3HTKC

Crystal structure of mms21 and smc5 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
molecule keywords Structural maintenance of chromosomes protein 5
total genus 75
structure length 254
sequence length 254
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1010 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3htkC01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3htkC02
5D1LB 2L80A 4GNFA 2YU4A 4GNDA 4Q6FA 2VNFA 3M99A 3N9LA 3PHDA 3I2DA 2LRIC 2KU3A 2YSJA 1HYIA 1BORA 2RSDA 2JMDA 2M6MA 3HCTA 4F52B 2HYED 4ZUXU 4N3WA 2BAYA 2QJ0A 3O35A 2KWJA 3HCSA 5LKZA 1G25A 5J3XA 4L58A 3LRQA 3LQIA 3C5KA 2DX8A 2H0DB 1WEQA 2XB1A 4YBSA 2UZGA 2YURA 2C2LA 3ASLA 2VJFA 4S3OC 2M1RA 1K2FA 5B77A 4LKAA 1WEOA 3O37A 3LQHA 2F6JA 4A49A 2ECGA 4P5OB 4YBTA 4I7DA 1VYXA 2LV9A 5G05B 5I3LA 2AN6A 1JM7A 4X3GA 5TRBA 2ECTA 3SOXA 3O34A 2YQMA 1Z60A 3RTRB 2PUYA 4FO9A 4CCGX 1X4IA 4FIPA 2D8SA 3KV6A 2KYUA 3T6RA 2G43A 4AVXA 2ECWA 4S3OB 5FERA 5H1TA 5FB0A 1JOCA 3RPGC 4YATA 3RPGB 3SHBA 4I7BA 1WEMA 1N87A 2EA6A 2LGLA 2F42A 3QZVA 4O64A 2KIZA 1VD4A 4CA1A 4B86C 2PNXA 3GV4A 3C6WA 2YHOA 2VPEA 4C9ZA 2CKLB 1MM2A 2LXPC 2VPBA 3U5OA 2G6QA 4MSXA 4A4CA 3O36A 1WEVA 4PTBA 4YABA 4WA6A 2EGPA 5C11A 3PURA 1WFKA 1X4UA 5DKAA 2ECJA 5EYAF 2F6NA 3KV5A 2YW8A 1FP0A 3M62A 2FUIA 2K4DA 5TDRA 2LDRA 3ZVYA 2RI7A 2VP7A 5TBNA 2QICA 5B76A 1IYMA 4WZ0A 3PUQA 3U5PA 5H1UA 1CHCA 4I7CA 1Z6UA 2M3HA 1LDKC 1DVPA 4AYCA 5FEYA 2VPGA 4XI1A 4UI9B 4YADA 2K17A 3SOWA 2MA6A 4BHWA 2LN0A 4R8PK 3EB5A 4R7EA 2YUCA 5KH7A 2MUMA 2YQLA 2QIZA 4YAXA 1WE9A 5G04B 2KGGA 4LADB 5KH9A 2MIQA 4GB0A 5D1MB 5LKXA 1WIMA 5C13A 3U5MA 4AYCB 2C2VS 3M63A 1ZBDB 5G0FA 1HYJA 4W4UA 4LLBA 3HCUA 1RMDA 2MA5A 2ZETC 2KREA 2Y1NA 1LDJB 4PPEA 2YHNA 3GL6A 1F62A 5B8DA 1XWHA 1U6GB 5JG6A 3U5NA 2L0BA 2LGKA 5D1KB 4R2YA 2Y43A 3KQIA 1E4UA 4WZ3B 2LGGA 3L1ZB 2XEUA 2M85A 3V43A 5B75A 4LJNA 2KGIA 2JRJA 4V3LC 3ZVZB 1WENA 3O7AA 4MVTA 2CSYA 2K16A 3ZNIA 4AP4A 2EODA 2JMIA 2KWNA 4V3KC 5FB1A 3N9MA 4IC3A 2CT2A 2L75A 4B7YC 1WEUA 3LQJA 5LKUA 3ZPVE 4WZ2A 2KE1A 1JM7B 1T1HA 2E6RA 4FK5A 4A0CD 5LCWB 2G45A 4LK9A 2E6SA 5LKTA 4L7XA 1WEWA 1WEEA 5B78A 4YC9A 1Z2QA 2VPDA 2YSMA 2ECVA 2MNYA 5H1VA 4AUQB 4QF3A 2FUUA 2OXQC 3O33A 2KWKA 2ECIA 2MD8C 3HTKC 3MHHA 2KFTA 2LGVA 3N9QA 3L11A 2MD7B 4UP0A 5B79A 5TABA 2HDPA 4ZDTA 3N9OA 3T7LA 1WGMA 2LQ6A 3EB6A 1WILA 5KH3A 5DINA 4GNGA 2FSAA 2VJEA 1VFYA 2JMJA 4GNEA 5AIUA 3KNVA 3N9NA 3IHPA 2MNZA 2L43A 4YBMA 2NAAA 2LXHC 3O70A 4IC2A 3DQVR 4FJCA 2CSZA 3FL2A 1V87A 1WESA 5H9MA 2H0DA 3DPLR 3NG2A 2ECNA 4N4FA 4BBQA 4UP5A 5AITA 2VJFB 2L5UA 4ZQLA 4A4BA 2CKLA 1WEPA 2Y1MA 2IDAA 3ZPV1 2I50A 4QF2A 3MHSA 3N9PA 2YYRA 4TKPB 2VJEB 5TDWA 2KR4A 2YT5A 1X4JA 1MM3A 4NN2A 2K1JA 3ZTGA 3L1XA 3ZYQA 3VK6A 3SOUA 2YREA 1FBVA 2KWOA 2MT5A
chains in the Genus database with same CATH superfamily
3LLKA 4XPWA 1RXQA 4Q6FA 4YL3A 4DRHB 2YZSA 2HJ3A 4I44A 1HMOA 1V55C 2KU3A 3UGOA 1ZHTA 3OEOA 3AQCA 1T6IA 1CGNA 2RSDA 1OKKA 3HCTA 2HYED 4CX9A 4ZUXU 3O55A 4K7BA 2KKYA 2YHSA 5COGA 3TD7A 1DOWA 3HCSA 3DE8A 3VM6A 3KH2A 3LVQE 1AEPA 1YA9A 3T6JA 2H0DB 3IQTA 1WEQA 1RMVA 3EH1A 3SXMA 2XOYA 3HNJA 2UZGA 3ABKC 5GPGB 1QPUA 2KYHA 2P0NA 2KK1A 4F4BA 2M1RA 2J9BA 1FMWA 1K2FA 1GM5A 4EIYA 3O37A 4AX2A 2F6JA 2ECGA 2FD4A 4I7DA 4BEMJ 4JIOA 2DYRC 1ST6A 1LKXA 1ZYRF 4KNVA 2LP4A 3A11A 4X3GA 4IWBA 5TRBA 2ECTA 3K66A 3Q7GA 2LCHA 2HV6A 2NSGA 2F22A 2WZLA 2YVKA 2A69F 4A4AA 2CGEA 4FO9A 5KYWA 5FZTA 2D8SA 2KYUA 3RQGA 5FERA 3MX3A 4G78A 5H1TA 3DAGA 3SHBA 1M2VB 2AWYA 2PP4A 4CJGA 4YL0A 2CNWD 1MBMA 2EPOA 3Q6NA 5KYYB 3LEVA 3AG2C 3NYJA 4LDKA 3ECSA 4O64A 4KI2A 1VD4A 1K40A 5EGYA 3K7DA 2FFHA 5L0DA 2PNXA 2GFHA 3GV4A 2YHOA 2L81A 1R4TA 2CKLB 2X51A 4MSXA 4JRZA 3FAPB 2KQ9A 3FDQA 1VTMP 4WA6A 4NQFA 2EGPA 4MS2A 2ZD9A 3PURA 2RD9A 5A6BA 3FMSA 5JRAA 3K1IC 2Y3BA 2XL4A 1M57C 4U5GA 3M62A 3HJCA 1OW7A 2Q4FA 3ZVYA 2VP7A 4A2NB 2B0HA 2XL8A 3HNIA 3U5SA 4DJ9A 3PUQA 3W4YA 1LPEA 3JT1A 3JSEO 2XRHA 2BC5A 3MLGA 1D0YA 1N1CA 3O39A 5FEYA 2KJGA 1Z6AA 5E3AA 1QLEC 1QQ3A 1ZW3A 3K1HA 3U8PA 3FVYA 3LJUX 3SOWA 3FM8C 1LE2A 3KYJA 3UMIA 4P9TA 1W2WA 3LVRE 4H4KC 2YQLA 4PACA 3L34A 2G3VA 2LQGA 3B0PA 3TOMA 4YAXA 2KGGA 2WL8A 3OA1A 2R7UA 2CSVA 5L0GA 2MIQA 3AQBA 4QQ4A 3T4RA 1TWCA 4BJ6A 3RW0A 3IHUA 4C3DA 3MBGA 2LAUA 4W4UA 3JYHA 4Z0RA 3NG1A 3EQLF 3H2VA 4XEVA 5CI9A 4PPEA 1WGWA 2J46A 2YLGA 1U6GB 2LGKA 2M4EA 4R2YA 2IOQA 2Y43A 1E4UA 2LGGA 2Q9CA 4E17A 2XEUA 4BG0A 4U5HA 3V43A 3C7JA 1FAPB 5F28E 3O47A 1T6UA 4J7TA 4V3LC 2C04A 1S7ZA 1WENA 4J7YA 4D4NA 2CSYA 2ZXWC 4O6YA 2EODA 3ITFA 1O87A 2JMIA 1JR8A 4YT4A 1G4US 2KWNA 4V3KC 5FB1A 4IC3A 2CT2A 1WOLA 2Y3GA 3ZQYA 4MVQA 3JSZA 3B0VC 1KU2A 4UDVA 4A0CD 4PJMA 4LK9A 3U3BA 2E6SA 1ZHWA 4L7XA 2EPKX 3ZDLA 2NUTB 5B78A 1E84A 2IBFA 1Z7Qc 1TQGA 4ULVA 2ECVA 5BQHA 4ZLDA 5JT4A 5H1VA 2A0UA 2A6EF 2OXQC 2J7PA 3RKOF 4OIQF 2M13A 3MHHA 4CBEA 3G50A 2J9VA 1E83A 4M63A 2OOCA 4G7OF 1TWGA 3N9QA 2MD7B 5TABA 1SF8A 2EIKC 4O62A 3GM1A 1HY5A 2M64A 2HDPA 4ZDTA 3POVA 1R5ID 1WGMA 3EH2A 3UR3C 2UUHA 3EB6A 2VASA 5KH3A 4AL1A 2KW3C 3LUTB 5JSLA 4RDAA 4EUKB 1PD1A 2J0XA 4IAOA 1VFYA 5AIUA 1L3PA 2DGJA 2AU5A 1HMDA 2LXHC 4IC2A 4XEKA 3FL2A 5E3CA 3DPLR 1YAUO 3NG2A 5KYXA 1C17M 4N4FA 4BBQA 5E2QA 2B0JA 2CCYA 2VJFB 3SXZA 2CKLA 1WEPA 2IDAA 3MHSA 1ZHZA 3N9PA 5TDWA 3RYLA 3WAQA 1ZW2A 2K1JA 4NTAA 1VLTA 5AC5A 3ZTGA 3FANA 2PFDA 4CS8A 2AVKA 5KYXB 1FBVA 4KC9A 3ZIBA 1PV3A 3DM9B 2H7BA 4WGZA 5L0JA 3RQFA 4NC3A 1NG1A 4GNFA 2YU4A 4GNDA 2MHRA 4Z9JA 3S9OA 2VNFA 3N9LA 2NG1A 1JPNA 1HE1A 4YL1A 5KYNA 4HE8D 5A6KA 1D1BA 2Z15A 3W8HA 1HYIA 1EA8A 4ZLCA 1BORA 1GQAA 2JMDA 4MVSA 3W8IA 3CZ6A 4EKWA 4N3WA 3I5PA 3OWTA 2QJ0A 3L0IA 4XWJA 2IXPA 2Q3TA 3HLZA 1D1AA 2VH3A 2HUJA 2DSMA 3LQIA 5BUOA 4QI2A 2DX8A 4GQHA 3T6BA 4YBSA 1OR3A 2CRRA 3EZIA 3IQ6A 3ASLA 3U2MA 3KL4A 2GWWA 2R05A 3R2PA 1YA7O 3LAYA 5B77A 5HSWA 3LQHA 2A6HF 5FCLA 5BQGA 5G05B 4U5FE 3JRTA 3TJ6A 2J9UA 1KNYA 4IRUA 4IJJA 3N24A 3QW0A 3SNHA 3JUEA 1TR2A 2GA0A 2PX0A 1CGOA 3TULA 1DCQA 3SOXA 2YQMA 1M56C 4LDQA 4WJ0A 4CCGX 3S29A 3ZG1A 4YT5A 1E86A 3EGDA 2KC3A 2R7XA 3T6RA 2ECWA 4S3OB 1MMGA 2L6FA 3E2DA 1JOCA 2RR4A 2JPUA 3V5YA 4I7BA 1WEMA 1BBHA 3MYFA 2WVOA 2LGLA 3C8ZA 3PMRA 5L0HA 1V54C 1VMAA 1E85A 4PR9A 2EPMX 2HSBA 3IPMO 4B86C 3US6A 3C6WA 2VPEA 4C9ZA 1YZCA 2EILC 2LXPC 3U5OA 3T6GB 2MYSA 4NCQA 5DS5A 5KYWB 2ZXOA 3DMDA 4CS9C 3AGUA 2OEXA 4O6MA 1A7VA 2D8UA 4NTFA 1AUEA 3SZRA 2V3CC 1O3UA 2F6NA 1GS9A 1ZU4A 2Q00A 1GGQA 5TDRA 4AK9A 5TBNA 5B76A 1IYMA 3ZVRA 4WZ0A 3K33A 3U5PA 1QVXA 1CHCA 4I7CA 4XLPF 1T6QA 4AYCA 3JRMO 2VCAA 3TQOA 4XI1A 4YADA 1MNEA 4CDYA 4ANJA 4BHWA 2W4BA 4R8PK 4IARA 4YK5A 5A6BD 3EB5A 4AE4B 1NU7D 3L1MA 4MW8A 2YUCA 2XSEA 1YYXA 4IGGA 2MUMA 4EBBA 1WE9A 1TFOB 3ZSUA 2XLWA 2KKXA 5LKXA 2LFFA 3U5MA 4E7ZA 1YYJA 2L9JA 5A69A 2UUIA 2C2VS 3FAOA 3M63A 3SEOA 2YVRA 3HCUA 1UG7A 3E9VA 3LESA 3KDEC 4N4WA 2MA5A 2OQMA 1C03A 5SVYA 3ASNC 3U9JA 3GL6A 3EG9A 4YT2A 1F62A 5JG6A 2YL0A 4YWQA 2L0BA 5D1KB 3KQIA 3X2QC 2A0BA 1JAFA 2HZ8A 4JURI 1NBBA 1I5NA 3L8JA 4XTKA 3LNMB 4MNDA 3NMJA 1PCXA 4LJNA 4DXWA 1Q0FA 3NKEA 3HKKA 1A7DA 3WHNA 3TJ5A 5AC4A 2J9WA 4EBKA 5CIVA 2WZFA 1FNTc 1XWJA 4AP4A 1OXBA 5L3QA 3CAXA 1O5HA 4MVOA 3N9MA 3JYYA 3ABMC 1FFTC 1EI7A 4B7YC 3VF0A 4JCZA 2Y3HA 3DXJF 3LDYA 2EPLX 4X0RA 2P6VA 2QTVA 2IM8A 2KE1A 1T1HA 3U9MA 5LCWB 1BZ4A 2R9RB 2JD3A 5A6AA 1YDIA 4HFKB 1WEWA 2XL6A 3M15A 2E87A 1WEEA 2HJMA 4YC9A 3EHMA 1Z2QA 2H8AA 1AVOB 1APCA 2WB7A 4AUQB 5F5FA 4OGCA 2IYLD 4W8KA 3O33A 2ECIA 5T3TA 3H65A 4R32A 2NUPA 4MVMA 3U8VA 2OU6A 1Z5ZA 2GAQA 3L11A 3MDBC 3BEHA 3T9OA 3I5QA 3T7LA 4K0DA 3U3FA 1LE4A 2NUTA 1TWHA 256BA 2EINC 2MWQA 1WILA 1BDJB 1F1MA 4I3MA 3SYNA 3DZAA 1K05A 2QY9A 2R02A 4DRIB 2JMJA 4GNEA 4P6IC 3IHPA 3N9NA 5JLIA 3NRHA 2MNZA 3MYIA 3CSKA 1EKYA 4N06A 1V87A 2W45A 5CI8A 2H0DA 4K1OA 5H9MA 2QLAA 1J8YF 2ECNA 3PLWA 2L5UA 4O7GA 4LLCA 2Y1MA 2I50A 3C18A 4TKPB 3RF3A 3H7HA 1WWPA 2KR4A 2YT5A 1X4JA 4DOZA 4NN2A 3V7OA 1TFKB 3FJUB 1TKNA 1NZEA 4JC7A 3ZQVA 2YREA 2MT5A 2XLVA 1OQCA 1Z63A 4E18A 1E2XA 3QVYA 1CPQA 1YZAA 4XEFA 3PHDA 3J06A 5JP7A 3K6BA 1JMWA 2R7RA 3NKDA 2YSJA 3EG9B 4CIPA 2R7VA 2M6MA 3S84A 2EPNA 3DWWA 3KKBA 2BAYA 1MMAA 1VYIA 1LI7A 4CSAC 2W9YA 2A68F 1ORSC 2KWJA 3AG3C 5B1BC 2DYSC 2EIMC 1PD0A 2ZPAA 3C5KA 4QI0A 1FMVA 2XB1A 1FTSA 2OG2A 3JCUQ 4BJ1A 4WABA 1YLMA 2YURA 2Y39A 2LIGA 2C2LA 1OW6A 2VJFA 1T01A 1VOMA 2KSFA 2R7TA 3C63A 4LKAA 1WEOA 3LLIA 5B3IA 4P5OB 4JVSA 1VYXA 4H9DA 3GWNA 3ZTMA 2PX3A 3MFNA 5I3LA 3K1IA 1JM7A 5KYYA 1T5OA 1IZMA 2EGMA 3M7KA 4LERA 1YVIA 1LS4A 4MTFA 3O34A 3RTRB 2PUYA 3FXHA 4KNWA 2HFIA 2FGYA 2Y3DA 3KV6A 4YT8A 2G43A 3VYWA 4AVXA 1HW1A 2ASRA 3SP1A 5FB0A 4YATA 1MQVA 3AJMA 1N87A 2EA6A 2F42A 3QZVA 1OKKD 4CA1A 1OCOC 4H54A 1XZQA 2L6HA 2YL3A 4U9EA 4MQ9F 3ASOC 3NMIA 1MM2A 2G6QA 1WEVA 4PTBA 4YABA 4BJ6C 4YN0B 3UMHA 5C11A 1VB5A 2OKUA 1X4UA 2ECJA 2YL1A 1U0BB 3Q1DA 5B1AC 4DVZA 2DJAA 2R7QA 5BQIA 2FUIA 4FAPB 3C8GD 1L7CA 2RI7A 3QMKA 2JM3A 1WN0A 1RJ9B 4BJ5C 1D0XA 1A7EA 3EFOA 2M3HA 5IY5C 1LDKC 2TMVP 2VPGA 1I4ZA 4UI9B 2K17A 2KGOA 2PBEA 5L0FA 2MA6A 3M79A 3T9KA 1SZIA 4J30B 5B3SC 4OD5A 4CDVA 1RCPA 4G0HA 1J8MF 3GEEA 4CIHA 1A0BA 5KH7A 2J8WA 4ULWA 5G04B 1BR4A 5T1DB 5KH9A 1A41A 4GB0A 1HE9A 3RQEA 2YEVA 5C13A 4EHPA 4AYCB 3G4XA 1SMYF 1ZBDB 2XS1A 3AG4C 1LI5A 3ATPA 4LLBA 2BL2A 3GWLA 4MTOA 2LD6A 4Q4ZF 3E70C 3S0XA 2R7SA 2ZXRA 1LVKA 1OR2A 2Y1NA 2XXAB 2ZXPA 4BPMA 4I1MA 1LDJB 2YHNA 3N0TA 3RVZA 3U5NA 3V5XA 1NLXA 4BEJA 5DS4A 1QZXA 1ZU5A 3RH3A 2OJED 4MVRA 3QW1A 3L1ZB 4RBNA 3O6XA 2M85A 2LSEA 4D4XA 2D4UA 5B75A 3PDMP 2KGIA 1ZHYA 2JRJA 2CRWA 3ZVZB 2K16A 4CS8C 3FHDA 3ZNIA 1HW2A 1SR2A 3EGXA 4QDLA 4JE9A 2CW0F 4JZAA 2AP3A 3B71A 1RKEB 1G8XA 1Y6DA 1ORJA 3UNGC 3LQJA 5TJ5E 3ZPVE 2R7WA 2IXNA 1FR0A 4U5BE 4FK5A 1Y4CA 2E6RA 3NYMA 1NU9C 3EHNA 3EZHA 3LS1A 4KBLA 2YLDA 1V4AA 3B0UX 3FOPA 3NYLA 3Q7LA 3Q6MA 2VPDA 4PFPA 2MNYA 3VAYA 4LACB 2AWCA 2IQJA 3M4CA 5D91A 1VLSA 3S27A 3HTKC 2HV7A 2YLIA 3IEEA 2KFTA 2LGVA 4UP0A 3BRJA 4Z9HA 4DBRA 2NUPB 5KYUA 2HMQA 2OEVA 2G62A 1WTYA 3B29A 4FWVA 5DINA 2KNHA 4PJLA 4PFOA 4GNGA 3TK0A 3DM5A 4MTGA 2NPUA 2HKVA 1V74B 3WODF 2L43A 2H7VC 3DQVR 2XOZA 4FJCA 2CSZA 2P57A 4CS9A 1QSPA 5L0IA 5SVIA 2WZGA 2IXMA 4JTCB 4UP5A 2R25A 3TOLA 5F5HA 5AITA 4E7SA 2YKZA 4XLNF 1SYQA 4ZQLA 4AL0A 4A4BA 1MMDA 4B6IA 2R7OA 4LDRA 5DVWA 1OCZC 3HNKA 3PHF2 4EWCA 3IQCA 3U2LA 4YJWA 1MNDA 5K0IA 3W2VA 1VYKA 4GEHA 1JRAA 2EXUA 3ZYQA 3DE9A 3VK6A 1K04A 2KWOA 3GM3A 1JPJA 5D1LB 2L80A 2BE5F 3WG7C 3M99A 3I2DA 2G3KA 3EGDB 4ER9A 2LRIC 3GODA 4P9FA 5K3QA 2HS5A 3EJNA 2CNWA 1OCCC 1M6TA 3G4ZA 4F52B 2YWAA 3AOUA 4JTAB 4CDAA 2XM4A 3O35A 1LM3B 1NFOA 3I4UA 2XLMA 4OD4A 5LKZA 2VCCA 2X0CA 4ONSA 2VCBA 2OWAA 1G25A 4L6RA 1YJGA 5J3XA 4L58A 2HMZA 3LRQA 3DKAA 4Z0OA 5D92A 2OJQA 3FEHA 3SUBA 4DVYP 3JTLO 4S3OC 3DI5A 2HSQA 4O6NA 4Q5SF 1OW8A 4A49A 4YBTA 3QZCA 2LV9A 2XOCA 5SVXA 1OXKA 5JS5A 2AN6A 2I8BA 3CEXA 3W2WA 4DRJB 2WVQA 3SXYA 1U89A 4O79A 1UFBA 4G7ZF 1T9KA 1H9GA 2QE9A 4MW3A 1Z60A 3HNLA 4IAQA 3ABLC 1X4IA 1BR1A 1VK5A 4FIPA 3DWDA 4NY3A 1NFNA 5HV9A 1YARO 4J32B 3DAFA 4U5DE 3RPGC 3RPGB 5JVEA 3V5ZA 4GYTA 2A1DD 4XPYA 1XZPA 4JEBA 3FAJA 2O9XA 4C3EA 3M4BA 3F46A 2KIZA 3DJUB 3LS0A 3M1CB 2XLDA 5A6JA 4HFFB 3R7CA 2VPBA 3ZTZA 1ORYA 5KYUB 2JX0A 4A4CA 3O36A 3GEIA 4U9DA 3ZWIA 2J45A 2NSFA 2CYDA 1M2OA 2MKEA 1WFKA 5COFA 2Q7RA 4JJGA 4JCHA 4PK4A 3RFYA 2ICWG 2Q9BA 5DKAA 5EYAF 2L7AA 1Z3IX 2ETSA 2CDQA 3F47A 3JZ0A 3KV5A 5COMA 2YW8A 1FP0A 3C8GA 2XM0A 2K4DA 2PNOA 3KMIA 2LDRA 3KPHA 3EFOB 2XLHA 2QICA 2XP0A 5H1UA 3C8GB 2J7PD 3U0CA 1Z6UA 5SVIB 4N6HA 1DVPA 4W8PA 4IB4A 2VC9A 2W4MA 3LNRA 1G4WR 1S05A 2LN0A 1ZVZA 4R7EA 1H9TA 4C7OA 2P1AA 1WASA 2QIZA 3L8IA 4DBQA 1M2VA 4G7HF 2JUNA 4F1PA 4LADB 4OIOF 5D1MB 1WIMA 5L0CA 4CSAA 3IQ5A 1RJ9A 1Q0MA 4I1OB 3NDBB 3NMKA 5G0FA 2WVNA 1HYJA 3N2ZB 2J0WA 2P61A 4N6CA 1RMDA 3SXKA 2GDCA 2L7PA 3EGXB 3DD7A 2L6GA 1ZZPA 2ZETC 1TWAA 2KREA 1IW7F 4Q7CA 4NTBA 4PJNA 1RKEA 5DS6A 5B8DA 5DQTA 1XWHA 4CS7A 4JTDB 1JOGA 4FESA 4WZ3B 1Q0KA 5EHHA 2YRFA 2QUPA 2QNLA 3UGPA 2C03A 5DQZA 3A9CA 2H7OA 2OCCC 1H6GA 2DB4A 2I15A 4WGYA 2XLOA 3DDTA 3PCVA 3O7AA 4MVTA 3QVZA 2CONA 4OINF 4Z9IA 3C62A 5T3WA 2FFWA 4PJJA 2P7VA 2L75A 1WEUA 2LK4A 3GM2A 1C02A 1OCRC 1D1CA 4JKVA 5E33A 5LKUA 4JW1A 2LFDA 4JJFA 4WZ2A 1JM7B 5JUAA 3LJBA 2G45A 3CQZA 4BJTA 4OIPF 5AGFA 3VRCA 4XQ1A 5LKTA 4OGEA 1ZHXA 4E0IA 4OIRF 3LEOA 3S28A 1G5ZA 2YSMA 1CPRA 1WATA 2DI3A 1FFHA 1H7IA 1DOVA 1U6HA 4QF3A 3ZC4A 1NSGB 2FUUA 3GORA 2B0OE 2KWKA 1MMNA 1Q0GA 2Q9AA 1CGME 2MD8C 3KYIA 3QTHA 4RD9A 4MVZA 1RKCA 4FX5A 4HEAJ 2R03A 5B79A 2IXOA 2Y69C 1B68A 3X1OA 4MVUA 3N9OA 1I4YA 5EK0A 2FAPB 2LQ6A 1EQ1A 3AG1C 2D5RB 4U5EE 2RSEB 2V26A 3RVYA 2FSAA 2VJEA 1Z23A 4XPXA 4EBJA 3DJNB 3KNVA 4YBMA 2VB6A 2NAAA 3O70A 4CJOA 3FOOA 3O10A 2PF4E 2XS8A 2YQYA 1WESA 4C3BA 3S90A 2YL7A 3GEHA 3AGTA 3GANA 1D0ZA 3UMKA 3H2UA 4U5CE 1LS1A 3ZPV1 1BR2A 1QKRA 1Q0DA 4QF2A 2YYRA 5DLJA 2VJEB 4JEAA 2EIJC 4AE4A 4LLEA 4C7OB 2XXAA 1MM3A 5L3VA 2E61A 4BJ5A 3L1XA 3RIPA 1KTMA 1LIHA 4E0HA 3SOUA 3B9QA 3EPVA 2XLEA
chains in the Genus database with same CATH topology
5D1LB 2L80A 3LLKA 2BE5F 1NG1A 4GNFA 2YU4A 4GNDA 4Q6FA 3WG7C 2VNFA 3M99A 3N9LA 3I2DA 3PHDA 2G3KA 2YZSA 3EGDB 2NG1A 4I44A 3K6BA 2LRIC 1JPNA 3GODA 2R7RA 1V55C 3NKDA 5KYNA 4HE8D 3EJNA 2KU3A 2YSJA 2CNWA 3UGOA 1OCCC 1ZHTA 1D1BA 2Z15A 3AQCA 3OEOA 3W8HA 1HYIA 3EG9B 2R7VA 4ZLCA 1BORA 2RSDA 1OKKA 2JMDA 2M6MA 3HCTA 3W8IA 4F52B 2HYED 3CZ6A 4N3WA 4ZUXU 3KKBA 2BAYA 4K7BA 1MMAA 3I5PA 3OWTA 2QJ0A 3O35A 2YHSA 1VYIA 4CSAC 3I4UA 2W9YA 2A68F 3TD7A 2KWJA 3HCSA 3AG3C 4OD4A 5B1BC 3L0IA 5LKZA 4XWJA 2IXPA 2Q3TA 3KH2A 2DYSC 3HLZA 2EIMC 1D1AA 2VH3A 1PD0A 1G25A 3T6JA 5J3XA 4L58A 3LRQA 3LQIA 5BUOA 4QI2A 2ZPAA 3C5KA 4QI0A 2DX8A 1FMVA 5D92A 1WEQA 2H0DB 3EH1A 3T6BA 2XB1A 4YBSA 1FTSA 2OG2A 3JCUQ 4BJ1A 2UZGA 3EZIA 3ABKC 4DVYP 2Y39A 2YURA 2C2LA 3ASLA 2VJFA 3KL4A 4S3OC 4F4BA 4O6NA 1VOMA 2M1RA 4Q5SF 3LAYA 1FMWA 2R7TA 1K2FA 5B77A 5HSWA 4LKAA 1WEOA 3O37A 3LQHA 2A6HF 4AX2A 3LLIA 5FCLA 2F6JA 4A49A 2ECGA 4P5OB 4YBTA 4I7DA 4JVSA 3QZCA 1VYXA 2LV9A 5G05B 4U5FE 3JRTA 2J9UA 2PX3A 2DYRC 1ST6A 5I3LA 1LKXA 1ZYRF 2I8BA 4KNVA 2AN6A 1JM7A 4IRUA 5KYYA 4IJJA 3N24A 3W2WA 4IWBA 3SNHA 1IZMA 4X3GA 2ECTA 5TRBA 1TR2A 3K66A 2PX0A 2WVQA 3Q7GA 4O79A 2HV6A 4LERA 3SOXA 4G7ZF 3O34A 2WZLA 1Z60A 2A69F 2YQMA 2PUYA 3RTRB 1M56C 2CGEA 4WJ0A 4KNWA 4FO9A 4CCGX 3S29A 3ABLC 3ZG1A 1X4IA 1BR1A 1VK5A 2FGYA 5KYWA 4FIPA 2D8SA 4NY3A 2Y3DA 4YT5A 3EGDA 3KV6A 2R7XA 2KYUA 4YT8A 3T6RA 2G43A 3VYWA 4AVXA 2ECWA 4S3OB 1MMGA 5FERA 3MX3A 4J32B 3DAFA 5H1TA 3SP1A 4U5DE 1JOCA 3DAGA 5FB0A 3RPGC 4YATA 3RPGB 3SHBA 4I7BA 1WEMA 1M2VB 2PP4A 4GYTA 2A1DD 1N87A 2EA6A 2WVOA 3FAJA 2LGLA 2O9XA 4C3EA 2CNWD 2F42A 3Q6NA 5KYYB 3PMRA 3LEVA 1V54C 1VMAA 3AG2C 3NYJA 3ECSA 3QZVA 4O64A 4KI2A 3F46A 2KIZA 1VD4A 1OKKD 4CA1A 5EGYA 1OCOC 4B86C 3K7DA 2FFHA 3DJUB 2PNXA 2GFHA 3C6WA 3GV4A 3LS0A 3M1CB 2YHOA 2L81A 2VPEA 4MQ9F 3ASOC 4HFFB 4C9ZA 2EILC 1MM2A 2CKLB 2LXPC 2VPBA 3U5OA 2G6QA 5KYUB 2X51A 4MSXA 2MYSA 4A4CA 3O36A 1WEVA 4PTBA 5DS5A 4YABA 4BJ6C 5KYWB 2KQ9A 3FDQA 4WA6A 4YN0B 2ZXOA 2J45A 2EGPA 3UMHA 5C11A 1M2OA 3PURA 3DMDA 1WFKA 4CS9C 4O6MA 4JJGA 4JCHA 4PK4A 3RFYA 1X4UA 3SZRA 2V3CC 2Q9BA 3K1IC 5DKAA 2ECJA 5EYAF 2Y3BA 1Z3IX 2XL4A 5B1AC 2F6NA 2CDQA 3F47A 1M57C 3KV5A 2YW8A 4DVZA 1ZU4A 4U5GA 2R7QA 1FP0A 3M62A 3HJCA 2FUIA 2K4DA 5TDRA 3KMIA 4AK9A 2LDRA 3ZVYA 2RI7A 2VP7A 5TBNA 3EFOB 4A2NB 3QMKA 2QICA 5B76A 1IYMA 3ZVRA 4WZ0A 3K33A 3PUQA 3U5PA 5H1UA 2J7PD 1CHCA 1RJ9B 4I7CA 3JT1A 4BJ5C 1D0XA 2XRHA 1Z6UA 3MLGA 3EFOA 1D0YA 5IY5C 2M3HA 1LDKC 1DVPA 1N1CA 4XLPF 3O39A 4AYCA 5FEYA 2W4MA 2KJGA 2VPGA 1Z6AA 4XI1A 4UI9B 4YADA 1MNEA 5E3AA 1QLEC 2K17A 3LNRA 2KGOA 3K1HA 3FVYA 3SOWA 2MA6A 4ANJA 4BHWA 1SZIA 2W4BA 4J30B 2LN0A 4R8PK 5B3SC 4OD5A 3EB5A 3UMIA 1NU7D 4AE4B 4G0HA 1J8MF 1W2WA 4R7EA 4CIHA 2YUCA 2XSEA 4H4KC 5KH7A 4C7OA 2MUMA 2YQLA 3L34A 4EBBA 2G3VA 2QIZA 3B0PA 4YAXA 4DBQA 1M2VA 4G7HF 1WE9A 4ULWA 5G04B 1BR4A 3ZSUA 5T1DB 2KGGA 4LADB 2WL8A 3OA1A 4OIOF 2R7UA 5KH9A 2MIQA 4GB0A 3AQBA 5D1MB 5LKXA 1WIMA 2YEVA 4CSAA 5C13A 1RJ9A 3U5MA 4E7ZA 3T4RA 1TWCA 4AYCB 2L9JA 4BJ6A 4I1OB 3NDBB 1SMYF 2C2VS 3M63A 1ZBDB 3AG4C 4C3DA 5G0FA 2WVNA 3SEOA 1HYJA 3N2ZB 4W4UA 4LLBA 2J0WA 3HCUA 3JYHA 1RMDA 3NG1A 3E9VA 3LESA 2MA5A 3EQLF 4Q4ZF 3E70C 3EGXB 3DD7A 3S0XA 2R7SA 2ZXRA 1LVKA 2ZETC 1TWAA 2KREA 1IW7F 4Q7CA 2Y1NA 4PJNA 2XXAB 2ZXPA 4I1MA 5CI9A 1LDJB 4PPEA 5DS6A 1WGWA 2YHNA 3ASNC 3GL6A 3N0TA 3EG9A 4YT2A 5B8DA 1F62A 2J46A 5DQTA 1XWHA 1U6GB 4CS7A 5JG6A 3U5NA 2L0BA 4YWQA 2LGKA 5D1KB 2M4EA 4R2YA 2IOQA 2Y43A 3KQIA 4BEJA 5DS4A 1QZXA 4FESA 4WZ3B 3X2QC 1E4UA 1ZU5A 3RH3A 5EHHA 2LGGA 4JURI 2Q9CA 3L1ZB 4RBNA 4XTKA 3O6XA 2XEUA 4BG0A 3UGPA 2M85A 2LSEA 4U5HA 2C03A 5DQZA 4MNDA 3V43A 5B75A 1PCXA 4LJNA 2KGIA 2H7OA 2OCCC 3NKEA 1ZHYA 2JRJA 4V3LC 3ZVZB 2C04A 1S7ZA 1WENA 3O7AA 4MVTA 2CSYA 2K16A 4CS8C 3FHDA 2J9WA 2ZXWC 2WZFA 4OINF 3ZNIA 4AP4A 4O6YA 2EODA 3ITFA 1O87A 2JMIA 3EGXA 4YT4A 4QDLA 5T3WA 5L3QA 1O5HA 2KWNA 4V3KC 5FB1A 2CW0F 4JZAA 3N9MA 4IC3A 3ABMC 2CT2A 4PJJA 1G8XA 2Y3GA 1FFTC 2P7VA 2L75A 4B7YC 1WEUA 3UNGC 2Y3HA 3LQJA 1OCRC 1D1CA 3DXJF 5E33A 5LKUA 3JSZA 4JW1A 3B0VC 3ZPVE 2R7WA 2IXNA 4X0RA 4JJFA 4WZ2A 1KU2A 2P6VA 2QTVA 4U5BE 2KE1A 1JM7B 1T1HA 2E6RA 4FK5A 4A0CD 3NYMA 3LJBA 5LCWB 4PJMA 1NU9C 2G45A 4LK9A 3CQZA 4BJTA 3EHNA 4OIPF 3EZHA 2JD3A 2E6SA 3LS1A 5LKTA 1ZHWA 4KBLA 3B0UX 4L7XA 1ZHXA 4HFKB 1WEWA 2NUTB 2E87A 4OIRF 1WEEA 5B78A 3S28A 3NYLA 4YC9A 3EHMA 3Q7LA 1Z2QA 3Q6MA 2VPDA 2YSMA 4PFPA 2ECVA 2MNYA 3VAYA 4LACB 2WB7A 4ZLDA 1FFHA 5H1VA 4AUQB 5F5FA 5D91A 2IYLD 2A6EF 3ZC4A 2FUUA 2OXQC 4W8KA 4QF3A 2J7PA 3O33A 3RKOF 2KWKA 1MMNA 3S27A 4OIQF 2Q9AA 2ECIA 5T3TA 3H65A 2MD8C 3HTKC 3MHHA 2HV7A 4CBEA 2NUPA 3IEEA 2J9VA 4M63A 4RD9A 2KFTA 1Z5ZA 4G7OF 1TWGA 4FX5A 2LGVA 4HEAJ 3N9QA 3L11A 2MD7B 4UP0A 5B79A 4DBRA 2NUPB 2IXOA 5KYUA 1SF8A 5TABA 2EIKC 2Y69C 2G62A 3X1OA 3I5QA 2HDPA 4ZDTA 3POVA 3N9OA 3T7LA 1WGMA 4K0DA 2LQ6A 3EH2A 3UR3C 3AG1C 2D5RB 2NUTA 3EB6A 1TWHA 2MWQA 2EINC 2VASA 4FWVA 4U5EE 1WILA 5KH3A 5DINA 2KW3C 4I3MA 2KNHA 4PJLA 4PFOA 3SYNA 4GNGA 2V26A 3DZAA 2FSAA 4RDAA 2QY9A 3DM5A 2VJEA 1PD1A 2J0XA 1Z23A 4IAOA 1VFYA 2JMJA 4GNEA 5AIUA 2DGJA 3DJNB 3KNVA 4P6IC 3IHPA 3N9NA 3WODF 3NRHA 2MNZA 2L43A 4YBMA 2VB6A 2LXHC 2NAAA 2H7VC 3O70A 4IC2A 3DQVR 3CSKA 4FJCA 2PF4E 2CSZA 3FL2A 4N06A 4CS9A 1V87A 1WESA 2W45A 4C3BA 5CI8A 5E3CA 2H0DA 5H9MA 3DPLR 3NG2A 2WZGA 5KYXA 2IXMA 1J8YF 2ECNA 4N4FA 4BBQA 4UP5A 5E2QA 5F5HA 3GANA 2B0JA 5AITA 4E7SA 1D0ZA 2VJFB 4XLNF 2L5UA 4ZQLA 3UMKA 4O7GA 4A4BA 1MMDA 4LLCA 2CKLA 1WEPA 2Y1MA 4U5CE 2IDAA 1LS1A 4B6IA 2R7OA 3ZPV1 1BR2A 2I50A 4QF2A 3MHSA 1ZHZA 3N9PA 2YYRA 4TKPB 5DVWA 5DLJA 2VJEB 1OCZC 3PHF2 2EIJC 4AE4A 5TDWA 3RYLA 4EWCA 2KR4A 4LLEA 2YT5A 4YJWA 4C7OB 1X4JA 2XXAA 4DOZA 1MNDA 1MM3A 4NN2A 5L3VA 2K1JA 3V7OA 3W2VA 3ZTGA 4BJ5A 1VYKA 4GEHA 3L1XA 3RIPA 1TKNA 3ZYQA 1NZEA 3VK6A 2PFDA 4CS8A 3SOUA 5KYXB 3B9QA 3EPVA 2YREA 1FBVA 4KC9A 3ZIBA 2KWOA 2MT5A 3DM9B 2H7BA 1JPJA 1Z63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1L B;  2L80 A;  4GNF A;  2YU4 A;  4GND A;  4Q6F A;  2VNF A;  3M99 A;  3N9L A;  3PHD A;  3I2D A;  2LRI C;  2KU3 A;  2YSJ A;  1HYI A;  1BOR A;  2RSD A;  2JMD A;  2M6M A;  3HCT A;  4F52 B;  2HYE D;  4ZUX U;  4N3W A;  2BAY A;  2QJ0 A;  3O35 A;  2KWJ A;  3HCS A;  5LKZ A;  1G25 A;  5J3X A;  4L58 A;  3LRQ A;  3LQI A;  3C5K A;  2DX8 A;  2H0D B;  1WEQ A;  2XB1 A;  4YBS A;  2UZG A;  2YUR A;  2C2L A;  3ASL A;  2VJF A;  4S3O C;  2M1R A;  1K2F A;  5B77 A;  4LKA A;  1WEO A;  3O37 A;  3LQH A;  2F6J A;  4A49 A;  2ECG A;  4P5O B;  4YBT A;  4I7D A;  1VYX A;  2LV9 A;  5G05 B;  5I3L A;  2AN6 A;  1JM7 A;  4X3G A;  5TRB A;  2ECT A;  3SOX A;  3O34 A;  2YQM A;  1Z60 A;  3RTR B;  2PUY A;  4FO9 A;  4CCG X;  1X4I A;  4FIP A;  2D8S A;  3KV6 A;  2KYU A;  3T6R A;  2G43 A;  4AVX A;  2ECW A;  4S3O B;  5FER A;  5H1T A;  5FB0 A;  1JOC A;  3RPG C;  4YAT A;  3RPG B;  3SHB A;  4I7B A;  1WEM A;  1N87 A;  2EA6 A;  2LGL A;  2F42 A;  3QZV A;  4O64 A;  2KIZ A;  1VD4 A;  4CA1 A;  4B86 C;  2PNX A;  3GV4 A;  3C6W A;  2YHO A;  2VPE A;  4C9Z A;  2CKL B;  1MM2 A;  2LXP C;  2VPB A;  3U5O A;  2G6Q A;  4MSX A;  4A4C A;  3O36 A;  1WEV A;  4PTB A;  4YAB A;  4WA6 A;  2EGP A;  5C11 A;  3PUR A;  1WFK A;  1X4U A;  5DKA A;  2ECJ A;  5EYA F;  2F6N A;  3KV5 A;  2YW8 A;  1FP0 A;  3M62 A;  2FUI A;  2K4D A;  5TDR A;  2LDR A;  3ZVY A;  2RI7 A;  2VP7 A;  5TBN A;  2QIC A;  5B76 A;  1IYM A;  4WZ0 A;  3PUQ A;  3U5P A;  5H1U A;  1CHC A;  4I7C A;  1Z6U A;  2M3H A;  1LDK C;  1DVP A;  4AYC A;  5FEY A;  2VPG A;  4XI1 A;  4UI9 B;  4YAD A;  2K17 A;  3SOW A;  2MA6 A;  4BHW A;  2LN0 A;  4R8P K;  3EB5 A;  4R7E A;  2YUC A;  5KH7 A;  2MUM A;  2YQL A;  2QIZ A;  4YAX A;  1WE9 A;  5G04 B;  2KGG A;  4LAD B;  5KH9 A;  2MIQ A;  4GB0 A;  5D1M B;  5LKX A;  1WIM A;  5C13 A;  3U5M A;  4AYC B;  2C2V S;  3M63 A;  1ZBD B;  5G0F A;  1HYJ A;  4W4U A;  4LLB A;  3HCU A;  1RMD A;  2MA5 A;  2ZET C;  2KRE A;  2Y1N A;  1LDJ B;  4PPE A;  2YHN A;  3GL6 A;  1F62 A;  5B8D A;  1XWH A;  1U6G B;  5JG6 A;  3U5N A;  2L0B A;  2LGK A;  5D1K B;  4R2Y A;  2Y43 A;  3KQI A;  1E4U A;  4WZ3 B;  2LGG A;  3L1Z B;  2XEU A;  2M85 A;  3V43 A;  5B75 A;  4LJN A;  2KGI A;  2JRJ A;  4V3L C;  3ZVZ B;  1WEN A;  3O7A A;  4MVT A;  2CSY A;  2K16 A;  3ZNI A;  4AP4 A;  2EOD A;  2JMI A;  2KWN A;  4V3K C;  5FB1 A;  3N9M A;  4IC3 A;  2CT2 A;  2L75 A;  4B7Y C;  1WEU A;  3LQJ A;  5LKU A;  3ZPV E;  4WZ2 A;  2KE1 A;  1JM7 B;  1T1H A;  2E6R A;  4FK5 A;  4A0C D;  5LCW B;  2G45 A;  4LK9 A;  2E6S A;  5LKT A;  4L7X A;  1WEW A;  1WEE A;  5B78 A;  4YC9 A;  1Z2Q A;  2VPD A;  2YSM A;  2ECV A;  2MNY A;  5H1V A;  4AUQ B;  4QF3 A;  2FUU A;  2OXQ C;  3O33 A;  2KWK A;  2ECI A;  2MD8 C;  3HTK C;  3MHH A;  2KFT A;  2LGV A;  3N9Q A;  3L11 A;  2MD7 B;  4UP0 A;  5B79 A;  5TAB A;  2HDP A;  4ZDT A;  3N9O A;  3T7L A;  1WGM A;  2LQ6 A;  3EB6 A;  1WIL A;  5KH3 A;  5DIN A;  4GNG A;  2FSA A;  2VJE A;  1VFY A;  2JMJ A;  4GNE A;  5AIU A;  3KNV A;  3N9N A;  3IHP A;  2MNZ A;  2L43 A;  4YBM A;  2NAA A;  2LXH C;  3O70 A;  4IC2 A;  3DQV R;  4FJC A;  2CSZ A;  3FL2 A;  1V87 A;  1WES A;  5H9M A;  2H0D A;  3DPL R;  3NG2 A;  2ECN A;  4N4F A;  4BBQ A;  4UP5 A;  5AIT A;  2VJF B;  2L5U A;  4ZQL A;  4A4B A;  2CKL A;  1WEP A;  2Y1M A;  2IDA A;  3ZPV 1;  2I50 A;  4QF2 A;  3MHS A;  3N9P A;  2YYR A;  4TKP B;  2VJE B;  5TDW A;  2KR4 A;  2YT5 A;  1X4J A;  1MM3 A;  4NN2 A;  2K1J A;  3ZTG A;  3L1X A;  3ZYQ A;  3VK6 A;  3SOU A;  2YRE A;  1FBV A;  2KWO A;  2MT5 A; 
#chains in the Genus database with same CATH topology
 3LLK A;  4XPW A;  1RXQ A;  4Q6F A;  4YL3 A;  4DRH B;  2YZS A;  2HJ3 A;  4I44 A;  1HMO A;  1V55 C;  2KU3 A;  3UGO A;  1ZHT A;  3OEO A;  3AQC A;  1T6I A;  1CGN A;  2RSD A;  1OKK A;  3HCT A;  2HYE D;  4CX9 A;  4ZUX U;  3O55 A;  4K7B A;  2KKY A;  2YHS A;  5COG A;  3TD7 A;  1DOW A;  3HCS A;  3DE8 A;  3VM6 A;  3KH2 A;  3LVQ E;  1AEP A;  1YA9 A;  3T6J A;  2H0D B;  3IQT A;  1WEQ A;  1RMV A;  3EH1 A;  3SXM A;  2XOY A;  3HNJ A;  2UZG A;  3ABK C;  5GPG B;  1QPU A;  2KYH A;  2P0N A;  2KK1 A;  4F4B A;  2M1R A;  2J9B A;  1FMW A;  1K2F A;  1GM5 A;  4EIY A;  3O37 A;  4AX2 A;  2F6J A;  2ECG A;  2FD4 A;  4I7D A;  4BEM J;  4JIO A;  2DYR C;  1ST6 A;  1LKX A;  1ZYR F;  4KNV A;  2LP4 A;  3A11 A;  4X3G A;  4IWB A;  5TRB A;  2ECT A;  3K66 A;  3Q7G A;  2LCH A;  2HV6 A;  2NSG A;  2F22 A;  2WZL A;  2YVK A;  2A69 F;  4A4A A;  2CGE A;  4FO9 A;  5KYW A;  5FZT A;  2D8S A;  2KYU A;  3RQG A;  5FER A;  3MX3 A;  4G78 A;  5H1T A;  3DAG A;  3SHB A;  1M2V B;  2AWY A;  2PP4 A;  4CJG A;  4YL0 A;  2CNW D;  1MBM A;  2EPO A;  3Q6N A;  5KYY B;  3LEV A;  3AG2 C;  3NYJ A;  4LDK A;  3ECS A;  4O64 A;  4KI2 A;  1VD4 A;  1K40 A;  5EGY A;  3K7D A;  2FFH A;  5L0D A;  2PNX A;  2GFH A;  3GV4 A;  2YHO A;  2L81 A;  1R4T A;  2CKL B;  2X51 A;  4MSX A;  4JRZ A;  3FAP B;  2KQ9 A;  3FDQ A;  1VTM P;  4WA6 A;  4NQF A;  2EGP A;  4MS2 A;  2ZD9 A;  3PUR A;  2RD9 A;  5A6B A;  3FMS A;  5JRA A;  3K1I C;  2Y3B A;  2XL4 A;  1M57 C;  4U5G A;  3M62 A;  3HJC A;  1OW7 A;  2Q4F A;  3ZVY A;  2VP7 A;  4A2N B;  2B0H A;  2XL8 A;  3HNI A;  3U5S A;  4DJ9 A;  3PUQ A;  3W4Y A;  1LPE A;  3JT1 A;  3JSE O;  2XRH A;  2BC5 A;  3MLG A;  1D0Y A;  1N1C A;  3O39 A;  5FEY A;  2KJG A;  1Z6A A;  5E3A A;  1QLE C;  1QQ3 A;  1ZW3 A;  3K1H A;  3U8P A;  3FVY A;  3LJU X;  3SOW A;  3FM8 C;  1LE2 A;  3KYJ A;  3UMI A;  4P9T A;  1W2W A;  3LVR E;  4H4K C;  2YQL A;  4PAC A;  3L34 A;  2G3V A;  2LQG A;  3B0P A;  3TOM A;  4YAX A;  2KGG A;  2WL8 A;  3OA1 A;  2R7U A;  2CSV A;  5L0G A;  2MIQ A;  3AQB A;  4QQ4 A;  3T4R A;  1TWC A;  4BJ6 A;  3RW0 A;  3IHU A;  4C3D A;  3MBG A;  2LAU A;  4W4U A;  3JYH A;  4Z0R A;  3NG1 A;  3EQL F;  3H2V A;  4XEV A;  5CI9 A;  4PPE A;  1WGW A;  2J46 A;  2YLG A;  1U6G B;  2LGK A;  2M4E A;  4R2Y A;  2IOQ A;  2Y43 A;  1E4U A;  2LGG A;  2Q9C A;  4E17 A;  2XEU A;  4BG0 A;  4U5H A;  3V43 A;  3C7J A;  1FAP B;  5F28 E;  3O47 A;  1T6U A;  4J7T A;  4V3L C;  2C04 A;  1S7Z A;  1WEN A;  4J7Y A;  4D4N A;  2CSY A;  2ZXW C;  4O6Y A;  2EOD A;  3ITF A;  1O87 A;  2JMI A;  1JR8 A;  4YT4 A;  1G4U S;  2KWN A;  4V3K C;  5FB1 A;  4IC3 A;  2CT2 A;  1WOL A;  2Y3G A;  3ZQY A;  4MVQ A;  3JSZ A;  3B0V C;  1KU2 A;  4UDV A;  4A0C D;  4PJM A;  4LK9 A;  3U3B A;  2E6S A;  1ZHW A;  4L7X A;  2EPK X;  3ZDL A;  2NUT B;  5B78 A;  1E84 A;  2IBF A;  1Z7Q c;  1TQG A;  4ULV A;  2ECV A;  5BQH A;  4ZLD A;  5JT4 A;  5H1V A;  2A0U A;  2A6E F;  2OXQ C;  2J7P A;  3RKO F;  4OIQ F;  2M13 A;  3MHH A;  4CBE A;  3G50 A;  2J9V A;  1E83 A;  4M63 A;  2OOC A;  4G7O F;  1TWG A;  3N9Q A;  2MD7 B;  5TAB A;  1SF8 A;  2EIK C;  4O62 A;  3GM1 A;  1HY5 A;  2M64 A;  2HDP A;  4ZDT A;  3POV A;  1R5I D;  1WGM A;  3EH2 A;  3UR3 C;  2UUH A;  3EB6 A;  2VAS A;  5KH3 A;  4AL1 A;  2KW3 C;  3LUT B;  5JSL A;  4RDA A;  4EUK B;  1PD1 A;  2J0X A;  4IAO A;  1VFY A;  5AIU A;  1L3P A;  2DGJ A;  2AU5 A;  1HMD A;  2LXH C;  4IC2 A;  4XEK A;  3FL2 A;  5E3C A;  3DPL R;  1YAU O;  3NG2 A;  5KYX A;  1C17 M;  4N4F A;  4BBQ A;  5E2Q A;  2B0J A;  2CCY A;  2VJF B;  3SXZ A;  2CKL A;  1WEP A;  2IDA A;  3MHS A;  1ZHZ A;  3N9P A;  5TDW A;  3RYL A;  3WAQ A;  1ZW2 A;  2K1J A;  4NTA A;  1VLT A;  5AC5 A;  3ZTG A;  3FAN A;  2PFD A;  4CS8 A;  2AVK A;  5KYX B;  1FBV A;  4KC9 A;  3ZIB A;  1PV3 A;  3DM9 B;  2H7B A;  4WGZ A;  5L0J A;  3RQF A;  4NC3 A;  1NG1 A;  4GNF A;  2YU4 A;  4GND A;  2MHR A;  4Z9J A;  3S9O A;  2VNF A;  3N9L A;  2NG1 A;  1JPN A;  1HE1 A;  4YL1 A;  5KYN A;  4HE8 D;  5A6K A;  1D1B A;  2Z15 A;  3W8H A;  1HYI A;  1EA8 A;  4ZLC A;  1BOR A;  1GQA A;  2JMD A;  4MVS A;  3W8I A;  3CZ6 A;  4EKW A;  4N3W A;  3I5P A;  3OWT A;  2QJ0 A;  3L0I A;  4XWJ A;  2IXP A;  2Q3T A;  3HLZ A;  1D1A A;  2VH3 A;  2HUJ A;  2DSM A;  3LQI A;  5BUO A;  4QI2 A;  2DX8 A;  4GQH A;  3T6B A;  4YBS A;  1OR3 A;  2CRR A;  3EZI A;  3IQ6 A;  3ASL A;  3U2M A;  3KL4 A;  2GWW A;  2R05 A;  3R2P A;  1YA7 O;  3LAY A;  5B77 A;  5HSW A;  3LQH A;  2A6H F;  5FCL A;  5BQG A;  5G05 B;  4U5F E;  3JRT A;  3TJ6 A;  2J9U A;  1KNY A;  4IRU A;  4IJJ A;  3N24 A;  3QW0 A;  3SNH A;  3JUE A;  1TR2 A;  2GA0 A;  2PX0 A;  1CGO A;  3TUL A;  1DCQ A;  3SOX A;  2YQM A;  1M56 C;  4LDQ A;  4WJ0 A;  4CCG X;  3S29 A;  3ZG1 A;  4YT5 A;  1E86 A;  3EGD A;  2KC3 A;  2R7X A;  3T6R A;  2ECW A;  4S3O B;  1MMG A;  2L6F A;  3E2D A;  1JOC A;  2RR4 A;  2JPU A;  3V5Y A;  4I7B A;  1WEM A;  1BBH A;  3MYF A;  2WVO A;  2LGL A;  3C8Z A;  3PMR A;  5L0H A;  1V54 C;  1VMA A;  1E85 A;  4PR9 A;  2EPM X;  2HSB A;  3IPM O;  4B86 C;  3US6 A;  3C6W A;  2VPE A;  4C9Z A;  1YZC A;  2EIL C;  2LXP C;  3U5O A;  3T6G B;  2MYS A;  4NCQ A;  5DS5 A;  5KYW B;  2ZXO A;  3DMD A;  4CS9 C;  3AGU A;  2OEX A;  4O6M A;  1A7V A;  2D8U A;  4NTF A;  1AUE A;  3SZR A;  2V3C C;  1O3U A;  2F6N A;  1GS9 A;  1ZU4 A;  2Q00 A;  1GGQ A;  5TDR A;  4AK9 A;  5TBN A;  5B76 A;  1IYM A;  3ZVR A;  4WZ0 A;  3K33 A;  3U5P A;  1QVX A;  1CHC A;  4I7C A;  4XLP F;  1T6Q A;  4AYC A;  3JRM O;  2VCA A;  3TQO A;  4XI1 A;  4YAD A;  1MNE A;  4CDY A;  4ANJ A;  4BHW A;  2W4B A;  4R8P K;  4IAR A;  4YK5 A;  5A6B D;  3EB5 A;  4AE4 B;  1NU7 D;  3L1M A;  4MW8 A;  2YUC A;  2XSE A;  1YYX A;  4IGG A;  2MUM A;  4EBB A;  1WE9 A;  1TFO B;  3ZSU A;  2XLW A;  2KKX A;  5LKX A;  2LFF A;  3U5M A;  4E7Z A;  1YYJ A;  2L9J A;  5A69 A;  2UUI A;  2C2V S;  3FAO A;  3M63 A;  3SEO A;  2YVR A;  3HCU A;  1UG7 A;  3E9V A;  3LES A;  3KDE C;  4N4W A;  2MA5 A;  2OQM A;  1C03 A;  5SVY A;  3ASN C;  3U9J A;  3GL6 A;  3EG9 A;  4YT2 A;  1F62 A;  5JG6 A;  2YL0 A;  4YWQ A;  2L0B A;  5D1K B;  3KQI A;  3X2Q C;  2A0B A;  1JAF A;  2HZ8 A;  4JUR I;  1NBB A;  1I5N A;  3L8J A;  4XTK A;  3LNM B;  4MND A;  3NMJ A;  1PCX A;  4LJN A;  4DXW A;  1Q0F A;  3NKE A;  3HKK A;  1A7D A;  3WHN A;  3TJ5 A;  5AC4 A;  2J9W A;  4EBK A;  5CIV A;  2WZF A;  1FNT c;  1XWJ A;  4AP4 A;  1OXB A;  5L3Q A;  3CAX A;  1O5H A;  4MVO A;  3N9M A;  3JYY A;  3ABM C;  1FFT C;  1EI7 A;  4B7Y C;  3VF0 A;  4JCZ A;  2Y3H A;  3DXJ F;  3LDY A;  2EPL X;  4X0R A;  2P6V A;  2QTV A;  2IM8 A;  2KE1 A;  1T1H A;  3U9M A;  5LCW B;  1BZ4 A;  2R9R B;  2JD3 A;  5A6A A;  1YDI A;  4HFK B;  1WEW A;  2XL6 A;  3M15 A;  2E87 A;  1WEE A;  2HJM A;  4YC9 A;  3EHM A;  1Z2Q A;  2H8A A;  1AVO B;  1APC A;  2WB7 A;  4AUQ B;  5F5F A;  4OGC A;  2IYL D;  4W8K A;  3O33 A;  2ECI A;  5T3T A;  3H65 A;  4R32 A;  2NUP A;  4MVM A;  3U8V A;  2OU6 A;  1Z5Z A;  2GAQ A;  3L11 A;  3MDB C;  3BEH A;  3T9O A;  3I5Q A;  3T7L A;  4K0D A;  3U3F A;  1LE4 A;  2NUT A;  1TWH A;  256B A;  2EIN C;  2MWQ A;  1WIL A;  1BDJ B;  1F1M A;  4I3M A;  3SYN A;  3DZA A;  1K05 A;  2QY9 A;  2R02 A;  4DRI B;  2JMJ A;  4GNE A;  4P6I C;  3IHP A;  3N9N A;  5JLI A;  3NRH A;  2MNZ A;  3MYI A;  3CSK A;  1EKY A;  4N06 A;  1V87 A;  2W45 A;  5CI8 A;  2H0D A;  4K1O A;  5H9M A;  2QLA A;  1J8Y F;  2ECN A;  3PLW A;  2L5U A;  4O7G A;  4LLC A;  2Y1M A;  2I50 A;  3C18 A;  4TKP B;  3RF3 A;  3H7H A;  1WWP A;  2KR4 A;  2YT5 A;  1X4J A;  4DOZ A;  4NN2 A;  3V7O A;  1TFK B;  3FJU B;  1TKN A;  1NZE A;  4JC7 A;  3ZQV A;  2YRE A;  2MT5 A;  2XLV A;  1OQC A;  1Z63 A;  4E18 A;  1E2X A;  3QVY A;  1CPQ A;  1YZA A;  4XEF A;  3PHD A;  3J06 A;  5JP7 A;  3K6B A;  1JMW A;  2R7R A;  3NKD A;  2YSJ A;  3EG9 B;  4CIP A;  2R7V A;  2M6M A;  3S84 A;  2EPN A;  3DWW A;  3KKB A;  2BAY A;  1MMA A;  1VYI A;  1LI7 A;  4CSA C;  2W9Y A;  2A68 F;  1ORS C;  2KWJ A;  3AG3 C;  5B1B C;  2DYS C;  2EIM C;  1PD0 A;  2ZPA A;  3C5K A;  4QI0 A;  1FMV A;  2XB1 A;  1FTS A;  2OG2 A;  3JCU Q;  4BJ1 A;  4WAB A;  1YLM A;  2YUR A;  2Y39 A;  2LIG A;  2C2L A;  1OW6 A;  2VJF A;  1T01 A;  1VOM A;  2KSF A;  2R7T A;  3C63 A;  4LKA A;  1WEO A;  3LLI A;  5B3I A;  4P5O B;  4JVS A;  1VYX A;  4H9D A;  3GWN A;  3ZTM A;  2PX3 A;  3MFN A;  5I3L A;  3K1I A;  1JM7 A;  5KYY A;  1T5O A;  1IZM A;  2EGM A;  3M7K A;  4LER A;  1YVI A;  1LS4 A;  4MTF A;  3O34 A;  3RTR B;  2PUY A;  3FXH A;  4KNW A;  2HFI A;  2FGY A;  2Y3D A;  3KV6 A;  4YT8 A;  2G43 A;  3VYW A;  4AVX A;  1HW1 A;  2ASR A;  3SP1 A;  5FB0 A;  4YAT A;  1MQV A;  3AJM A;  1N87 A;  2EA6 A;  2F42 A;  3QZV A;  1OKK D;  4CA1 A;  1OCO C;  4H54 A;  1XZQ A;  2L6H A;  2YL3 A;  4U9E A;  4MQ9 F;  3ASO C;  3NMI A;  1MM2 A;  2G6Q A;  1WEV A;  4PTB A;  4YAB A;  4BJ6 C;  4YN0 B;  3UMH A;  5C11 A;  1VB5 A;  2OKU A;  1X4U A;  2ECJ A;  2YL1 A;  1U0B B;  3Q1D A;  5B1A C;  4DVZ A;  2DJA A;  2R7Q A;  5BQI A;  2FUI A;  4FAP B;  3C8G D;  1L7C A;  2RI7 A;  3QMK A;  2JM3 A;  1WN0 A;  1RJ9 B;  4BJ5 C;  1D0X A;  1A7E A;  3EFO A;  2M3H A;  5IY5 C;  1LDK C;  2TMV P;  2VPG A;  1I4Z A;  4UI9 B;  2K17 A;  2KGO A;  2PBE A;  5L0F A;  2MA6 A;  3M79 A;  3T9K A;  1SZI A;  4J30 B;  5B3S C;  4OD5 A;  4CDV A;  1RCP A;  4G0H A;  1J8M F;  3GEE A;  4CIH A;  1A0B A;  5KH7 A;  2J8W A;  4ULW A;  5G04 B;  1BR4 A;  5T1D B;  5KH9 A;  1A41 A;  4GB0 A;  1HE9 A;  3RQE A;  2YEV A;  5C13 A;  4EHP A;  4AYC B;  3G4X A;  1SMY F;  1ZBD B;  2XS1 A;  3AG4 C;  1LI5 A;  3ATP A;  4LLB A;  2BL2 A;  3GWL A;  4MTO A;  2LD6 A;  4Q4Z F;  3E70 C;  3S0X A;  2R7S A;  2ZXR A;  1LVK A;  1OR2 A;  2Y1N A;  2XXA B;  2ZXP A;  4BPM A;  4I1M A;  1LDJ B;  2YHN A;  3N0T A;  3RVZ A;  3U5N A;  3V5X A;  1NLX A;  4BEJ A;  5DS4 A;  1QZX A;  1ZU5 A;  3RH3 A;  2OJE D;  4MVR A;  3QW1 A;  3L1Z B;  4RBN A;  3O6X A;  2M85 A;  2LSE A;  4D4X A;  2D4U A;  5B75 A;  3PDM P;  2KGI A;  1ZHY A;  2JRJ A;  2CRW A;  3ZVZ B;  2K16 A;  4CS8 C;  3FHD A;  3ZNI A;  1HW2 A;  1SR2 A;  3EGX A;  4QDL A;  4JE9 A;  2CW0 F;  4JZA A;  2AP3 A;  3B71 A;  1RKE B;  1G8X A;  1Y6D A;  1ORJ A;  3UNG C;  3LQJ A;  5TJ5 E;  3ZPV E;  2R7W A;  2IXN A;  1FR0 A;  4U5B E;  4FK5 A;  1Y4C A;  2E6R A;  3NYM A;  1NU9 C;  3EHN A;  3EZH A;  3LS1 A;  4KBL A;  2YLD A;  1V4A A;  3B0U X;  3FOP A;  3NYL A;  3Q7L A;  3Q6M A;  2VPD A;  4PFP A;  2MNY A;  3VAY A;  4LAC B;  2AWC A;  2IQJ A;  3M4C A;  5D91 A;  1VLS A;  3S27 A;  3HTK C;  2HV7 A;  2YLI A;  3IEE A;  2KFT A;  2LGV A;  4UP0 A;  3BRJ A;  4Z9H A;  4DBR A;  2NUP B;  5KYU A;  2HMQ A;  2OEV A;  2G62 A;  1WTY A;  3B29 A;  4FWV A;  5DIN A;  2KNH A;  4PJL A;  4PFO A;  4GNG A;  3TK0 A;  3DM5 A;  4MTG A;  2NPU A;  2HKV A;  1V74 B;  3WOD F;  2L43 A;  2H7V C;  3DQV R;  2XOZ A;  4FJC A;  2CSZ A;  2P57 A;  4CS9 A;  1QSP A;  5L0I A;  5SVI A;  2WZG A;  2IXM A;  4JTC B;  4UP5 A;  2R25 A;  3TOL A;  5F5H A;  5AIT A;  4E7S A;  2YKZ A;  4XLN F;  1SYQ A;  4ZQL A;  4AL0 A;  4A4B A;  1MMD A;  4B6I A;  2R7O A;  4LDR A;  5DVW A;  1OCZ C;  3HNK A;  3PHF 2;  4EWC A;  3IQC A;  3U2L A;  4YJW A;  1MND A;  5K0I A;  3W2V A;  1VYK A;  4GEH A;  1JRA A;  2EXU A;  3ZYQ A;  3DE9 A;  3VK6 A;  1K04 A;  2KWO A;  3GM3 A;  1JPJ A;  5D1L B;  2L80 A;  2BE5 F;  3WG7 C;  3M99 A;  3I2D A;  2G3K A;  3EGD B;  4ER9 A;  2LRI C;  3GOD A;  4P9F A;  5K3Q A;  2HS5 A;  3EJN A;  2CNW A;  1OCC C;  1M6T A;  3G4Z A;  4F52 B;  2YWA A;  3AOU A;  4JTA B;  4CDA A;  2XM4 A;  3O35 A;  1LM3 B;  1NFO A;  3I4U A;  2XLM A;  4OD4 A;  5LKZ A;  2VCC A;  2X0C A;  4ONS A;  2VCB A;  2OWA A;  1G25 A;  4L6R A;  1YJG A;  5J3X A;  4L58 A;  2HMZ A;  3LRQ A;  3DKA A;  4Z0O A;  5D92 A;  2OJQ A;  3FEH A;  3SUB A;  4DVY P;  3JTL O;  4S3O C;  3DI5 A;  2HSQ A;  4O6N A;  4Q5S F;  1OW8 A;  4A49 A;  4YBT A;  3QZC A;  2LV9 A;  2XOC A;  5SVX A;  1OXK A;  5JS5 A;  2AN6 A;  2I8B A;  3CEX A;  3W2W A;  4DRJ B;  2WVQ A;  3SXY A;  1U89 A;  4O79 A;  1UFB A;  4G7Z F;  1T9K A;  1H9G A;  2QE9 A;  4MW3 A;  1Z60 A;  3HNL A;  4IAQ A;  3ABL C;  1X4I A;  1BR1 A;  1VK5 A;  4FIP A;  3DWD A;  4NY3 A;  1NFN A;  5HV9 A;  1YAR O;  4J32 B;  3DAF A;  4U5D E;  3RPG C;  3RPG B;  5JVE A;  3V5Z A;  4GYT A;  2A1D D;  4XPY A;  1XZP A;  4JEB A;  3FAJ A;  2O9X A;  4C3E A;  3M4B A;  3F46 A;  2KIZ A;  3DJU B;  3LS0 A;  3M1C B;  2XLD A;  5A6J A;  4HFF B;  3R7C A;  2VPB A;  3ZTZ A;  1ORY A;  5KYU B;  2JX0 A;  4A4C A;  3O36 A;  3GEI A;  4U9D A;  3ZWI A;  2J45 A;  2NSF A;  2CYD A;  1M2O A;  2MKE A;  1WFK A;  5COF A;  2Q7R A;  4JJG A;  4JCH A;  4PK4 A;  3RFY A;  2ICW G;  2Q9B A;  5DKA A;  5EYA F;  2L7A A;  1Z3I X;  2ETS A;  2CDQ A;  3F47 A;  3JZ0 A;  3KV5 A;  5COM A;  2YW8 A;  1FP0 A;  3C8G A;  2XM0 A;  2K4D A;  2PNO A;  3KMI A;  2LDR A;  3KPH A;  3EFO B;  2XLH A;  2QIC A;  2XP0 A;  5H1U A;  3C8G B;  2J7P D;  3U0C A;  1Z6U A;  5SVI B;  4N6H A;  1DVP A;  4W8P A;  4IB4 A;  2VC9 A;  2W4M A;  3LNR A;  1G4W R;  1S05 A;  2LN0 A;  1ZVZ A;  4R7E A;  1H9T A;  4C7O A;  2P1A A;  1WAS A;  2QIZ A;  3L8I A;  4DBQ A;  1M2V A;  4G7H F;  2JUN A;  4F1P A;  4LAD B;  4OIO F;  5D1M B;  1WIM A;  5L0C A;  4CSA A;  3IQ5 A;  1RJ9 A;  1Q0M A;  4I1O B;  3NDB B;  3NMK A;  5G0F A;  2WVN A;  1HYJ A;  3N2Z B;  2J0W A;  2P61 A;  4N6C A;  1RMD A;  3SXK A;  2GDC A;  2L7P A;  3EGX B;  3DD7 A;  2L6G A;  1ZZP A;  2ZET C;  1TWA A;  2KRE A;  1IW7 F;  4Q7C A;  4NTB A;  4PJN A;  1RKE A;  5DS6 A;  5B8D A;  5DQT A;  1XWH A;  4CS7 A;  4JTD B;  1JOG A;  4FES A;  4WZ3 B;  1Q0K A;  5EHH A;  2YRF A;  2QUP A;  2QNL A;  3UGP A;  2C03 A;  5DQZ A;  3A9C A;  2H7O A;  2OCC C;  1H6G A;  2DB4 A;  2I15 A;  4WGY A;  2XLO A;  3DDT A;  3PCV A;  3O7A A;  4MVT A;  3QVZ A;  2CON A;  4OIN F;  4Z9I A;  3C62 A;  5T3W A;  2FFW A;  4PJJ A;  2P7V A;  2L75 A;  1WEU A;  2LK4 A;  3GM2 A;  1C02 A;  1OCR C;  1D1C A;  4JKV A;  5E33 A;  5LKU A;  4JW1 A;  2LFD A;  4JJF A;  4WZ2 A;  1JM7 B;  5JUA A;  3LJB A;  2G45 A;  3CQZ A;  4BJT A;  4OIP F;  5AGF A;  3VRC A;  4XQ1 A;  5LKT A;  4OGE A;  1ZHX A;  4E0I A;  4OIR F;  3LEO A;  3S28 A;  1G5Z A;  2YSM A;  1CPR A;  1WAT A;  2DI3 A;  1FFH A;  1H7I A;  1DOV A;  1U6H A;  4QF3 A;  3ZC4 A;  1NSG B;  2FUU A;  3GOR A;  2B0O E;  2KWK A;  1MMN A;  1Q0G A;  2Q9A A;  1CGM E;  2MD8 C;  3KYI A;  3QTH A;  4RD9 A;  4MVZ A;  1RKC A;  4FX5 A;  4HEA J;  2R03 A;  5B79 A;  2IXO A;  2Y69 C;  1B68 A;  3X1O A;  4MVU A;  3N9O A;  1I4Y A;  5EK0 A;  2FAP B;  2LQ6 A;  1EQ1 A;  3AG1 C;  2D5R B;  4U5E E;  2RSE B;  2V26 A;  3RVY A;  2FSA A;  2VJE A;  1Z23 A;  4XPX A;  4EBJ A;  3DJN B;  3KNV A;  4YBM A;  2VB6 A;  2NAA A;  3O70 A;  4CJO A;  3FOO A;  3O10 A;  2PF4 E;  2XS8 A;  2YQY A;  1WES A;  4C3B A;  3S90 A;  2YL7 A;  3GEH A;  3AGT A;  3GAN A;  1D0Z A;  3UMK A;  3H2U A;  4U5C E;  1LS1 A;  3ZPV 1;  1BR2 A;  1QKR A;  1Q0D A;  4QF2 A;  2YYR A;  5DLJ A;  2VJE B;  4JEA A;  2EIJ C;  4AE4 A;  4LLE A;  4C7O B;  2XXA A;  1MM3 A;  5L3V A;  2E61 A;  4BJ5 A;  3L1X A;  3RIP A;  1KTM A;  1LIH A;  4E0H A;  3SOU A;  3B9Q A;  3EPV A;  2XLE A; 
#chains in the Genus database with same CATH homology
 5D1L B;  2L80 A;  3LLK A;  2BE5 F;  1NG1 A;  4GNF A;  2YU4 A;  4GND A;  4Q6F A;  3WG7 C;  2VNF A;  3M99 A;  3N9L A;  3I2D A;  3PHD A;  2G3K A;  2YZS A;  3EGD B;  2NG1 A;  4I44 A;  3K6B A;  2LRI C;  1JPN A;  3GOD A;  2R7R A;  1V55 C;  3NKD A;  5KYN A;  4HE8 D;  3EJN A;  2KU3 A;  2YSJ A;  2CNW A;  3UGO A;  1OCC C;  1ZHT A;  1D1B A;  2Z15 A;  3AQC A;  3OEO A;  3W8H A;  1HYI A;  3EG9 B;  2R7V A;  4ZLC A;  1BOR A;  2RSD A;  1OKK A;  2JMD A;  2M6M A;  3HCT A;  3W8I A;  4F52 B;  2HYE D;  3CZ6 A;  4N3W A;  4ZUX U;  3KKB A;  2BAY A;  4K7B A;  1MMA A;  3I5P A;  3OWT A;  2QJ0 A;  3O35 A;  2YHS A;  1VYI A;  4CSA C;  3I4U A;  2W9Y A;  2A68 F;  3TD7 A;  2KWJ A;  3HCS A;  3AG3 C;  4OD4 A;  5B1B C;  3L0I A;  5LKZ A;  4XWJ A;  2IXP A;  2Q3T A;  3KH2 A;  2DYS C;  3HLZ A;  2EIM C;  1D1A A;  2VH3 A;  1PD0 A;  1G25 A;  3T6J A;  5J3X A;  4L58 A;  3LRQ A;  3LQI A;  5BUO A;  4QI2 A;  2ZPA A;  3C5K A;  4QI0 A;  2DX8 A;  1FMV A;  5D92 A;  1WEQ A;  2H0D B;  3EH1 A;  3T6B A;  2XB1 A;  4YBS A;  1FTS A;  2OG2 A;  3JCU Q;  4BJ1 A;  2UZG A;  3EZI A;  3ABK C;  4DVY P;  2Y39 A;  2YUR A;  2C2L A;  3ASL A;  2VJF A;  3KL4 A;  4S3O C;  4F4B A;  4O6N A;  1VOM A;  2M1R A;  4Q5S F;  3LAY A;  1FMW A;  2R7T A;  1K2F A;  5B77 A;  5HSW A;  4LKA A;  1WEO A;  3O37 A;  3LQH A;  2A6H F;  4AX2 A;  3LLI A;  5FCL A;  2F6J A;  4A49 A;  2ECG A;  4P5O B;  4YBT A;  4I7D A;  4JVS A;  3QZC A;  1VYX A;  2LV9 A;  5G05 B;  4U5F E;  3JRT A;  2J9U A;  2PX3 A;  2DYR C;  1ST6 A;  5I3L A;  1LKX A;  1ZYR F;  2I8B A;  4KNV A;  2AN6 A;  1JM7 A;  4IRU A;  5KYY A;  4IJJ A;  3N24 A;  3W2W A;  4IWB A;  3SNH A;  1IZM A;  4X3G A;  2ECT A;  5TRB A;  1TR2 A;  3K66 A;  2PX0 A;  2WVQ A;  3Q7G A;  4O79 A;  2HV6 A;  4LER A;  3SOX A;  4G7Z F;  3O34 A;  2WZL A;  1Z60 A;  2A69 F;  2YQM A;  2PUY A;  3RTR B;  1M56 C;  2CGE A;  4WJ0 A;  4KNW A;  4FO9 A;  4CCG X;  3S29 A;  3ABL C;  3ZG1 A;  1X4I A;  1BR1 A;  1VK5 A;  2FGY A;  5KYW A;  4FIP A;  2D8S A;  4NY3 A;  2Y3D A;  4YT5 A;  3EGD A;  3KV6 A;  2R7X A;  2KYU A;  4YT8 A;  3T6R A;  2G43 A;  3VYW A;  4AVX A;  2ECW A;  4S3O B;  1MMG A;  5FER A;  3MX3 A;  4J32 B;  3DAF A;  5H1T A;  3SP1 A;  4U5D E;  1JOC A;  3DAG A;  5FB0 A;  3RPG C;  4YAT A;  3RPG B;  3SHB A;  4I7B A;  1WEM A;  1M2V B;  2PP4 A;  4GYT A;  2A1D D;  1N87 A;  2EA6 A;  2WVO A;  3FAJ A;  2LGL A;  2O9X A;  4C3E A;  2CNW D;  2F42 A;  3Q6N A;  5KYY B;  3PMR A;  3LEV A;  1V54 C;  1VMA A;  3AG2 C;  3NYJ A;  3ECS A;  3QZV A;  4O64 A;  4KI2 A;  3F46 A;  2KIZ A;  1VD4 A;  1OKK D;  4CA1 A;  5EGY A;  1OCO C;  4B86 C;  3K7D A;  2FFH A;  3DJU B;  2PNX A;  2GFH A;  3C6W A;  3GV4 A;  3LS0 A;  3M1C B;  2YHO A;  2L81 A;  2VPE A;  4MQ9 F;  3ASO C;  4HFF B;  4C9Z A;  2EIL C;  1MM2 A;  2CKL B;  2LXP C;  2VPB A;  3U5O A;  2G6Q A;  5KYU B;  2X51 A;  4MSX A;  2MYS A;  4A4C A;  3O36 A;  1WEV A;  4PTB A;  5DS5 A;  4YAB A;  4BJ6 C;  5KYW B;  2KQ9 A;  3FDQ A;  4WA6 A;  4YN0 B;  2ZXO A;  2J45 A;  2EGP A;  3UMH A;  5C11 A;  1M2O A;  3PUR A;  3DMD A;  1WFK A;  4CS9 C;  4O6M A;  4JJG A;  4JCH A;  4PK4 A;  3RFY A;  1X4U A;  3SZR A;  2V3C C;  2Q9B A;  3K1I C;  5DKA A;  2ECJ A;  5EYA F;  2Y3B A;  1Z3I X;  2XL4 A;  5B1A C;  2F6N A;  2CDQ A;  3F47 A;  1M57 C;  3KV5 A;  2YW8 A;  4DVZ A;  1ZU4 A;  4U5G A;  2R7Q A;  1FP0 A;  3M62 A;  3HJC A;  2FUI A;  2K4D A;  5TDR A;  3KMI A;  4AK9 A;  2LDR A;  3ZVY A;  2RI7 A;  2VP7 A;  5TBN A;  3EFO B;  4A2N B;  3QMK A;  2QIC A;  5B76 A;  1IYM A;  3ZVR A;  4WZ0 A;  3K33 A;  3PUQ A;  3U5P A;  5H1U A;  2J7P D;  1CHC A;  1RJ9 B;  4I7C A;  3JT1 A;  4BJ5 C;  1D0X A;  2XRH A;  1Z6U A;  3MLG A;  3EFO A;  1D0Y A;  5IY5 C;  2M3H A;  1LDK C;  1DVP A;  1N1C A;  4XLP F;  3O39 A;  4AYC A;  5FEY A;  2W4M A;  2KJG A;  2VPG A;  1Z6A A;  4XI1 A;  4UI9 B;  4YAD A;  1MNE A;  5E3A A;  1QLE C;  2K17 A;  3LNR A;  2KGO A;  3K1H A;  3FVY A;  3SOW A;  2MA6 A;  4ANJ A;  4BHW A;  1SZI A;  2W4B A;  4J30 B;  2LN0 A;  4R8P K;  5B3S C;  4OD5 A;  3EB5 A;  3UMI A;  1NU7 D;  4AE4 B;  4G0H A;  1J8M F;  1W2W A;  4R7E A;  4CIH A;  2YUC A;  2XSE A;  4H4K C;  5KH7 A;  4C7O A;  2MUM A;  2YQL A;  3L34 A;  4EBB A;  2G3V A;  2QIZ A;  3B0P A;  4YAX A;  4DBQ A;  1M2V A;  4G7H F;  1WE9 A;  4ULW A;  5G04 B;  1BR4 A;  3ZSU A;  5T1D B;  2KGG A;  4LAD B;  2WL8 A;  3OA1 A;  4OIO F;  2R7U A;  5KH9 A;  2MIQ A;  4GB0 A;  3AQB A;  5D1M B;  5LKX A;  1WIM A;  2YEV A;  4CSA A;  5C13 A;  1RJ9 A;  3U5M A;  4E7Z A;  3T4R A;  1TWC A;  4AYC B;  2L9J A;  4BJ6 A;  4I1O B;  3NDB B;  1SMY F;  2C2V S;  3M63 A;  1ZBD B;  3AG4 C;  4C3D A;  5G0F A;  2WVN A;  3SEO A;  1HYJ A;  3N2Z B;  4W4U A;  4LLB A;  2J0W A;  3HCU A;  3JYH A;  1RMD A;  3NG1 A;  3E9V A;  3LES A;  2MA5 A;  3EQL F;  4Q4Z F;  3E70 C;  3EGX B;  3DD7 A;  3S0X A;  2R7S A;  2ZXR A;  1LVK A;  2ZET C;  1TWA A;  2KRE A;  1IW7 F;  4Q7C A;  2Y1N A;  4PJN A;  2XXA B;  2ZXP A;  4I1M A;  5CI9 A;  1LDJ B;  4PPE A;  5DS6 A;  1WGW A;  2YHN A;  3ASN C;  3GL6 A;  3N0T A;  3EG9 A;  4YT2 A;  5B8D A;  1F62 A;  2J46 A;  5DQT A;  1XWH A;  1U6G B;  4CS7 A;  5JG6 A;  3U5N A;  2L0B A;  4YWQ A;  2LGK A;  5D1K B;  2M4E A;  4R2Y A;  2IOQ A;  2Y43 A;  3KQI A;  4BEJ A;  5DS4 A;  1QZX A;  4FES A;  4WZ3 B;  3X2Q C;  1E4U A;  1ZU5 A;  3RH3 A;  5EHH A;  2LGG A;  4JUR I;  2Q9C A;  3L1Z B;  4RBN A;  4XTK A;  3O6X A;  2XEU A;  4BG0 A;  3UGP A;  2M85 A;  2LSE A;  4U5H A;  2C03 A;  5DQZ A;  4MND A;  3V43 A;  5B75 A;  1PCX A;  4LJN A;  2KGI A;  2H7O A;  2OCC C;  3NKE A;  1ZHY A;  2JRJ A;  4V3L C;  3ZVZ B;  2C04 A;  1S7Z A;  1WEN A;  3O7A A;  4MVT A;  2CSY A;  2K16 A;  4CS8 C;  3FHD A;  2J9W A;  2ZXW C;  2WZF A;  4OIN F;  3ZNI A;  4AP4 A;  4O6Y A;  2EOD A;  3ITF A;  1O87 A;  2JMI A;  3EGX A;  4YT4 A;  4QDL A;  5T3W A;  5L3Q A;  1O5H A;  2KWN A;  4V3K C;  5FB1 A;  2CW0 F;  4JZA A;  3N9M A;  4IC3 A;  3ABM C;  2CT2 A;  4PJJ A;  1G8X A;  2Y3G A;  1FFT C;  2P7V A;  2L75 A;  4B7Y C;  1WEU A;  3UNG C;  2Y3H A;  3LQJ A;  1OCR C;  1D1C A;  3DXJ F;  5E33 A;  5LKU A;  3JSZ A;  4JW1 A;  3B0V C;  3ZPV E;  2R7W A;  2IXN A;  4X0R A;  4JJF A;  4WZ2 A;  1KU2 A;  2P6V A;  2QTV A;  4U5B E;  2KE1 A;  1JM7 B;  1T1H A;  2E6R A;  4FK5 A;  4A0C D;  3NYM A;  3LJB A;  5LCW B;  4PJM A;  1NU9 C;  2G45 A;  4LK9 A;  3CQZ A;  4BJT A;  3EHN A;  4OIP F;  3EZH A;  2JD3 A;  2E6S A;  3LS1 A;  5LKT A;  1ZHW A;  4KBL A;  3B0U X;  4L7X A;  1ZHX A;  4HFK B;  1WEW A;  2NUT B;  2E87 A;  4OIR F;  1WEE A;  5B78 A;  3S28 A;  3NYL A;  4YC9 A;  3EHM A;  3Q7L A;  1Z2Q A;  3Q6M A;  2VPD A;  2YSM A;  4PFP A;  2ECV A;  2MNY A;  3VAY A;  4LAC B;  2WB7 A;  4ZLD A;  1FFH A;  5H1V A;  4AUQ B;  5F5F A;  5D91 A;  2IYL D;  2A6E F;  3ZC4 A;  2FUU A;  2OXQ C;  4W8K A;  4QF3 A;  2J7P A;  3O33 A;  3RKO F;  2KWK A;  1MMN A;  3S27 A;  4OIQ F;  2Q9A A;  2ECI A;  5T3T A;  3H65 A;  2MD8 C;  3HTK C;  3MHH A;  2HV7 A;  4CBE A;  2NUP A;  3IEE A;  2J9V A;  4M63 A;  4RD9 A;  2KFT A;  1Z5Z A;  4G7O F;  1TWG A;  4FX5 A;  2LGV A;  4HEA J;  3N9Q A;  3L11 A;  2MD7 B;  4UP0 A;  5B79 A;  4DBR A;  2NUP B;  2IXO A;  5KYU A;  1SF8 A;  5TAB A;  2EIK C;  2Y69 C;  2G62 A;  3X1O A;  3I5Q A;  2HDP A;  4ZDT A;  3POV A;  3N9O A;  3T7L A;  1WGM A;  4K0D A;  2LQ6 A;  3EH2 A;  3UR3 C;  3AG1 C;  2D5R B;  2NUT A;  3EB6 A;  1TWH A;  2MWQ A;  2EIN C;  2VAS A;  4FWV A;  4U5E E;  1WIL A;  5KH3 A;  5DIN A;  2KW3 C;  4I3M A;  2KNH A;  4PJL A;  4PFO A;  3SYN A;  4GNG A;  2V26 A;  3DZA A;  2FSA A;  4RDA A;  2QY9 A;  3DM5 A;  2VJE A;  1PD1 A;  2J0X A;  1Z23 A;  4IAO A;  1VFY A;  2JMJ A;  4GNE A;  5AIU A;  2DGJ A;  3DJN B;  3KNV A;  4P6I C;  3IHP A;  3N9N A;  3WOD F;  3NRH A;  2MNZ A;  2L43 A;  4YBM A;  2VB6 A;  2LXH C;  2NAA A;  2H7V C;  3O70 A;  4IC2 A;  3DQV R;  3CSK A;  4FJC A;  2PF4 E;  2CSZ A;  3FL2 A;  4N06 A;  4CS9 A;  1V87 A;  1WES A;  2W45 A;  4C3B A;  5CI8 A;  5E3C A;  2H0D A;  5H9M A;  3DPL R;  3NG2 A;  2WZG A;  5KYX A;  2IXM A;  1J8Y F;  2ECN A;  4N4F A;  4BBQ A;  4UP5 A;  5E2Q A;  5F5H A;  3GAN A;  2B0J A;  5AIT A;  4E7S A;  1D0Z A;  2VJF B;  4XLN F;  2L5U A;  4ZQL A;  3UMK A;  4O7G A;  4A4B A;  1MMD A;  4LLC A;  2CKL A;  1WEP A;  2Y1M A;  4U5C E;  2IDA A;  1LS1 A;  4B6I A;  2R7O A;  3ZPV 1;  1BR2 A;  2I50 A;  4QF2 A;  3MHS A;  1ZHZ A;  3N9P A;  2YYR A;  4TKP B;  5DVW A;  5DLJ A;  2VJE B;  1OCZ C;  3PHF 2;  2EIJ C;  4AE4 A;  5TDW A;  3RYL A;  4EWC A;  2KR4 A;  4LLE A;  2YT5 A;  4YJW A;  4C7O B;  1X4J A;  2XXA A;  4DOZ A;  1MND A;  1MM3 A;  4NN2 A;  5L3V A;  2K1J A;  3V7O A;  3W2V A;  3ZTG A;  4BJ5 A;  1VYK A;  4GEH A;  3L1X A;  3RIP A;  1TKN A;  3ZYQ A;  1NZE A;  3VK6 A;  2PFD A;  4CS8 A;  3SOU A;  5KYX B;  3B9Q A;  3EPV A;  2YRE A;  1FBV A;  4KC9 A;  3ZIB A;  2KWO A;  2MT5 A;  3DM9 B;  2H7B A;  1JPJ A;  1Z63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...