERA 3FL2A 1WE9A 2KU3A 1WESA 1WEEA 3PHDA 3KV5A 5H1TA 2KWKA 1WEPA 4UP5A 2LGLA 2F42A 3N9QA 2LXHC 3SHBA 1X4JA 4N3WA 4R8PK 2YW8A 3L11A 3T6RA 5H1VA 5G05B 1N87A 4GNEA 2YHNA 4ZUXU 2ZETC 4LADB 2JMJA 2JMDA 1MM2A 3O34A 2LGVA 5JG6A 3U5MA 4O64A 3V43A 4R7EA 2VJFA 5FB0A 3ZYQA 4WZ2A 4XI1A 3SOWA 1RMDA 2QIZA 2JMIA 2MD8C 5B75A 3T7LA 4YBMA 2LRIC 2RI7A 1Z6UA 4I7CA 4B86C 3L1ZB 4YATA 4ZQLA 5FB1A 5KH3A 4LKAA 2H0DA 2ECVA 2LGKA 3O7AA 4C9ZA 3HCSA 2LDRA 3LRQA 2C2VS 2MA6A 2YREA 5DKAA 5LKTA 5TBNA 2L43A 5AIUA 2Y1NA 5LCWB 3M63A 2MNYA 3N9MA 4YC9A 2F6NA 2VJEA 2YSJA 2VJEB 4IC2A 1FBVA 1XWHA 1WIMA 2E6RA 4S3OC 4A4BA 4FIPA 4NN2A 2XEUA 4YBTA 4UP0A 2MT5A 4UI9B 4ZDTA 3HCUA 2M1RA 2MA5A 2KIZA 2JRJA 1HYJA 3NG2A 2ECTA 1LDJB 4W4UA 5J3XA 2VJFB 4CCGX 2VPGA 3M99A 2FUIA 1CHCA 2LGGA 4AUQB 4YBSA 4V3KC 2KE1A 1MM3A 3SOUA 2ECIA 2ECJA 1FP0A 1WEUA 4TKPB 2YQLA 2M6MA 2MD7B 3O35A 2CSZA 1G25A 3ZVZB 2NAAA 4QF3A 3MHHA 4P5OB 4FK5A 3O36A 4GNGA 3VK6A 2D8SA 2K1JA 3O70A 2UZGA 1JOCA 3LQIA 1X4IA 3KNVA 3N9OA 2PNXA 4CA1A 2G45A 4F52B 2EODA 5I3LA 4IC3A 2EA6A 4BBQA 5B79A 2CKLA 4AYCA 1WEWA 3O37A 2KYUA 1U6GB 4Q6FA 2YU4A 3C5KA 3PURA 1JM7A 4WZ3B 1Z2QA 1HYIA 2K4DA 3DPLR 3N9LA 3PUQA 3EB6A 1DVPA 2L5UA 1WEMA 1V87A 4V3LC 2YQMA 2K16A 2LQ6A 2L80A 3LQHA 2KFTA 1VFYA 5LKUA 5D1KB 3GL6A 5TRBA 1LDKC 1ZBDB 2KGGA 2VP7A 4PPEA 2F6JA 3ASLA 2OXQC 5TDRA 2L75A 3U5PA 5KH9A 2E6SA 2MIQA 1WILA 2VPDA 3RPGB 3KQIA 1WEOA 4R2YA 2YUCA 2YSMA 2Y1MA 4L7XA 5AITA 4MSXA 2MNZA 2CT2A 3KV6A 4YADA 4X3GA 3EB5A 4A0CD 5LKZA 4I7DA 5KH7A 5FEYA 2KREA 1E4UA 2YYRA 4YABA 3N9PA 4GNDA 4GB0A 4S3OB 4YAXA 2YHOA 5C11A 2L0BA 2IDAA 5TDWA 3I2DA 2KWJA 4LJNA 1VD4A 2H0DB 5B78A 2VPBA 3IHPA 2KWNA 5D1LB 3ZVYA 3O33A 5B77A 4WZ0A 3HCTA 1WFKA 5DINA 5TABA 2CSYA 4I7BA 4GNFA 3ZPV1 2Y43A 2FSAA 2AN6A 4LLBA 4PTBA 2K17A 2YT5A 4L58A 2ECNA 4MVTA 3GV4A 1Z60A 2M85A 2DX8A 2BAYA 1JM7B 1WENA 1VYXA 2VNFA 2HYED 3M62A 4QF2A 2LN0A 1WEQA 3ZNIA 1X4UA 5B8DA 3QZVA 2LXPC 4A49A 2RSDA 2ECGA 3MHSA 2FUUA 4FJCA 2CKLB 5G0FA 2EGPA 5D1MB 2MUMA 2YURA 2KWOA 5LKXA 2M3HA 5EYAF 1T1HA 3U5NA 4AVXA 2KGIA 4N4FA 3RTRB 5B76A 2HDPA 3LQJA 2VPEA 5H1UA 5G04B 2QICA 1WGMA 2QJ0A 3U5OA 4A4CA 4BHWA 1F62A 1K2FA 3ZPVE 4B7YC 2PUYA 2G43A 3SOXA 4WA6A 3N9NA 3HTKC 1BORA 4AYCB 1IYMA 2C2LA 3ZTGA 3RPGC 2I50A 2ECWA 4FO9A 2LV9A
chains in the Genus database with same CATH superfamily
2XB1A 3DQVR 5C13A 3C6WA 3L1XA 1WEVA 2KR4A 5H9MA 2G6QA 4LK9A 4AP4A 5FERA 4F1PA 2FFWA 3FL2A 1WE9A 5SVYA 2KU3A 1WESA 1WEEA 3PHDA 3KV5A 5H1TA 2KWKA 1WEPA 4UP5A 4OGCA 2B0OE 2LGLA 2F42A 3N9QA 2XP0A 2LXHC 3SHBA 1X4JA 4N3WA 4R8PK 2YW8A 3L11A 2JM3A 2EGMA 2KKXA 3T6RA 5H1VA 4H9DA 5G05B 1N87A 4GNEA 2YHNA 4ZUXU 2ZETC 4LADB 2JMJA 2JMDA 1MM2A 3FM8C 3O34A 3E2DA 2LGVA 5JG6A 3U5MA 4O64A 3V43A 4R7EA 5FB0A 2VJFA 3O47A 3ZYQA 4XI1A 4WZ2A 3SOWA 1RMDA 2QIZA 2JMIA 2MD8C 5B75A 3T7LA 4YBMA 2LRIC 2RI7A 2CONA 1Z6UA 4I7CA 3T9KA 4QQ4A 4B86C 3L1ZB 4YATA 4ZQLA 5FB1A 5KH3A 4LKAA 2H0DA 2ECVA 2LGKA 3O7AA 4C9ZA 3HCSA 2LDRA 3LRQA 2C2VS 2MA6A 2YREA 5DKAA 5LKTA 5TBNA 5SVIA 2L43A 5AIUA 2Y1NA 5LCWB 3M63A 2MNYA 3N9MA 4YC9A 2F6NA 2VJEA 2YSJA 2VJEB 4IC2A 3KDEC 3LDYA 1FBVA 1XWHA 1WIMA 3FAOA 2E6RA 3FJUB 4S3OC 4A4BA 4FIPA 4NN2A 2XEUA 3JUEA 4UP0A 4YBTA 3H7HA 2KKYA 2MT5A 4UI9B 4ZDTA 3HCUA 3M7KA 2M1RA 2MA5A 2KIZA 2JRJA 1HYJA 3NG2A 2ECTA 1LDJB 3DDTA 5SVXA 4W4UA 5J3XA 2VJFB 4CCGX 2VPGA 3M99A 2FUIA 1CHCA 2LGGA 4AUQB 4YBSA 3LVRE 4V3KC 2XOZA 2KE1A 3FANA 1MM3A 3SOUA 2ECIA 2ECJA 1FP0A 1WEUA 4TKPB 4OGEA 2YQLA 2M6MA 2MD7B 3O35A 2CSZA 1G25A 3ZVZB 2NAAA 4QF3A 3MHHA 4P5OB 4FK5A 5K3QA 3O36A 4GNGA 3VK6A 2D8SA 2K1JA 3O70A 2UZGA 3LQIA 1JOCA 1X4IA 3KNVA 3N9OA 2PNXA 2P57A 2G45A 4CA1A 4F52B 1MBMA 2EODA 5I3LA 4IC3A 2EA6A 4BBQA 5B79A 2CKLA 4AYCA 1WEWA 3FEHA 3O37A 3Q1DA 2KYUA 1U6GB 4Q6FA 2YU4A 3C5KA 3PURA 1JM7A 4WZ3B 1Z2QA 1HYIA 2K4DA 3DPLR 3N9LA 3PUQA 3DWDA 3EB6A 1DVPA 2L5UA 1WEMA 1V87A 4V3LC 2YQMA 2YVRA 2K16A 2LQ6A 2L80A 3LQHA 2KFTA 1VFYA 5LKUA 5D1KB 3GL6A 5TRBA 1LDKC 1ZBDB 2KGGA 2VP7A 1DCQA 4PPEA 2F6JA 3ASLA 2OXQC 5TDRA 2L75A 3U5PA 5KH9A 2L7PA 2E6SA 2MIQA 1WILA 2VPDA 3LVQE 2MKEA 3RPGB 3KQIA 1WEOA 4R2YA 2YUCA 2YSMA 2Y1MA 4L7XA 5AITA 4MSXA 2MNZA 2CT2A 3KV6A 4YADA 2JUNA 4X3GA 3EB5A 2RR4A 4A0CD 5LKZA 2M13A 4I7DA 5KH7A 2DJAA 5FEYA 2KREA 1E4UA 2YYRA 4YABA 3N9PA 4GNDA 4GB0A 4S3OB 4YAXA 2YHOA 5C11A 2L0BA 2IDAA 5TDWA 3I2DA 2KWJA 2IQJA 4LJNA 1VD4A 2CRRA 2H0DB 5B78A 2EXUA 2VPBA 3IHPA 2KWNA 2DSMA 5D1LB 2D8UA 3ZVYA 3O33A 5B77A 4WZ0A 3HCTA 4O62A 1WFKA 4Z0RA 5DINA 5TABA 3MDBC 2CSYA 4I7BA 4GNFA 3ZPV1 2Y43A 2FSAA 2AN6A 4LLBA 2FD4A 4PTBA 2K17A 2YT5A 4L58A 2ECNA 4MVTA 3GV4A 1Z60A 2M85A 2DX8A 2BAYA 1JM7B 1WENA 1VYXA 2VNFA 2HYED 3M62A 4QF2A 2LN0A 1WEQA 5SVIB 3ZNIA 1X4UA 5B8DA 3QZVA 2LXPC 4A49A 2RSDA 2ECGA 3MHSA 2FUUA 4FJCA 2CKLB 5G0FA 2EGPA 5D1MB 2MUMA 2LAUA 2KWOA 2YURA 2M3HA 5LKXA 5EYAF 1T1HA 3U5NA 4AVXA 2KGIA 4N4FA 3RTRB 5B76A 2HDPA 2XOCA 3LQJA 2VPEA 5H1UA 5G04B 2QICA 1WGMA 2CSVA 4Z0OA 2QJ0A 3U5OA 4A4CA 3LJUX 4BHWA 1F62A 1K2FA 3ZPVE 4B7YC 2CRWA 2PUYA 2G43A 3SOXA 2XOYA 4WA6A 3N9NA 3HTKC 1BORA 2E61A 2OWAA 4AYCB 1IYMA 2C2LA 3PLWA 3RPGC 3ZTGA 2I50A 2ECWA 4FO9A 3SUBA 2LV9A
chains in the Genus database with same CATH topology
2XB1A 3DQVR 5C13A 3C6WA 3L1XA 1WEVA 2KR4A 5H9MA 2G6QA 4LK9A 4AP4A 5FERA 3FL2A 1WE9A 2KU3A 1WESA 1WEEA 3PHDA 3KV5A 5H1TA 2KWKA 1WEPA 4UP5A 2LGLA 2F42A 3N9QA 2LXHC 3SHBA 1X4JA 4N3WA 4R8PK 2YW8A 3L11A 3T6RA 5H1VA 5G05B 1N87A 4GNEA 2YHNA 4ZUXU 2ZETC 4LADB 2JMJA 2JMDA 1MM2A 3O34A 2LGVA 5JG6A 3U5MA 4O64A 3V43A 4R7EA 2VJFA 5FB0A 3ZYQA 4WZ2A 4XI1A 3SOWA 1RMDA 2QIZA 2JMIA 2MD8C 5B75A 3T7LA 4YBMA 2LRIC 2RI7A 1Z6UA 4I7CA 4B86C 3L1ZB 4YATA 4ZQLA 5FB1A 5KH3A 4LKAA 2H0DA 2ECVA 2LGKA 3O7AA 4C9ZA 3HCSA 2LDRA 3LRQA 2C2VS 2MA6A 2YREA 5DKAA 5LKTA 5TBNA 2L43A 5AIUA 2Y1NA 5LCWB 3M63A 2MNYA 3N9MA 4YC9A 2F6NA 2VJEA 2YSJA 2VJEB 4IC2A 1FBVA 1XWHA 1WIMA 2E6RA 4S3OC 4A4BA 4FIPA 4NN2A 2XEUA 4YBTA 4UP0A 2MT5A 4UI9B 4ZDTA 3HCUA 2M1RA 2MA5A 2KIZA 2JRJA 1HYJA 3NG2A 2ECTA 1LDJB 4W4UA 5J3XA 2VJFB 4CCGX 2VPGA 3M99A 2FUIA 1CHCA 2LGGA 4AUQB 4YBSA 4V3KC 2KE1A 1MM3A 3SOUA 2ECIA 2ECJA 1FP0A 1WEUA 4TKPB 2YQLA 2M6MA 2MD7B 3O35A 2CSZA 1G25A 3ZVZB 2NAAA 4QF3A 3MHHA 4P5OB 4FK5A 3O36A 4GNGA 3VK6A 2D8SA 2K1JA 3O70A 2UZGA 1JOCA 3LQIA 1X4IA 3KNVA 3N9OA 2PNXA 4CA1A 2G45A 4F52B 2EODA 5I3LA 4IC3A 2EA6A 4BBQA 5B79A 2CKLA 4AYCA 1WEWA 3O37A 2KYUA 1U6GB 4Q6FA 2YU4A 3C5KA 3PURA 1JM7A 4WZ3B 1Z2QA 1HYIA 2K4DA 3DPLR 3N9LA 3PUQA 3EB6A 1DVPA 2L5UA 1WEMA 1V87A 4V3LC 2YQMA 2K16A 2LQ6A 2L80A 3LQHA 2KFTA 1VFYA 5LKUA 5D1KB 3GL6A 5TRBA 1LDKC 1ZBDB 2KGGA 2VP7A 4PPEA 2F6JA 3ASLA 2OXQC 5TDRA 2L75A 3U5PA 5KH9A 2E6SA 2MIQA 1WILA 2VPDA 3RPGB 3KQIA 1WEOA 4R2YA 2YUCA 2YSMA 2Y1MA 4L7XA 5AITA 4MSXA 2MNZA 2CT2A 3KV6A 4YADA 4X3GA 3EB5A 4A0CD 5LKZA 4I7DA 5KH7A 5FEYA 2KREA 1E4UA 2YYRA 4YABA 3N9PA 4GNDA 4GB0A 4S3OB 4YAXA 2YHOA 5C11A 2L0BA 2IDAA 5TDWA 3I2DA 2KWJA 4LJNA 1VD4A 2H0DB 5B78A 2VPBA 3IHPA 2KWNA 5D1LB 3ZVYA 3O33A 5B77A 4WZ0A 3HCTA 1WFKA 5DINA 5TABA 2CSYA 4I7BA 4GNFA 3ZPV1 2Y43A 2FSAA 2AN6A 4LLBA 4PTBA 2K17A 2YT5A 4L58A 2ECNA 4MVTA 3GV4A 1Z60A 2M85A 2DX8A 2BAYA 1JM7B 1WENA 1VYXA 2VNFA 2HYED 3M62A 4QF2A 2LN0A 1WEQA 3ZNIA 1X4UA 5B8DA 3QZVA 2LXPC 4A49A 2RSDA 2ECGA 3MHSA 2FUUA 4FJCA 2CKLB 5G0FA 2EGPA 5D1MB 2MUMA 2YURA 2KWOA 5LKXA 2M3HA 5EYAF 1T1HA 3U5NA 4AVXA 2KGIA 4N4FA 3RTRB 5B76A 2HDPA 3LQJA 2VPEA 5H1UA 5G04B 2QICA 1WGMA 2QJ0A 3U5OA 4A4CA 4BHWA 1F62A 1K2FA 3ZPVE 4B7YC 2PUYA 2G43A 3SOXA 4WA6A 3N9NA 3HTKC 1BORA 4AYCB 1IYMA 2C2LA 3ZTGA 3RPGC 2I50A 2ECWA 4FO9A 2LV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB1 A;  3DQV R;  5C13 A;  3C6W A;  3L1X A;  1WEV A;  2KR4 A;  5H9M A;  2G6Q A;  4LK9 A;  4AP4 A;  5FER A;  3FL2 A;  1WE9 A;  2KU3 A;  1WES A;  1WEE A;  3PHD A;  3KV5 A;  5H1T A;  2KWK A;  1WEP A;  4UP5 A;  2LGL A;  2F42 A;  3N9Q A;  2LXH C;  3SHB A;  1X4J A;  4N3W A;  4R8P K;  2YW8 A;  3L11 A;  3T6R A;  5H1V A;  5G05 B;  1N87 A;  4GNE A;  2YHN A;  4ZUX U;  2ZET C;  4LAD B;  2JMJ A;  2JMD A;  1MM2 A;  3O34 A;  2LGV A;  5JG6 A;  3U5M A;  4O64 A;  3V43 A;  4R7E A;  2VJF A;  5FB0 A;  3ZYQ A;  4WZ2 A;  4XI1 A;  3SOW A;  1RMD A;  2QIZ A;  2JMI A;  2MD8 C;  5B75 A;  3T7L A;  4YBM A;  2LRI C;  2RI7 A;  1Z6U A;  4I7C A;  4B86 C;  3L1Z B;  4YAT A;  4ZQL A;  5FB1 A;  5KH3 A;  4LKA A;  2H0D A;  2ECV A;  2LGK A;  3O7A A;  4C9Z A;  3HCS A;  2LDR A;  3LRQ A;  2C2V S;  2MA6 A;  2YRE A;  5DKA A;  5LKT A;  5TBN A;  2L43 A;  5AIU A;  2Y1N A;  5LCW B;  3M63 A;  2MNY A;  3N9M A;  4YC9 A;  2F6N A;  2VJE A;  2YSJ A;  2VJE B;  4IC2 A;  1FBV A;  1XWH A;  1WIM A;  2E6R A;  4S3O C;  4A4B A;  4FIP A;  4NN2 A;  2XEU A;  4YBT A;  4UP0 A;  2MT5 A;  4UI9 B;  4ZDT A;  3HCU A;  2M1R A;  2MA5 A;  2KIZ A;  2JRJ A;  1HYJ A;  3NG2 A;  2ECT A;  1LDJ B;  4W4U A;  5J3X A;  2VJF B;  4CCG X;  2VPG A;  3M99 A;  2FUI A;  1CHC A;  2LGG A;  4AUQ B;  4YBS A;  4V3K C;  2KE1 A;  1MM3 A;  3SOU A;  2ECI A;  2ECJ A;  1FP0 A;  1WEU A;  4TKP B;  2YQL A;  2M6M A;  2MD7 B;  3O35 A;  2CSZ A;  1G25 A;  3ZVZ B;  2NAA A;  4QF3 A;  3MHH A;  4P5O B;  4FK5 A;  3O36 A;  4GNG A;  3VK6 A;  2D8S A;  2K1J A;  3O70 A;  2UZG A;  1JOC A;  3LQI A;  1X4I A;  3KNV A;  3N9O A;  2PNX A;  4CA1 A;  2G45 A;  4F52 B;  2EOD A;  5I3L A;  4IC3 A;  2EA6 A;  4BBQ A;  5B79 A;  2CKL A;  4AYC A;  1WEW A;  3O37 A;  2KYU A;  1U6G B;  4Q6F A;  2YU4 A;  3C5K A;  3PUR A;  1JM7 A;  4WZ3 B;  1Z2Q A;  1HYI A;  2K4D A;  3DPL R;  3N9L A;  3PUQ A;  3EB6 A;  1DVP A;  2L5U A;  1WEM A;  1V87 A;  4V3L C;  2YQM A;  2K16 A;  2LQ6 A;  2L80 A;  3LQH A;  2KFT A;  1VFY A;  5LKU A;  5D1K B;  3GL6 A;  5TRB A;  1LDK C;  1ZBD B;  2KGG A;  2VP7 A;  4PPE A;  2F6J A;  3ASL A;  2OXQ C;  5TDR A;  2L75 A;  3U5P A;  5KH9 A;  2E6S A;  2MIQ A;  1WIL A;  2VPD A;  3RPG B;  3KQI A;  1WEO A;  4R2Y A;  2YUC A;  2YSM A;  2Y1M A;  4L7X A;  5AIT A;  4MSX A;  2MNZ A;  2CT2 A;  3KV6 A;  4YAD A;  4X3G A;  3EB5 A;  4A0C D;  5LKZ A;  4I7D A;  5KH7 A;  5FEY A;  2KRE A;  1E4U A;  2YYR A;  4YAB A;  3N9P A;  4GND A;  4GB0 A;  4S3O B;  4YAX A;  2YHO A;  5C11 A;  2L0B A;  2IDA A;  5TDW A;  3I2D A;  2KWJ A;  4LJN A;  1VD4 A;  2H0D B;  5B78 A;  2VPB A;  3IHP A;  2KWN A;  5D1L B;  3ZVY A;  3O33 A;  5B77 A;  4WZ0 A;  3HCT A;  1WFK A;  5DIN A;  5TAB A;  2CSY A;  4I7B A;  4GNF A;  3ZPV 1;  2Y43 A;  2FSA A;  2AN6 A;  4LLB A;  4PTB A;  2K17 A;  2YT5 A;  4L58 A;  2ECN A;  4MVT A;  3GV4 A;  1Z60 A;  2M85 A;  2DX8 A;  2BAY A;  1JM7 B;  1WEN A;  1VYX A;  2VNF A;  2HYE D;  3M62 A;  4QF2 A;  2LN0 A;  1WEQ A;  3ZNI A;  1X4U A;  5B8D A;  3QZV A;  2LXP C;  4A49 A;  2RSD A;  2ECG A;  3MHS A;  2FUU A;  4FJC A;  2CKL B;  5G0F A;  2EGP A;  5D1M B;  2MUM A;  2YUR A;  2KWO A;  5LKX A;  2M3H A;  5EYA F;  1T1H A;  3U5N A;  4AVX A;  2KGI A;  4N4F A;  3RTR B;  5B76 A;  2HDP A;  3LQJ A;  2VPE A;  5H1U A;  5G04 B;  2QIC A;  1WGM A;  2QJ0 A;  3U5O A;  4A4C A;  4BHW A;  1F62 A;  1K2F A;  3ZPV E;  4B7Y C;  2PUY A;  2G43 A;  3SOX A;  4WA6 A;  3N9N A;  3HTK C;  1BOR A;  4AYC B;  1IYM A;  2C2L A;  3ZTG A;  3RPG C;  2I50 A;  2ECW A;  4FO9 A;  2LV9 A; 
#chains in the Genus database with same CATH topology
 2XB1 A;  3DQV R;  5C13 A;  3C6W A;  3L1X A;  1WEV A;  2KR4 A;  5H9M A;  2G6Q A;  4LK9 A;  4AP4 A;  5FER A;  4F1P A;  2FFW A;  3FL2 A;  1WE9 A;  5SVY A;  2KU3 A;  1WES A;  1WEE A;  3PHD A;  3KV5 A;  5H1T A;  2KWK A;  1WEP A;  4UP5 A;  4OGC A;  2B0O E;  2LGL A;  2F42 A;  3N9Q A;  2XP0 A;  2LXH C;  3SHB A;  1X4J A;  4N3W A;  4R8P K;  2YW8 A;  3L11 A;  2JM3 A;  2EGM A;  2KKX A;  3T6R A;  5H1V A;  4H9D A;  5G05 B;  1N87 A;  4GNE A;  2YHN A;  4ZUX U;  2ZET C;  4LAD B;  2JMJ A;  2JMD A;  1MM2 A;  3FM8 C;  3O34 A;  3E2D A;  2LGV A;  5JG6 A;  3U5M A;  4O64 A;  3V43 A;  4R7E A;  5FB0 A;  2VJF A;  3O47 A;  3ZYQ A;  4XI1 A;  4WZ2 A;  3SOW A;  1RMD A;  2QIZ A;  2JMI A;  2MD8 C;  5B75 A;  3T7L A;  4YBM A;  2LRI C;  2RI7 A;  2CON A;  1Z6U A;  4I7C A;  3T9K A;  4QQ4 A;  4B86 C;  3L1Z B;  4YAT A;  4ZQL A;  5FB1 A;  5KH3 A;  4LKA A;  2H0D A;  2ECV A;  2LGK A;  3O7A A;  4C9Z A;  3HCS A;  2LDR A;  3LRQ A;  2C2V S;  2MA6 A;  2YRE A;  5DKA A;  5LKT A;  5TBN A;  5SVI A;  2L43 A;  5AIU A;  2Y1N A;  5LCW B;  3M63 A;  2MNY A;  3N9M A;  4YC9 A;  2F6N A;  2VJE A;  2YSJ A;  2VJE B;  4IC2 A;  3KDE C;  3LDY A;  1FBV A;  1XWH A;  1WIM A;  3FAO A;  2E6R A;  3FJU B;  4S3O C;  4A4B A;  4FIP A;  4NN2 A;  2XEU A;  3JUE A;  4UP0 A;  4YBT A;  3H7H A;  2KKY A;  2MT5 A;  4UI9 B;  4ZDT A;  3HCU A;  3M7K A;  2M1R A;  2MA5 A;  2KIZ A;  2JRJ A;  1HYJ A;  3NG2 A;  2ECT A;  1LDJ B;  3DDT A;  5SVX A;  4W4U A;  5J3X A;  2VJF B;  4CCG X;  2VPG A;  3M99 A;  2FUI A;  1CHC A;  2LGG A;  4AUQ B;  4YBS A;  3LVR E;  4V3K C;  2XOZ A;  2KE1 A;  3FAN A;  1MM3 A;  3SOU A;  2ECI A;  2ECJ A;  1FP0 A;  1WEU A;  4TKP B;  4OGE A;  2YQL A;  2M6M A;  2MD7 B;  3O35 A;  2CSZ A;  1G25 A;  3ZVZ B;  2NAA A;  4QF3 A;  3MHH A;  4P5O B;  4FK5 A;  5K3Q A;  3O36 A;  4GNG A;  3VK6 A;  2D8S A;  2K1J A;  3O70 A;  2UZG A;  3LQI A;  1JOC A;  1X4I A;  3KNV A;  3N9O A;  2PNX A;  2P57 A;  2G45 A;  4CA1 A;  4F52 B;  1MBM A;  2EOD A;  5I3L A;  4IC3 A;  2EA6 A;  4BBQ A;  5B79 A;  2CKL A;  4AYC A;  1WEW A;  3FEH A;  3O37 A;  3Q1D A;  2KYU A;  1U6G B;  4Q6F A;  2YU4 A;  3C5K A;  3PUR A;  1JM7 A;  4WZ3 B;  1Z2Q A;  1HYI A;  2K4D A;  3DPL R;  3N9L A;  3PUQ A;  3DWD A;  3EB6 A;  1DVP A;  2L5U A;  1WEM A;  1V87 A;  4V3L C;  2YQM A;  2YVR A;  2K16 A;  2LQ6 A;  2L80 A;  3LQH A;  2KFT A;  1VFY A;  5LKU A;  5D1K B;  3GL6 A;  5TRB A;  1LDK C;  1ZBD B;  2KGG A;  2VP7 A;  1DCQ A;  4PPE A;  2F6J A;  3ASL A;  2OXQ C;  5TDR A;  2L75 A;  3U5P A;  5KH9 A;  2L7P A;  2E6S A;  2MIQ A;  1WIL A;  2VPD A;  3LVQ E;  2MKE A;  3RPG B;  3KQI A;  1WEO A;  4R2Y A;  2YUC A;  2YSM A;  2Y1M A;  4L7X A;  5AIT A;  4MSX A;  2MNZ A;  2CT2 A;  3KV6 A;  4YAD A;  2JUN A;  4X3G A;  3EB5 A;  2RR4 A;  4A0C D;  5LKZ A;  2M13 A;  4I7D A;  5KH7 A;  2DJA A;  5FEY A;  2KRE A;  1E4U A;  2YYR A;  4YAB A;  3N9P A;  4GND A;  4GB0 A;  4S3O B;  4YAX A;  2YHO A;  5C11 A;  2L0B A;  2IDA A;  5TDW A;  3I2D A;  2KWJ A;  2IQJ A;  4LJN A;  1VD4 A;  2CRR A;  2H0D B;  5B78 A;  2EXU A;  2VPB A;  3IHP A;  2KWN A;  2DSM A;  5D1L B;  2D8U A;  3ZVY A;  3O33 A;  5B77 A;  4WZ0 A;  3HCT A;  4O62 A;  1WFK A;  4Z0R A;  5DIN A;  5TAB A;  3MDB C;  2CSY A;  4I7B A;  4GNF A;  3ZPV 1;  2Y43 A;  2FSA A;  2AN6 A;  4LLB A;  2FD4 A;  4PTB A;  2K17 A;  2YT5 A;  4L58 A;  2ECN A;  4MVT A;  3GV4 A;  1Z60 A;  2M85 A;  2DX8 A;  2BAY A;  1JM7 B;  1WEN A;  1VYX A;  2VNF A;  2HYE D;  3M62 A;  4QF2 A;  2LN0 A;  1WEQ A;  5SVI B;  3ZNI A;  1X4U A;  5B8D A;  3QZV A;  2LXP C;  4A49 A;  2RSD A;  2ECG A;  3MHS A;  2FUU A;  4FJC A;  2CKL B;  5G0F A;  2EGP A;  5D1M B;  2MUM A;  2LAU A;  2KWO A;  2YUR A;  2M3H A;  5LKX A;  5EYA F;  1T1H A;  3U5N A;  4AVX A;  2KGI A;  4N4F A;  3RTR B;  5B76 A;  2HDP A;  2XOC A;  3LQJ A;  2VPE A;  5H1U A;  5G04 B;  2QIC A;  1WGM A;  2CSV A;  4Z0O A;  2QJ0 A;  3U5O A;  4A4C A;  3LJU X;  4BHW A;  1F62 A;  1K2F A;  3ZPV E;  4B7Y C;  2CRW A;  2PUY A;  2G43 A;  3SOX A;  2XOY A;  4WA6 A;  3N9N A;  3HTK C;  1BOR A;  2E61 A;  2OWA A;  4AYC B;  1IYM A;  2C2L A;  3PLW A;  3RPG C;  3ZTG A;  2I50 A;  2ECW A;  4FO9 A;  3SUB A;  2LV9 A; 
#chains in the Genus database with same CATH homology
 2XB1 A;  3DQV R;  5C13 A;  3C6W A;  3L1X A;  1WEV A;  2KR4 A;  5H9M A;  2G6Q A;  4LK9 A;  4AP4 A;  5FER A;  3FL2 A;  1WE9 A;  2KU3 A;  1WES A;  1WEE A;  3PHD A;  3KV5 A;  5H1T A;  2KWK A;  1WEP A;  4UP5 A;  2LGL A;  2F42 A;  3N9Q A;  2LXH C;  3SHB A;  1X4J A;  4N3W A;  4R8P K;  2YW8 A;  3L11 A;  3T6R A;  5H1V A;  5G05 B;  1N87 A;  4GNE A;  2YHN A;  4ZUX U;  2ZET C;  4LAD B;  2JMJ A;  2JMD A;  1MM2 A;  3O34 A;  2LGV A;  5JG6 A;  3U5M A;  4O64 A;  3V43 A;  4R7E A;  2VJF A;  5FB0 A;  3ZYQ A;  4WZ2 A;  4XI1 A;  3SOW A;  1RMD A;  2QIZ A;  2JMI A;  2MD8 C;  5B75 A;  3T7L A;  4YBM A;  2LRI C;  2RI7 A;  1Z6U A;  4I7C A;  4B86 C;  3L1Z B;  4YAT A;  4ZQL A;  5FB1 A;  5KH3 A;  4LKA A;  2H0D A;  2ECV A;  2LGK A;  3O7A A;  4C9Z A;  3HCS A;  2LDR A;  3LRQ A;  2C2V S;  2MA6 A;  2YRE A;  5DKA A;  5LKT A;  5TBN A;  2L43 A;  5AIU A;  2Y1N A;  5LCW B;  3M63 A;  2MNY A;  3N9M A;  4YC9 A;  2F6N A;  2VJE A;  2YSJ A;  2VJE B;  4IC2 A;  1FBV A;  1XWH A;  1WIM A;  2E6R A;  4S3O C;  4A4B A;  4FIP A;  4NN2 A;  2XEU A;  4YBT A;  4UP0 A;  2MT5 A;  4UI9 B;  4ZDT A;  3HCU A;  2M1R A;  2MA5 A;  2KIZ A;  2JRJ A;  1HYJ A;  3NG2 A;  2ECT A;  1LDJ B;  4W4U A;  5J3X A;  2VJF B;  4CCG X;  2VPG A;  3M99 A;  2FUI A;  1CHC A;  2LGG A;  4AUQ B;  4YBS A;  4V3K C;  2KE1 A;  1MM3 A;  3SOU A;  2ECI A;  2ECJ A;  1FP0 A;  1WEU A;  4TKP B;  2YQL A;  2M6M A;  2MD7 B;  3O35 A;  2CSZ A;  1G25 A;  3ZVZ B;  2NAA A;  4QF3 A;  3MHH A;  4P5O B;  4FK5 A;  3O36 A;  4GNG A;  3VK6 A;  2D8S A;  2K1J A;  3O70 A;  2UZG A;  1JOC A;  3LQI A;  1X4I A;  3KNV A;  3N9O A;  2PNX A;  4CA1 A;  2G45 A;  4F52 B;  2EOD A;  5I3L A;  4IC3 A;  2EA6 A;  4BBQ A;  5B79 A;  2CKL A;  4AYC A;  1WEW A;  3O37 A;  2KYU A;  1U6G B;  4Q6F A;  2YU4 A;  3C5K A;  3PUR A;  1JM7 A;  4WZ3 B;  1Z2Q A;  1HYI A;  2K4D A;  3DPL R;  3N9L A;  3PUQ A;  3EB6 A;  1DVP A;  2L5U A;  1WEM A;  1V87 A;  4V3L C;  2YQM A;  2K16 A;  2LQ6 A;  2L80 A;  3LQH A;  2KFT A;  1VFY A;  5LKU A;  5D1K B;  3GL6 A;  5TRB A;  1LDK C;  1ZBD B;  2KGG A;  2VP7 A;  4PPE A;  2F6J A;  3ASL A;  2OXQ C;  5TDR A;  2L75 A;  3U5P A;  5KH9 A;  2E6S A;  2MIQ A;  1WIL A;  2VPD A;  3RPG B;  3KQI A;  1WEO A;  4R2Y A;  2YUC A;  2YSM A;  2Y1M A;  4L7X A;  5AIT A;  4MSX A;  2MNZ A;  2CT2 A;  3KV6 A;  4YAD A;  4X3G A;  3EB5 A;  4A0C D;  5LKZ A;  4I7D A;  5KH7 A;  5FEY A;  2KRE A;  1E4U A;  2YYR A;  4YAB A;  3N9P A;  4GND A;  4GB0 A;  4S3O B;  4YAX A;  2YHO A;  5C11 A;  2L0B A;  2IDA A;  5TDW A;  3I2D A;  2KWJ A;  4LJN A;  1VD4 A;  2H0D B;  5B78 A;  2VPB A;  3IHP A;  2KWN A;  5D1L B;  3ZVY A;  3O33 A;  5B77 A;  4WZ0 A;  3HCT A;  1WFK A;  5DIN A;  5TAB A;  2CSY A;  4I7B A;  4GNF A;  3ZPV 1;  2Y43 A;  2FSA A;  2AN6 A;  4LLB A;  4PTB A;  2K17 A;  2YT5 A;  4L58 A;  2ECN A;  4MVT A;  3GV4 A;  1Z60 A;  2M85 A;  2DX8 A;  2BAY A;  1JM7 B;  1WEN A;  1VYX A;  2VNF A;  2HYE D;  3M62 A;  4QF2 A;  2LN0 A;  1WEQ A;  3ZNI A;  1X4U A;  5B8D A;  3QZV A;  2LXP C;  4A49 A;  2RSD A;  2ECG A;  3MHS A;  2FUU A;  4FJC A;  2CKL B;  5G0F A;  2EGP A;  5D1M B;  2MUM A;  2YUR A;  2KWO A;  5LKX A;  2M3H A;  5EYA F;  1T1H A;  3U5N A;  4AVX A;  2KGI A;  4N4F A;  3RTR B;  5B76 A;  2HDP A;  3LQJ A;  2VPE A;  5H1U A;  5G04 B;  2QIC A;  1WGM A;  2QJ0 A;  3U5O A;  4A4C A;  4BHW A;  1F62 A;  1K2F A;  3ZPV E;  4B7Y C;  2PUY A;  2G43 A;  3SOX A;  4WA6 A;  3N9N A;  3HTK C;  1BOR A;  4AYC B;  1IYM A;  2C2L A;  3ZTG A;  3RPG C;  2I50 A;  2ECW A;  4FO9 A;  2LV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...