3HTKC

Crystal structure of mms21 and smc5 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Structural maintenance of chromosomes protein 5
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
total genus 75
structure length 254
sequence length 254
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1010 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3htkC01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3htkC02
3U5PA 3SHBA 1X4JA 5H1VA 1BORA 4L7XA 2ECIA 2YHNA 5G0FA 5H1TA 1U6GB 1WEPA 2MD8C 3N9MA 3RTRB 3KV6A 3SOXA 1JOCA 3SOUA 2VPGA 2Y1MA 3U5OA 5EYAF 5KH7A 5H1UA 5B79A 3IHPA 2G43A 1WEWA 1WEUA 5LKUA 1HYJA 4UP0A 3KQIA 5TDRA 3VK6A 1DVPA 2FUIA 2VJEB 3L1ZB 4IC3A 2NAAA 4W4UA 2KE1A 2Y43A 4P5OB 5AITA 5G05B 2DX8A 4MVTA 3PHDA 2KFTA 4GB0A 2HDPA 2YUCA 3ZTGA 3I2DA 5I3LA 2QIZA 3O35A 3O34A 2ECNA 1VYXA 3LRQA 3ASLA 2BAYA 2K16A 3SOWA 4O64A 4TKPB 3HCSA 2VJFB 4B7YC 4B86C 4CA1A 3MHSA 3U5MA 3PUQA 2CKLA 2D8SA 4IC2A 2PUYA 1FBVA 1LDKC 4GNEA 2MNZA 2H0DB 3U5NA 4AYCB 4PTBA 2L0BA 2FSAA 4ZUXU 3L11A 1CHCA 2LRIC 4LLBA 5AIUA 2KYUA 3N9OA 2ECVA 5J3XA 2M85A 3ZPVE 5LKXA 4A4CA 3M62A 2MA5A 4UP5A 2KWOA 4BHWA 4ZDTA 2VPDA 1MM2A 2VPBA 3MHHA 5TABA 4FJCA 3QZVA 3V43A 2L75A 4AVXA 2EA6A 3ZNIA 2CSZA 2VP7A 1HYIA 2JMJA 2VJEA 2EODA 3M63A 2YW8A 2KGIA 2C2LA 2YT5A 2KU3A 3M99A 2CT2A 2YHOA 2LQ6A 4GNFA 3HCTA 2XEUA 5FERA 3DQVR 2M1RA 2KIZA 2MUMA 4I7BA 4YADA 5G04B 1Z2QA 4YBMA 3ZYQA 3L1XA 2PNXA 4UI9B 4YAXA 5KH3A 2KWKA 1WESA 2QJ0A 5B78A 2VJFA 4V3KC 3T6RA 2ECWA 3LQHA 5C13A 4LADB 3ZPV1 5B77A 1Z6UA 3N9NA 4I7DA 4R7EA 5TDWA 1V87A 2ECJA 4QF3A 4A49A 4R2YA 2H0DA 5FB1A 2LGVA 4AYCA 2F6JA 4FK5A 2ZETC 4WZ3B 5DINA 2YU4A 2QICA 5D1LB 2OXQC 2L5UA 1E4UA 3DPLR 3HTKC 3O7AA 2F6NA 2LGKA 4LJNA 1RMDA 2AN6A 1K2FA 1WIMA 1WGMA 4XI1A 4LK9A 1VD4A 3O36A 3EB6A 5KH9A 4N4FA 4S3OC 5H9MA 1F62A 1WFKA 2VNFA 4FO9A 2YQMA 1JM7A 3LQJA 1IYMA 4A0CD 5C11A 4N3WA 2KREA 3FL2A 3HCUA 4I7CA 5B8DA 5TBNA 3RPGC 3C6WA 1Z60A 2E6SA 5D1KB 1ZBDB 2M3HA 2MA6A 2E6RA 1G25A 2YQLA 2L80A 3ZVYA 5FEYA 4A4BA 2G6QA 2C2VS 2LN0A 5D1MB 1JM7B 3LQIA 3ZVZB 2VPEA 4PPEA 2EGPA 2IDAA 4ZQLA 4LKAA 4AP4A 1XWHA 4YBSA 5LCWB 1T1HA 3O70A 2KGGA 5LKTA 2RI7A 2JMDA 2ECTA 4GNGA 3N9LA 2LV9A 2YSJA 4Q6FA 4YBTA 3NG2A 1WE9A 2K4DA 1LDJB 4MSXA 4AUQB 4CCGX 2YSMA 4C9ZA 4YABA 4NN2A 2LXHC 2Y1NA 3N9QA 3EB5A 4L58A 2MD7B 1WILA 2KWNA 2LXPC 1X4IA 1X4UA 4F52B 2MNYA 3GL6A 2JMIA 5B76A 2MIQA 2HYED 4WA6A 1WEEA 2XB1A 2M6MA 3T7LA 2CSYA 1N87A 2LGGA 5TRBA 5FB0A 1FP0A 2KR4A 5DKAA 3O37A 5B75A 5LKZA 4YC9A 4FIPA 3KNVA 2F42A 3O33A 2LGLA 2K1JA 2YREA 4QF2A 4S3OB 3C5KA 1WEVA 2FUUA 4WZ2A 1WEOA 4WZ0A 2ECGA 1WEMA 2LDRA 2RSDA 2KWJA 3PURA 2YURA 1WENA 1VFYA 2JRJA 4YATA 3GV4A 2G45A 1WEQA 3RPGB 4X3GA 3N9PA 2I50A 4R8PK 2YYRA 4BBQA 1MM3A 2L43A 5JG6A 2MT5A 2UZGA 3KV5A 2CKLB 4GNDA 4V3LC 2K17A
chains in the Genus database with same CATH superfamily
2QY9A 4PACA 3J06A 1OR3A 4L6RA 4QI2A 3NMIA 4XTKA 3L0IA 2XLVA 3QVYA 3V5YA 3HLZA 3FDQA 3EQLF 4W8KA 2OU6A 3FJUB 3KV6A 1GQAA 3U5OA 2CCYA 3HNJA 5B79A 3IEEA 3IQTA 3SXMA 3H7HA 3IHPA 5KYYB 3U2MA 2IXPA 3ZVRA 1MMGA 1YDIA 4ER9A 1BBHA 1HYJA 4CX9A 4DVZA 1IZMA 4E0HA 5JVEA 3O55A 1OCCC 3VK6A 2FD4A 4RBNA 2VJEB 3L1ZB 2NPUA 3MFNA 4P5OB 2DX8A 3PHDA 1N1CA 2E61A 1LE4A 3ZDLA 2XXAB 4BJ5A 4UDVA 4Z0OA 4GB0A 2HDPA 2P6VA 3ZTGA 3I2DA 2WB7A 2QIZA 3O35A 1EI7A 1LPEA 2YVKA 4HFFB 2EXUA 1WATA 3EGDB 3ASLA 5A6BD 2K16A 3SOWA 2D5RB 4TKPB 4CA1A 3MHSA 3GWNA 1E84A 2D8SA 4WABA 3TK0A 2PUYA 2V3CC 2JD3A 1FBVA 1LDKC 2XSEA 4NCQA 2LIGA 1APCA 2XLEA 4X0RA 4U5GA 4AYCB 2FSAA 4E17A 3N24A 4OGEA 5J3XA 1DOVA 5DS6A 5LKXA 3LS0A 3M62A 2MA5A 1HW1A 4UP5A 2KWOA 2NSGA 2L7PA 1Z63A 4BHWA 4ZDTA 1TWGA 3NMKA 2L9JA 2OCCC 1PV3A 4FJCA 3QZVA 1JPJA 256BA 3TJ6A 4AVXA 3EGXB 3ZNIA 3FHDA 5JS5A 4A4AA 1FFHA 4BJ6C 1C03A 3AGTA 2YT5A 2KU3A 2CT2A 2Q4FA 1TFOB 2ZXOA 4GNFA 2J45A 1Q0FA 2KSFA 1RMVA 4IAOA 2ASRA 5JRAA 4U9DA 1OCOC 4HFKB 1RJ9A 5AC5A 2R7XA 5F28E 1SYQA 2OWAA 2W9YA 3JUEA 2PNXA 3C7JA 4U9EA 2B0HA 2X0CA 3C62A 5B78A 1E2XA 2FAPB 1MNEA 2ECWA 2J8WA 3U8VA 5C13A 1R5ID 1QSPA 1TWCA 3N9NA 4I7DA 1V87A 2ECJA 1LI7A 2LGVA 1RXQA 3K6BA 3C8GB 1LE2A 4EBKA 2ZETC 5BQHA 3M15A 2XRHA 2QTVA 5DINA 3FOPA 4KC9A 3HTKC 1G5ZA 3O7AA 2F6NA 5COMA 1Y4CA 2AN6A 1WIMA 4JKVA 2R25A 4MW8A 3NRHA 3LNMB 2L6GA 4N4FA 2R7OA 4S3OC 1A7EA 4FWVA 1F62A 1WFKA 3DKAA 1QVXA 2EPKX 3VAYA 3EG9B 4E7ZA 3G50A 2NUTA 3A11A 1JM7A 3TJ5A 1VK5A 3C8ZA 3SYNA 2HFIA 3UGPA 3HCUA 5EHHA 3ZWIA 4OINF 2A0BA 3U3BA 2CDQA 2LFFA 3RVZA 4IARA 5TBNA 3C6WA 2DYSC 3ASOC 1LKXA 1NSGB 5B3SC 3Q7GA 1R4TA 1H9GA 3M1CB 3G4ZA 4K1OA 4MW3A 2YQLA 4AK9A 4J7YA 1JRAA 2G6QA 2OG2A 5JLIA 1RCPA 4Q5SF 5D1MB 4NTFA 1NLXA 2YLIA 1U89A 2IDAA 2J7PA 2KQ9A 1DCQA 1FMVA 1TKNA 1FAPB 4JC7A 4LKAA 4OD5A 1XWHA 5LCWB 3DWDA 1A7DA 3FMSA 4M63A 4CS8C 2J9WA 2ECTA 3N9LA 4IJJA 4YBTA 3PDMP 1HE1A 1M2VB 2YSMA 4C9ZA 2JPUA 3LEVA 4N6HA 4I1OB 3MDBC 4YL1A 1JAFA 4Z9IA 2KKXA 3N9QA 3I5QA 4L58A 2L6HA 2EGMA 2J9BA 4LACB 3K33A 2W4BA 2JMIA 5B76A 2HYED 4WA6A 3ITFA 2EILC 2XB1A 5K0IA 2M6MA 4QQ4A 3TQOA 2Q9AA 5TRBA 5KYWB 3W2WA 4KNVA 3JRTA 5B75A 3UNGC 5LKZA 3SXKA 4IRUA 1VYIA 1NFNA 1A7VA 2O9XA 3BEHA 2KJGA 5DQTA 1VLSA 4WJ0A 3O33A 1Q0DA 1DOWA 4FESA 3SXYA 4GYTA 4EBBA 3PCVA 4S3OB 1VLTA 1ST6A 2PNOA 4DRHB 1WEVA 4WZ2A 3U5SA 4CIHA 2XLDA 1YAUO 3O39A 1VTMP 3C63A 3GEIA 2YURA 1VFYA 1F1MA 3CQZA 3T6BA 1T01A 4FX5A 4YJWA 1WEQA 1OW6A 2AWYA 3LJUX 1QKRA 4JIOA 2IM8A 1MM3A 5JG6A 3CSKA 2QE9A 5D92A 2M13A 1M57C 3KV5A 4GNDA 5CI8A 3I4UA 1X4JA 2YHSA 2YHNA 1ZHTA 1ORYA 1U6GB 1WEPA 2MD8C 3N9MA 3ABMC 3SOXA 4NY3A 2ZD9A 3RQFA 2Y1MA 3S84A 5E2QA 4C7OA 4EWCA 3ZQYA 4LDRA 3U8PA 5LKUA 3IQ5A 4UP0A 1U6HA 3ZSUA 1V74B 2EINC 4W4UA 3FAJA 3IPMO 5AITA 3AOUA 4CS9A 1ZZPA 3DWWA 3R2PA 3FOOA 3SUBA 2YWAA 4QDLA 4BEMJ 4CS7A 1RKCA 4O79A 1EQ1A 1RJ9B 3O34A 2ECNA 2DYRC 1Z23A 3L1MA 4XEVA 2W4MA 2ICWG 2LD6A 2IXOA 4LDKA 3HCSA 2HKVA 1D0ZA 3L34A 2WVNA 4OIQF 4K7BA 4B6IA 3U3FA 4F4BA 3U5MA 4LLCA 2CKLA 1C17M 4MVZA 1OCRC 3DXJF 5A6KA 1WOLA 1ORSC 2R7VA 4GNEA 3V5ZA 1WTYA 5L0JA 2VC9A 2YLGA 3GORA 4OIRF 3EPVA 1H9TA 4YT2A 2NG1A 1LM3B 1CHCA 4IAQA 2KYUA 3GODA 5AC4A 1HW2A 4YT5A 3RQGA 5CIVA 4A4CA 3OA1A 1SZIA 1XWJA 4KI2A 2AVKA 2PBEA 1JOGA 2IQJA 5T1DB 1Z7Qc 5SVIA 2EA6A 4QI0A 3VM6A 2OOCA 3MBGA 1HYIA 3K7DA 1G4US 1Q0KA 1WASA 3EZHA 2P57A 1VYKA 2C2LA 2NUTB 4Q7CA 4BPMA 3QZCA 1H6GA 4AL1A 5F5FA 1OQCA 2Y3HA 3DI5A 4CDYA 3HCTA 3H2UA 4CSAA 2YQYA 1T6UA 2XEUA 4RD9A 3JT1A 3DQVR 5F5HA 4I7BA 1QZXA 4YADA 1YYXA 3DAGA 3ZYQA 4WGYA 2KWKA 1WESA 2VJFA 3IHUA 4GQHA 3S28A 3T6RA 4BJTA 1G8XA 2BE5F 4MVOA 2NUPA 4IB4A 4LADB 3ZPV1 4R7EA 5L0IA 5L0DA 2R7QA 4R2YA 2H0DA 2L81A 3V7OA 2MHRA 3H2VA 2CONA 4FK5A 3KDEC 2XLOA 2J7PD 4JZAA 3T6GB 2D8UA 2PX3A 3DPLR 2YL7A 2HUJA 2LGKA 4MQ9F 1TFKB 5DLJA 3B29A 2Q7RA 4LK9A 2XL8A 4DOZA 3HNLA 2BC5A 5KH9A 2E87A 3FAOA 2VNFA 2DGJA 4CS9C 3WG7C 2YKZA 4U5CE 4JTDB 4LDQA 3LQJA 4MVQA 4A0CD 1T6IA 1FNTc 2LCHA 2FFWA 4PJJA 2KREA 3FL2A 4DRIB 4BJ1A 3DM9B 4G7HF 4JURI 2PFDA 2R7TA 3RPGC 2YVRA 2WZLA 4ANJA 3GEEA 1Z60A 2D4UA 3VF0A 3NYJA 3DJUB 4XPWA 1TQGA 2GFHA 2E6RA 3S0XA 1QPUA 2A6EF 2L80A 4A4BA 3GWLA 1E85A 2Q3TA 3LQIA 2MWQA 1E86A 2VPEA 3W8IA 4PJMA 2EGPA 2GAQA 1LIHA 1EA8A 3RFYA 2ETSA 4DBRA 4ZQLA 3KPHA 2OJED 2F22A 4YBSA 5GPGB 1NU7D 1C02A 2KKYA 4MVSA 2EPOA 2AU5A 2KGGA 1A41A 4U5DE 2RI7A 2C04A 2JMDA 4Z0RA 1UFBA 1FTSA 2FFHA 3NG2A 2UUIA 4PFPA 3HKKA 4IGGA 4MSXA 1BR2A 3RYLA 4CCGX 3FANA 2CGEA 5L0HA 4U5BE 1LVKA 4PK4A 3EH1A 4NN2A 4G7ZF 2IXNA 1I4YA 2CYDA 4JTCB 1U0BB 4XPXA 2XS8A 3MYFA 2C03A 3ZQVA 1BZ4A 3EB5A 4JEAA 2KWNA 4F52B 2MNYA 3GL6A 5B1BC 2MIQA 1WEEA 2PP4A 2Y3BA 1N87A 2LGGA 5E33A 2KR4A 2WZFA 3B71A 4JE9A 1S05A 4A2NB 4C7OB 2H8AA 3IQCA 3KNVA 4FAPB 2HMQA 3TOMA 2IYLD 4XLNF 4PJLA 1PCXA 2LGLA 5DQZA 2K1JA 3LLKA 1Z6AA 4H4KC 5KYXB 4BJ5C 1WWPA 2VCCA 2HSBA 3C5KA 4OGCA 2ZPAA 3DE9A 4PJNA 5SVYA 4D4NA 2ECGA 4MVRA 3O6XA 2KWJA 2J9VA 2XM0A 2CW0F 3HNKA 4MTFA 4CJOA 1SMYF 4K0DA 3EFOB 1D1AA 1V4AA 3NYLA 2H7BA 5DVWA 3RPGB 3ATPA 2AWCA 5KYYA 3AQCA 2MT5A 4CJGA 3B9QA 3DE8A 5JT4A 2CKLB 1OCZC 3RW0A 4OIPF 3U5PA 2JX0A 3L8IA 2LAUA 2RR4A 5H1VA 1BORA 3LLIA 4L7XA 3AG3C 4YK5A 1K40A 3FEHA 2HJ3A 3W8HA 3LAYA 3KH2A 4GEHA 2M4EA 3JSEO 2XOZA 3RTRB 3SOUA 5EYAF 4Z9JA 4ZLDA 1OR2A 4XQ1A 5H1UA 4ULWA 3VYWA 2MKEA 1YZAA 1E83A 1WEWA 4WGZA 1XZQA 1WEUA 5SVXA 1V54C 3K1IA 3EGDA 5SVIB 2Z15A 2HV6A 4JEBA 2ZXPA 1JR8A 4YWQA 2NAAA 3KKBA 3LS1A 2Y43A 5G05B 4MVTA 3T6JA 1M2OA 4MS2A 4O62A 3QW0A 1AVOB 1BDJB 3K1HA 5JSLA 5COGA 3WAQA 2HV7A 3NYMA 4R32A 3LRQA 4PR9A 4J7TA 2VCBA 4O64A 3B0UX 2VJFB 4B7YC 4AL0A 4B86C 1OKKA 4DRJB 1PD0A 2XLMA 3S27A 1CGME 4N6CA 2NUPB 3EGXA 4E18A 3LJBA 2GDCA 1UG7A 1IW7F 1M56C 2XL4A 4AE4A 2VCAA 1QLEC 2MNZA 2H0DB 5FCLA 3U5NA 4PTBA 3L11A 2XOYA 2LRIC 3O47A 5AIUA 3S29A 2ECVA 4P6IC 3ZPVE 2XS1A 2ZXWC 5FZTA 4YL0A 3JYHA 2VPDA 2HZ8A 1L7CA 3T4RA 1MM2A 4XWJA 3MHHA 5TABA 4KNWA 1J8YF 3V43A 2L75A 4NTAA 2KK1A 4C3BA 3KYJA 2CSZA 2J9UA 2JMJA 1MMDA 3M63A 2YW8A 3QVZA 3B0VC 3M99A 2YHOA 1OXBA 2YL0A 4HE8D 2R05A 3C8GA 2M1RA 4PFOA 2KIZA 1ZYRF 2GA0A 1Z2QA 2J0WA 2Q9BA 3L1XA 2EPMX 3LESA 4UI9B 4YAXA 2WL8A 5KH3A 3ZTZA 4O6YA 5L3QA 3QMKA 3LQHA 2G3KA 5K3QA 3SNHA 3UMIA 4U5HA 1YARO 5B77A 1Z6UA 2KYHA 3SP1A 1WN0A 1BR1A 2G3VA 3MLGA 4CIPA 3X1OA 4J30B 2V26A 3EG9A 2PX0A 5FB1A 3X2QC 2F6JA 1GM5A 4JRZA 1YYJA 5A6AA 4WZ3B 4MTGA 4XLPF 5T3TA 2YL3A 5D1LB 1ZU5A 2OJQA 2OXQC 2L5UA 2BL2A 2KC3A 3UR3C 1LS4A 3QTHA 1RMDA 1KTMA 2B0OE 3K1IC 1K2FA 3JYYA 4XI1A 1VD4A 3O36A 3EB6A 1QQ3A 2YZSA 4YN0B 5D91A 1ZHZA 2LK4A 1RKEA 2RD9A 3DMDA 4LLEA 4CBEA 4LERA 2GWWA 4JCZA 5L0GA 1MBMA 2MYSA 4O6MA 3M4CA 5C11A 4N3WA 3NDBB 3OEOA 1W2WA 3DM5A 4I7CA 3F47A 3Q6MA 4XEFA 5EK0A 2I15A 4EUKB 3GEHA 3UGOA 2HSQA 5B8DA 1S7ZA 2EPNA 2DSMA 4YT8A 5D1KB 3WODF 5DS4A 3IQ6A 2M3HA 1O87A 4AX2A 1I5NA 1D1CA 1M2VA 2C2VS 3FVYA 1JM7B 4P9TA 1NG1A 2Y69C 2R9RB 3ZVZB 1CPRA 3JZ0A 4BG0A 5JP7A 5BQIA 2OEVA 4JVSA 3VRCA 3S90A 4AP4A 1VMAA 3M7KA 1T1HA 1BR4A 4Z9HA 2Y3GA 5L0CA 3O70A 1HY5A 3WHNA 5KYWA 2J0XA 4GNGA 3LDYA 5KYUA 2XLHA 4YABA 3ABLC 4MTOA 2LXHC 3E70C 2Y1NA 2L7AA 3RKOF 2EIKC 4MVUA 4BEJA 1WILA 1TWHA 3JRMO 4H54A 4G0HA 3M79A 4DVYP 3GANA 3T7LA 1JMWA 2CNWA 3UMKA 5FB0A 2DB4A 1FP0A 4C3EA 3O37A 3US6A 3ECSA 1MQVA 4MVMA 4FIPA 1TWAA 1Z3IX 2JM3A 3AG4C 5DS5A 4G7OF 4D4XA 2DI3A 1GGQA 2DJAA 2YREA 4E0IA 1T9KA 3QW1A 1JPNA 2VB6A 2KGOA 2FUUA 4WZ0A 2XOCA 2M64A 4ONSA 4N06A 3TULA 1WEMA 2LDRA 4F1PA 1EKYA 2W45A 3PURA 1K04A 3SEOA 1WENA 4KBLA 3TD7A 3RF3A 4YATA 4HEAJ 2I8BA 3BRJA 1I4ZA 3U9JA 3DZAA 2G45A 3NG1A 2A1DD 3N9PA 4R8PK 2YYRA 4BBQA 2ZXRA 4CS8A 2UZGA 1OKKD 1XZPA 2XP0A 4V3LC 3SHBA 2ECIA 4AE4B 3EHNA 4EBJA 5G0FA 1ZW2A 5H1TA 3E9VA 1YJGA 1OW8A 5T3WA 1JOCA 2VPGA 3EHMA 5JUAA 5KH7A 4IWBA 1LS1A 3HNIA 5B1AC 1A0BA 3OWTA 3NMJA 1ZU4A 4NC3A 5CI9A 4I1MA 5B3IA 1WGWA 2LP4A 1O3UA 3MX3A 3Q1DA 2R7WA 2UUHA 2G43A 2P61A 3O10A 2R7UA 3AQBA 3ZTMA 3KQIA 5TDRA 1DVPA 2FUIA 4IC3A 2XM4A 2R7RA 2KE1A 4CSAC 4C3DA 2HS5A 2A69F 3CEXA 3LVQE 2KFTA 5TJ5E 2YUCA 2WVQA 3H65A 5L3VA 3Q6NA 5I3LA 3S9OA 3RVYA 3T9OA 1O5HA 3U0CA 1VYXA 3C8GD 4JCHA 3KMIA 2G62A 1ZHXA 3JCUQ 2BAYA 2HMZA 5A6JA 2JUNA 3ZG1A 4ZLCA 4YT4A 1T5OA 3CAXA 5HV9A 4YL3A 3PUQA 3FXHA 2X51A 4IC2A 4EHPA 1ZVZA 3ZIBA 3Q7LA 1G4WR 3U2LA 3T9KA 3GM1A 4ULVA 2R02A 1MMNA 2L0BA 4ZUXU 4LLBA 1YZCA 3C18A 1SR2A 2OQMA 3N9OA 1YLMA 2M85A 1ORJA 4N4WA 5AGFA 1Q0MA 2VPBA 2QNLA 2P7VA 1HE9A 2VP7A 4MNDA 2LSEA 1L3PA 1RKEB 5EGYA 2VJEA 2EODA 3JTLO 2IOQA 3AG1C 2KGIA 1ZHYA 2TMVP 3PHF2 3N0TA 3LUTB 2XXAA 3A9CA 1MNDA 2LQ6A 1PD1A 1Y6DA 3RH3A 5KYNA 5FERA 2MUMA 1NU9C 5G04B 4YBMA 5A6BA 3V5XA 3FAPB 2XLWA 5IY5C 2QLAA 1FFTC 2QJ0A 4V3KC 3UMHA 1J8MF 2EPLX 2CRWA 5BQGA 1M6TA 1ZW3A 2VASA 3SZRA 2YEVA 2LQGA 5TDWA 2IXMA 4XEKA 4QF3A 4A49A 2P1AA 2YL1A 4AYCA 1OW7A 4I3MA 3ABKC 1D1BA 1CPQA 4OD4A 3DDTA 2LFDA 1FR0A 3EH2A 2YU4A 2QICA 4P9FA 2H7VC 1TR2A 5A69A 1E4UA 2A68F 4LJNA 2XL6A 5L0FA 2R7SA 4U5FE 4Q4ZF 1WGMA 1D0XA 4OIOF 4J32B 3TOLA 1NBBA 5KYUB 5BUOA 1YVIA 1KU2A 5H9MA 2A6HF 3KL4A 4FO9A 3AJMA 3DAFA 3JSZA 1OXKA 2YQMA 2FGYA 2OEXA 1YA9A 2Q9CA 3NKDA 3DD7A 2AP3A 2QUPA 1IYMA 4RDAA 3NKEA 3U9MA 4EIYA 2NSFA 4JTAB 2CNWD 2EIJC 4O6NA 4G78A 2CRRA 2KNHA 3PLWA 2E6SA 3AG2C 1ZBDB 3R7CA 2MA6A 3AGUA 1G25A 2RSEB 3ZVYA 5FEYA 1H7IA 1CGOA 2LN0A 4PPEA 4NQFA 4H9DA 1AEPA 4XPYA 1NFOA 4E7SA 2HJMA 1MMAA 2OKUA 4I44A 1V55C 5HSWA 1HMOA 4NTBA 3HJCA 1GS9A 2R03A 3M4BA 3B0PA 3LEOA 4EKWA 3W4YA 5E3AA 3DJNB 5LKTA 3RQEA 2IBFA 2LV9A 2YSJA 4Q6FA 2B0JA 1VOMA 1WE9A 2K4DA 1LDJB 4AUQB 3KYIA 2P0NA 1LI5A 3W2VA 3N2ZB 1HMDA 3POVA 2EIMC 3MYIA 3EJNA 3GM3A 4JJFA 5KYXA 4O7GA 4CDVA 1SF8A 4JW1A 3SXZA 2H7OA 2WVOA 1B68A 1T6QA 2MD7B 2LXPC 1X4IA 1X4UA 2J46A 2VH3A 1K05A 1VB5A 1YA7O 3LNRA 3GM2A 1D0YA 3ZC4A 2CSYA 3G4XA 5DKAA 1FMWA 1CGNA 4YC9A 1ZHWA 4DBQA 3EFOA 2Q00A 1Z5ZA 2F42A 4JJGA 1KNYA 2Y3DA 3I5PA 4DXWA 1AUEA 2CSVA 2YRFA 4QF2A 3LVRE 3F46A 4CDAA 4BJ6A 1WEOA 3K66A 1NZEA 3FM8C 2RSDA 1Q0GA 2PF4E 2KW3C 2JRJA 2WZGA 2A0UA 3GV4A 3RIPA 3CZ6A 4W8PA 2YLDA 2L6FA 4X3GA 3EZIA 2I50A 5E3CA 2L43A 3PMRA 3ASNC 3E2DA 4U5EE 3L8JA 2Y39A 4DJ9A 5COFA 2K17A
chains in the Genus database with same CATH topology
2QY9A 3U5PA 3SHBA 5CI8A 3I4UA 1X4JA 5H1VA 1BORA 2YHSA 3LLIA 4L7XA 3AG3C 4QI2A 4AE4B 2ECIA 2YHNA 1ZHTA 3EHNA 4XTKA 3W8HA 3L0IA 3LAYA 5G0FA 3KH2A 5H1TA 4GEHA 3E9VA 3HLZA 2M4EA 1U6GB 1WEPA 3FDQA 3EQLF 4W8KA 2MD8C 3N9MA 3ABMC 5T3WA 3KV6A 3RTRB 3SOXA 1JOCA 3SOUA 4NY3A 2VPGA 2Y1MA 3EHMA 3U5OA 5EYAF 5KH7A 4IWBA 1LS1A 4ZLDA 5B1AC 5H1UA 5B79A 3OWTA 3IEEA 5E2QA 4C7OA 1ZU4A 4EWCA 5CI9A 3IHPA 4I1MA 5KYYB 1WGWA 4ULWA 3VYWA 3MX3A 2IXPA 2R7WA 2G43A 1WEWA 3ZVRA 1MMGA 1WEUA 2R7UA 5LKUA 1V54C 1HYJA 3EGDA 4DVZA 1IZMA 4UP0A 2Z15A 2HV6A 3AQBA 2ZXPA 3KQIA 3ZSUA 5TDRA 1OCCC 3VK6A 1DVPA 2FUIA 4YWQA 4RBNA 2VJEB 2EINC 3L1ZB 4IC3A 3FAJA 2NAAA 4W4UA 2R7RA 2KE1A 4CSAC 3KKBA 4C3DA 3LS1A 2Y43A 4P5OB 5AITA 5G05B 2DX8A 4MVTA 3T6JA 4CS9A 3PHDA 2A69F 1N1CA 2XXAB 2KFTA 1M2OA 4BJ5A 4QDLA 4GB0A 2HDPA 4CS7A 2YUCA 2P6VA 2WVQA 3K1HA 3H65A 3ZTGA 3I2DA 5L3VA 2WB7A 3Q6NA 4O79A 5I3LA 2HV7A 1RJ9B 2QIZA 3O35A 3NYMA 1O5HA 2ECNA 3O34A 1VYXA 4JCHA 2DYRC 3LRQA 1Z23A 3KMIA 2G62A 1ZHXA 3JCUQ 4HFFB 2W4MA 3EGDB 3ASLA 2BAYA 2K16A 3SOWA 4O64A 2D5RB 3B0UX 2IXOA 4TKPB 3HCSA 1D0ZA 3L34A 2WVNA 3ZG1A 4ZLCA 2VJFB 4OIQF 4K7BA 4B86C 4B7YC 4B6IA 4YT4A 1OKKA 4F4BA 3MHSA 3U5MA 4CA1A 1PD0A 3S27A 4LLCA 3PUQA 2CKLA 2D8SA 2NUPB 2X51A 4IC2A 3EGXA 3ZIBA 1OCRC 3Q7LA 3DXJF 3LJBA 1IW7F 2V3CC 2PUYA 2JD3A 1FBVA 1LDKC 2XSEA 2R7VA 1M56C 2XL4A 4AE4A 4GNEA 1QLEC 2MNZA 2H0DB 5FCLA 4X0RA 3U5NA 4U5GA 4AYCB 4PTBA 1MMNA 2L0BA 4OIRF 3EPVA 4YT2A 2NG1A 2FSAA 4ZUXU 3L11A 1CHCA 3N24A 2LRIC 4LLBA 5AIUA 2KYUA 3GODA 3S29A 3N9OA 2ECVA 5J3XA 4YT5A 4P6IC 2M85A 5DS6A 3ZPVE 5LKXA 3LS0A 4A4CA 2ZXWC 3OA1A 1SZIA 3M62A 2MA5A 4UP5A 2KWOA 1Z63A 4KI2A 4BHWA 4ZDTA 3JYHA 2VPDA 1TWGA 3T4RA 1MM2A 4XWJA 2VPBA 3MHHA 2L9JA 2OCCC 5T1DB 4KNWA 5TABA 1J8YF 3QZVA 4FJCA 3V43A 1JPJA 2L75A 4AVXA 2EA6A 3EGXB 3ZNIA 4C3BA 2P7VA 4QI0A 2CSZA 3FHDA 5B76A 2VP7A 4MNDA 2J9UA 2LSEA 1HYIA 3K7DA 5EGYA 1FFHA 2JMJA 4BJ6C 2VJEA 1MMDA 2EODA 3EZHA 2IOQA 3M63A 1VYKA 2YW8A 3AG1C 2KGIA 2C2LA 1ZHYA 3B0VC 2NUTB 4Q7CA 2YT5A 3QZCA 3PHF2 2KU3A 3M99A 2CT2A 3N0TA 2XXAA 2YHOA 1MNDA 5F5FA 2LQ6A 1PD1A 2ZXOA 4GNFA 2J45A 2Y3HA 3HCTA 4HE8D 4IAOA 3RH3A 4CSAA 2XEUA 1OCOC 4RD9A 5KYNA 5FERA 3JT1A 3DQVR 4HFKB 5F5HA 4PFOA 1RJ9A 2R7XA 2KIZA 2M1RA 2MUMA 1NU9C 4I7BA 1ZYRF 1QZXA 4YADA 5G04B 1Z2QA 4YBMA 2J0WA 3DAGA 3ZYQA 2Q9BA 5IY5C 3L1XA 2W9YA 2PNXA 3LESA 4UI9B 1FFTC 4YAXA 2WL8A 5KH3A 2KWKA 1WESA 2QJ0A 5B78A 2VJFA 4V3KC 3S28A 3UMHA 3T6RA 4O6YA 4BJTA 1MNEA 3QMKA 5L3QA 2ECWA 1G8XA 2BE5F 2G3KA 1J8MF 3LQHA 3SNHA 3UMIA 5C13A 2NUPA 1TWCA 4U5HA 4LADB 2VASA 3SZRA 1Z6UA 3ZPV1 5B77A 2YEVA 3N9NA 4I7DA 4R7EA 5TDWA 1V87A 2IXMA 3SP1A 1BR1A 2G3VA 2R7QA 2ECJA 4QF3A 4A49A 4R2YA 3MLGA 2H0DA 2L81A 3X1OA 4J30B 2V26A 3V7OA 3EG9A 2PX0A 2LGVA 5FB1A 4AYCA 3X2QC 2F6JA 4FK5A 3K6BA 3ABKC 1D1BA 4I3MA 2ZETC 2J7PD 4OD4A 4WZ3B 4JZAA 4XLPF 2XRHA 5T3TA 2QTVA 5DINA 3EH2A 2YU4A 2QICA 5D1LB 1ZU5A 2OXQC 2H7VC 2L5UA 2PX3A 4KC9A 1TR2A 3UR3C 1E4UA 3DPLR 3HTKC 3O7AA 2F6NA 2A68F 2LGKA 4LJNA 2R7SA 1RMDA 4U5FE 4MQ9F 3K1IC 2AN6A 4Q4ZF 5DLJA 1K2FA 1WGMA 1WIMA 1D0XA 4OIOF 4J32B 3NRHA 4LK9A 4XI1A 4DOZA 1VD4A 3O36A 5KYUB 3EB6A 5BUOA 2YZSA 2E87A 5KH9A 4N4FA 2R7OA 4YN0B 4S3OC 1KU2A 5H9MA 4FWVA 2A6HF 5D91A 1ZHZA 1F62A 3KL4A 1WFKA 2VNFA 4FO9A 3DAFA 2DGJA 3JSZA 3WG7C 4CS9C 3VAYA 2YQMA 3DMDA 4LLEA 4CBEA 4LERA 4U5CE 3EG9B 4E7ZA 2NUTA 2FGYA 2Q9CA 3NKDA 2MYSA 1JM7A 3DD7A 4O6MA 3LQJA 1IYMA 1VK5A 3SYNA 4A0CD 3UGPA 5C11A 4N3WA 4PJJA 2KREA 4RDAA 3OEOA 3NDBB 1W2WA 3DM5A 3NKEA 5EHHA 3FL2A 3HCUA 4I7CA 3F47A 3Q6MA 4OINF 2CDQA 4BJ1A 3UGOA 3DM9B 4G7HF 4JURI 2CNWD 2PFDA 2R7TA 5B8DA 5TBNA 2EIJC 3C6WA 3RPGC 4O6NA 2WZLA 2DYSC 2KNHA 4ANJA 3ASOC 1S7ZA 1LKXA 5B3SC 1Z60A 2E6SA 3AG2C 3Q7GA 4YT8A 5D1KB 3WODF 3NYJA 1ZBDB 3DJUB 5DS4A 2GFHA 2M3HA 2MA6A 3M1CB 2E6RA 1O87A 2A6EF 3S0XA 1G25A 2YQLA 2L80A 3ZVYA 5FEYA 4AX2A 1D1CA 4A4BA 4AK9A 2G6QA 2OG2A 1M2VA 2C2VS 2LN0A 3FVYA 4Q5SF 5D1MB 1JM7B 1NG1A 2Q3TA 2Y69C 3LQIA 3ZVZB 2MWQA 2VPEA 4PPEA 3W8IA 4PJMA 4BG0A 2EGPA 2IDAA 2J7PA 2KQ9A 4JVSA 4I44A 1MMAA 4E7SA 3RFYA 1FMVA 1TKNA 4DBRA 1V55C 4ZQLA 5HSWA 4LKAA 4AP4A 3HJCA 4OD5A 1XWHA 1VMAA 4YBSA 5LCWB 3B0PA 1T1HA 1BR4A 1NU7D 4M63A 5E3AA 2Y3GA 4CS8C 3DJNB 3O70A 2KGGA 2J9WA 4U5DE 5LKTA 2RI7A 2C04A 5KYWA 2J0XA 2ECTA 2JMDA 4GNGA 3N9LA 2LV9A 2YSJA 2FFHA 1FTSA 4IJJA 4Q6FA 2B0JA 1VOMA 4YBTA 3NG2A 4PFPA 1WE9A 2K4DA 5KYUA 1LDJB 1M2VB 4MSXA 1BR2A 4AUQB 3RYLA 4CCGX 2YSMA 4C9ZA 2CGEA 4U5BE 1LVKA 4PK4A 4YABA 3EH1A 3ABLC 3W2VA 4NN2A 3LEVA 4G7ZF 2IXNA 3N2ZB 2LXHC 3E70C 3POVA 2EIMC 4I1OB 3EJNA 2Y1NA 4JJFA 5KYXA 4O7GA 2C03A 1SF8A 4JW1A 2H7OA 2WVOA 3N9QA 3EB5A 3RKOF 3I5QA 4L58A 2MD7B 2EIKC 4BEJA 1WILA 4LACB 3K33A 2KWNA 1X4IA 1X4UA 2LXPC 4F52B 1TWHA 2J46A 2VH3A 2W4BA 5B1BC 2JMIA 2MIQA 2MNYA 4G0HA 2HYED 1WEEA 3ITFA 4WA6A 2EILC 3LNRA 4DVYP 2M6MA 2XB1A 3GANA 3T7LA 2PP4A 2Y3BA 2CNWA 2Q9AA 1D0YA 3ZC4A 1N87A 2CSYA 2LGGA 5TRBA 5KYWB 3UMKA 5E33A 5FB0A 1FP0A 2KR4A 5DKAA 3W2WA 4C3EA 4KNVA 3JRTA 3O37A 2WZFA 3UNGC 4A2NB 1FMWA 5B75A 5LKZA 3ECSA 4C7OB 3GL6A 4IRUA 4YC9A 1VYIA 1ZHWA 4DBQA 4FIPA 3KNVA 3EFOA 1TWAA 1Z5ZA 1Z3IX 2O9XA 3AG4C 4JJGA 2KJGA 5DS5A 5DQTA 4G7OF 2F42A 2IYLD 2Y3DA 4WJ0A 4XLNF 3O33A 4PJLA 1PCXA 4FESA 2LGLA 5DQZA 2K1JA 3I5PA 3LLKA 2YREA 1Z6AA 4H4KC 4GYTA 5KYXB 4BJ5C 4EBBA 4QF2A 4S3OB 1JPNA 1ST6A 3C5KA 2ZPAA 3F46A 2VB6A 2KGOA 1WEVA 4BJ6A 4PJNA 2FUUA 4WZ2A 1WEOA 4WZ0A 3K66A 2ECGA 1WEMA 4N06A 1NZEA 2LDRA 2RSDA 4CIHA 3O6XA 2KWJA 3O39A 2W45A 2J9VA 3PURA 2YURA 3SEOA 2CW0F 4KBLA 1VFYA 1WENA 3TD7A 2PF4E 2KW3C 2JRJA 4YATA 2WZGA 3CQZA 1SMYF 2I8BA 4HEAJ 4K0DA 3T6BA 3GV4A 4FX5A 3RIPA 4YJWA 3CZ6A 3DZAA 3EFOB 1D1AA 2G45A 3NG1A 3NYLA 2H7BA 5DVWA 1WEQA 3RPGB 2A1DD 4X3GA 3N9PA 3EZIA 2I50A 4R8PK 2YYRA 5E3CA 4BBQA 5KYYA 1MM3A 2L43A 3AQCA 2ZXRA 3CSKA 3PMRA 5JG6A 5D92A 3ASNC 4CS8A 2MT5A 3B9QA 1M57C 2UZGA 1OKKD 3KV5A 4U5EE 2CKLB 2Y39A 1OCZC 4GNDA 4OIPF 4V3LC 2K17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5P A;  3SHB A;  1X4J A;  5H1V A;  1BOR A;  4L7X A;  2ECI A;  2YHN A;  5G0F A;  5H1T A;  1U6G B;  1WEP A;  2MD8 C;  3N9M A;  3RTR B;  3KV6 A;  3SOX A;  1JOC A;  3SOU A;  2VPG A;  2Y1M A;  3U5O A;  5EYA F;  5KH7 A;  5H1U A;  5B79 A;  3IHP A;  2G43 A;  1WEW A;  1WEU A;  5LKU A;  1HYJ A;  4UP0 A;  3KQI A;  5TDR A;  3VK6 A;  1DVP A;  2FUI A;  2VJE B;  3L1Z B;  4IC3 A;  2NAA A;  4W4U A;  2KE1 A;  2Y43 A;  4P5O B;  5AIT A;  5G05 B;  2DX8 A;  4MVT A;  3PHD A;  2KFT A;  4GB0 A;  2HDP A;  2YUC A;  3ZTG A;  3I2D A;  5I3L A;  2QIZ A;  3O35 A;  3O34 A;  2ECN A;  1VYX A;  3LRQ A;  3ASL A;  2BAY A;  2K16 A;  3SOW A;  4O64 A;  4TKP B;  3HCS A;  2VJF B;  4B7Y C;  4B86 C;  4CA1 A;  3MHS A;  3U5M A;  3PUQ A;  2CKL A;  2D8S A;  4IC2 A;  2PUY A;  1FBV A;  1LDK C;  4GNE A;  2MNZ A;  2H0D B;  3U5N A;  4AYC B;  4PTB A;  2L0B A;  2FSA A;  4ZUX U;  3L11 A;  1CHC A;  2LRI C;  4LLB A;  5AIU A;  2KYU A;  3N9O A;  2ECV A;  5J3X A;  2M85 A;  3ZPV E;  5LKX A;  4A4C A;  3M62 A;  2MA5 A;  4UP5 A;  2KWO A;  4BHW A;  4ZDT A;  2VPD A;  1MM2 A;  2VPB A;  3MHH A;  5TAB A;  4FJC A;  3QZV A;  3V43 A;  2L75 A;  4AVX A;  2EA6 A;  3ZNI A;  2CSZ A;  2VP7 A;  1HYI A;  2JMJ A;  2VJE A;  2EOD A;  3M63 A;  2YW8 A;  2KGI A;  2C2L A;  2YT5 A;  2KU3 A;  3M99 A;  2CT2 A;  2YHO A;  2LQ6 A;  4GNF A;  3HCT A;  2XEU A;  5FER A;  3DQV R;  2M1R A;  2KIZ A;  2MUM A;  4I7B A;  4YAD A;  5G04 B;  1Z2Q A;  4YBM A;  3ZYQ A;  3L1X A;  2PNX A;  4UI9 B;  4YAX A;  5KH3 A;  2KWK A;  1WES A;  2QJ0 A;  5B78 A;  2VJF A;  4V3K C;  3T6R A;  2ECW A;  3LQH A;  5C13 A;  4LAD B;  3ZPV 1;  5B77 A;  1Z6U A;  3N9N A;  4I7D A;  4R7E A;  5TDW A;  1V87 A;  2ECJ A;  4QF3 A;  4A49 A;  4R2Y A;  2H0D A;  5FB1 A;  2LGV A;  4AYC A;  2F6J A;  4FK5 A;  2ZET C;  4WZ3 B;  5DIN A;  2YU4 A;  2QIC A;  5D1L B;  2OXQ C;  2L5U A;  1E4U A;  3DPL R;  3HTK C;  3O7A A;  2F6N A;  2LGK A;  4LJN A;  1RMD A;  2AN6 A;  1K2F A;  1WIM A;  1WGM A;  4XI1 A;  4LK9 A;  1VD4 A;  3O36 A;  3EB6 A;  5KH9 A;  4N4F A;  4S3O C;  5H9M A;  1F62 A;  1WFK A;  2VNF A;  4FO9 A;  2YQM A;  1JM7 A;  3LQJ A;  1IYM A;  4A0C D;  5C11 A;  4N3W A;  2KRE A;  3FL2 A;  3HCU A;  4I7C A;  5B8D A;  5TBN A;  3RPG C;  3C6W A;  1Z60 A;  2E6S A;  5D1K B;  1ZBD B;  2M3H A;  2MA6 A;  2E6R A;  1G25 A;  2YQL A;  2L80 A;  3ZVY A;  5FEY A;  4A4B A;  2G6Q A;  2C2V S;  2LN0 A;  5D1M B;  1JM7 B;  3LQI A;  3ZVZ B;  2VPE A;  4PPE A;  2EGP A;  2IDA A;  4ZQL A;  4LKA A;  4AP4 A;  1XWH A;  4YBS A;  5LCW B;  1T1H A;  3O70 A;  2KGG A;  5LKT A;  2RI7 A;  2JMD A;  2ECT A;  4GNG A;  3N9L A;  2LV9 A;  2YSJ A;  4Q6F A;  4YBT A;  3NG2 A;  1WE9 A;  2K4D A;  1LDJ B;  4MSX A;  4AUQ B;  4CCG X;  2YSM A;  4C9Z A;  4YAB A;  4NN2 A;  2LXH C;  2Y1N A;  3N9Q A;  3EB5 A;  4L58 A;  2MD7 B;  1WIL A;  2KWN A;  2LXP C;  1X4I A;  1X4U A;  4F52 B;  2MNY A;  3GL6 A;  2JMI A;  5B76 A;  2MIQ A;  2HYE D;  4WA6 A;  1WEE A;  2XB1 A;  2M6M A;  3T7L A;  2CSY A;  1N87 A;  2LGG A;  5TRB A;  5FB0 A;  1FP0 A;  2KR4 A;  5DKA A;  3O37 A;  5B75 A;  5LKZ A;  4YC9 A;  4FIP A;  3KNV A;  2F42 A;  3O33 A;  2LGL A;  2K1J A;  2YRE A;  4QF2 A;  4S3O B;  3C5K A;  1WEV A;  2FUU A;  4WZ2 A;  1WEO A;  4WZ0 A;  2ECG A;  1WEM A;  2LDR A;  2RSD A;  2KWJ A;  3PUR A;  2YUR A;  1WEN A;  1VFY A;  2JRJ A;  4YAT A;  3GV4 A;  2G45 A;  1WEQ A;  3RPG B;  4X3G A;  3N9P A;  2I50 A;  4R8P K;  2YYR A;  4BBQ A;  1MM3 A;  2L43 A;  5JG6 A;  2MT5 A;  2UZG A;  3KV5 A;  2CKL B;  4GND A;  4V3L C;  2K17 A; 
#chains in the Genus database with same CATH topology
 2QY9 A;  4PAC A;  3J06 A;  1OR3 A;  4L6R A;  4QI2 A;  3NMI A;  4XTK A;  3L0I A;  2XLV A;  3QVY A;  3V5Y A;  3HLZ A;  3FDQ A;  3EQL F;  4W8K A;  2OU6 A;  3FJU B;  3KV6 A;  1GQA A;  3U5O A;  2CCY A;  3HNJ A;  5B79 A;  3IEE A;  3IQT A;  3SXM A;  3H7H A;  3IHP A;  5KYY B;  3U2M A;  2IXP A;  3ZVR A;  1MMG A;  1YDI A;  4ER9 A;  1BBH A;  1HYJ A;  4CX9 A;  4DVZ A;  1IZM A;  4E0H A;  5JVE A;  3O55 A;  1OCC C;  3VK6 A;  2FD4 A;  4RBN A;  2VJE B;  3L1Z B;  2NPU A;  3MFN A;  4P5O B;  2DX8 A;  3PHD A;  1N1C A;  2E61 A;  1LE4 A;  3ZDL A;  2XXA B;  4BJ5 A;  4UDV A;  4Z0O A;  4GB0 A;  2HDP A;  2P6V A;  3ZTG A;  3I2D A;  2WB7 A;  2QIZ A;  3O35 A;  1EI7 A;  1LPE A;  2YVK A;  4HFF B;  2EXU A;  1WAT A;  3EGD B;  3ASL A;  5A6B D;  2K16 A;  3SOW A;  2D5R B;  4TKP B;  4CA1 A;  3MHS A;  3GWN A;  1E84 A;  2D8S A;  4WAB A;  3TK0 A;  2PUY A;  2V3C C;  2JD3 A;  1FBV A;  1LDK C;  2XSE A;  4NCQ A;  2LIG A;  1APC A;  2XLE A;  4X0R A;  4U5G A;  4AYC B;  2FSA A;  4E17 A;  3N24 A;  4OGE A;  5J3X A;  1DOV A;  5DS6 A;  5LKX A;  3LS0 A;  3M62 A;  2MA5 A;  1HW1 A;  4UP5 A;  2KWO A;  2NSG A;  2L7P A;  1Z63 A;  4BHW A;  4ZDT A;  1TWG A;  3NMK A;  2L9J A;  2OCC C;  1PV3 A;  4FJC A;  3QZV A;  1JPJ A;  256B A;  3TJ6 A;  4AVX A;  3EGX B;  3ZNI A;  3FHD A;  5JS5 A;  4A4A A;  1FFH A;  4BJ6 C;  1C03 A;  3AGT A;  2YT5 A;  2KU3 A;  2CT2 A;  2Q4F A;  1TFO B;  2ZXO A;  4GNF A;  2J45 A;  1Q0F A;  2KSF A;  1RMV A;  4IAO A;  2ASR A;  5JRA A;  4U9D A;  1OCO C;  4HFK B;  1RJ9 A;  5AC5 A;  2R7X A;  5F28 E;  1SYQ A;  2OWA A;  2W9Y A;  3JUE A;  2PNX A;  3C7J A;  4U9E A;  2B0H A;  2X0C A;  3C62 A;  5B78 A;  1E2X A;  2FAP B;  1MNE A;  2ECW A;  2J8W A;  3U8V A;  5C13 A;  1R5I D;  1QSP A;  1TWC A;  3N9N A;  4I7D A;  1V87 A;  2ECJ A;  1LI7 A;  2LGV A;  1RXQ A;  3K6B A;  3C8G B;  1LE2 A;  4EBK A;  2ZET C;  5BQH A;  3M15 A;  2XRH A;  2QTV A;  5DIN A;  3FOP A;  4KC9 A;  3HTK C;  1G5Z A;  3O7A A;  2F6N A;  5COM A;  1Y4C A;  2AN6 A;  1WIM A;  4JKV A;  2R25 A;  4MW8 A;  3NRH A;  3LNM B;  2L6G A;  4N4F A;  2R7O A;  4S3O C;  1A7E A;  4FWV A;  1F62 A;  1WFK A;  3DKA A;  1QVX A;  2EPK X;  3VAY A;  3EG9 B;  4E7Z A;  3G50 A;  2NUT A;  3A11 A;  1JM7 A;  3TJ5 A;  1VK5 A;  3C8Z A;  3SYN A;  2HFI A;  3UGP A;  3HCU A;  5EHH A;  3ZWI A;  4OIN F;  2A0B A;  3U3B A;  2CDQ A;  2LFF A;  3RVZ A;  4IAR A;  5TBN A;  3C6W A;  2DYS C;  3ASO C;  1LKX A;  1NSG B;  5B3S C;  3Q7G A;  1R4T A;  1H9G A;  3M1C B;  3G4Z A;  4K1O A;  4MW3 A;  2YQL A;  4AK9 A;  4J7Y A;  1JRA A;  2G6Q A;  2OG2 A;  5JLI A;  1RCP A;  4Q5S F;  5D1M B;  4NTF A;  1NLX A;  2YLI A;  1U89 A;  2IDA A;  2J7P A;  2KQ9 A;  1DCQ A;  1FMV A;  1TKN A;  1FAP B;  4JC7 A;  4LKA A;  4OD5 A;  1XWH A;  5LCW B;  3DWD A;  1A7D A;  3FMS A;  4M63 A;  4CS8 C;  2J9W A;  2ECT A;  3N9L A;  4IJJ A;  4YBT A;  3PDM P;  1HE1 A;  1M2V B;  2YSM A;  4C9Z A;  2JPU A;  3LEV A;  4N6H A;  4I1O B;  3MDB C;  4YL1 A;  1JAF A;  4Z9I A;  2KKX A;  3N9Q A;  3I5Q A;  4L58 A;  2L6H A;  2EGM A;  2J9B A;  4LAC B;  3K33 A;  2W4B A;  2JMI A;  5B76 A;  2HYE D;  4WA6 A;  3ITF A;  2EIL C;  2XB1 A;  5K0I A;  2M6M A;  4QQ4 A;  3TQO A;  2Q9A A;  5TRB A;  5KYW B;  3W2W A;  4KNV A;  3JRT A;  5B75 A;  3UNG C;  5LKZ A;  3SXK A;  4IRU A;  1VYI A;  1NFN A;  1A7V A;  2O9X A;  3BEH A;  2KJG A;  5DQT A;  1VLS A;  4WJ0 A;  3O33 A;  1Q0D A;  1DOW A;  4FES A;  3SXY A;  4GYT A;  4EBB A;  3PCV A;  4S3O B;  1VLT A;  1ST6 A;  2PNO A;  4DRH B;  1WEV A;  4WZ2 A;  3U5S A;  4CIH A;  2XLD A;  1YAU O;  3O39 A;  1VTM P;  3C63 A;  3GEI A;  2YUR A;  1VFY A;  1F1M A;  3CQZ A;  3T6B A;  1T01 A;  4FX5 A;  4YJW A;  1WEQ A;  1OW6 A;  2AWY A;  3LJU X;  1QKR A;  4JIO A;  2IM8 A;  1MM3 A;  5JG6 A;  3CSK A;  2QE9 A;  5D92 A;  2M13 A;  1M57 C;  3KV5 A;  4GND A;  5CI8 A;  3I4U A;  1X4J A;  2YHS A;  2YHN A;  1ZHT A;  1ORY A;  1U6G B;  1WEP A;  2MD8 C;  3N9M A;  3ABM C;  3SOX A;  4NY3 A;  2ZD9 A;  3RQF A;  2Y1M A;  3S84 A;  5E2Q A;  4C7O A;  4EWC A;  3ZQY A;  4LDR A;  3U8P A;  5LKU A;  3IQ5 A;  4UP0 A;  1U6H A;  3ZSU A;  1V74 B;  2EIN C;  4W4U A;  3FAJ A;  3IPM O;  5AIT A;  3AOU A;  4CS9 A;  1ZZP A;  3DWW A;  3R2P A;  3FOO A;  3SUB A;  2YWA A;  4QDL A;  4BEM J;  4CS7 A;  1RKC A;  4O79 A;  1EQ1 A;  1RJ9 B;  3O34 A;  2ECN A;  2DYR C;  1Z23 A;  3L1M A;  4XEV A;  2W4M A;  2ICW G;  2LD6 A;  2IXO A;  4LDK A;  3HCS A;  2HKV A;  1D0Z A;  3L34 A;  2WVN A;  4OIQ F;  4K7B A;  4B6I A;  3U3F A;  4F4B A;  3U5M A;  4LLC A;  2CKL A;  1C17 M;  4MVZ A;  1OCR C;  3DXJ F;  5A6K A;  1WOL A;  1ORS C;  2R7V A;  4GNE A;  3V5Z A;  1WTY A;  5L0J A;  2VC9 A;  2YLG A;  3GOR A;  4OIR F;  3EPV A;  1H9T A;  4YT2 A;  2NG1 A;  1LM3 B;  1CHC A;  4IAQ A;  2KYU A;  3GOD A;  5AC4 A;  1HW2 A;  4YT5 A;  3RQG A;  5CIV A;  4A4C A;  3OA1 A;  1SZI A;  1XWJ A;  4KI2 A;  2AVK A;  2PBE A;  1JOG A;  2IQJ A;  5T1D B;  1Z7Q c;  5SVI A;  2EA6 A;  4QI0 A;  3VM6 A;  2OOC A;  3MBG A;  1HYI A;  3K7D A;  1G4U S;  1Q0K A;  1WAS A;  3EZH A;  2P57 A;  1VYK A;  2C2L A;  2NUT B;  4Q7C A;  4BPM A;  3QZC A;  1H6G A;  4AL1 A;  5F5F A;  1OQC A;  2Y3H A;  3DI5 A;  4CDY A;  3HCT A;  3H2U A;  4CSA A;  2YQY A;  1T6U A;  2XEU A;  4RD9 A;  3JT1 A;  3DQV R;  5F5H A;  4I7B A;  1QZX A;  4YAD A;  1YYX A;  3DAG A;  3ZYQ A;  4WGY A;  2KWK A;  1WES A;  2VJF A;  3IHU A;  4GQH A;  3S28 A;  3T6R A;  4BJT A;  1G8X A;  2BE5 F;  4MVO A;  2NUP A;  4IB4 A;  4LAD B;  3ZPV 1;  4R7E A;  5L0I A;  5L0D A;  2R7Q A;  4R2Y A;  2H0D A;  2L81 A;  3V7O A;  2MHR A;  3H2V A;  2CON A;  4FK5 A;  3KDE C;  2XLO A;  2J7P D;  4JZA A;  3T6G B;  2D8U A;  2PX3 A;  3DPL R;  2YL7 A;  2HUJ A;  2LGK A;  4MQ9 F;  1TFK B;  5DLJ A;  3B29 A;  2Q7R A;  4LK9 A;  2XL8 A;  4DOZ A;  3HNL A;  2BC5 A;  5KH9 A;  2E87 A;  3FAO A;  2VNF A;  2DGJ A;  4CS9 C;  3WG7 C;  2YKZ A;  4U5C E;  4JTD B;  4LDQ A;  3LQJ A;  4MVQ A;  4A0C D;  1T6I A;  1FNT c;  2LCH A;  2FFW A;  4PJJ A;  2KRE A;  3FL2 A;  4DRI B;  4BJ1 A;  3DM9 B;  4G7H F;  4JUR I;  2PFD A;  2R7T A;  3RPG C;  2YVR A;  2WZL A;  4ANJ A;  3GEE A;  1Z60 A;  2D4U A;  3VF0 A;  3NYJ A;  3DJU B;  4XPW A;  1TQG A;  2GFH A;  2E6R A;  3S0X A;  1QPU A;  2A6E F;  2L80 A;  4A4B A;  3GWL A;  1E85 A;  2Q3T A;  3LQI A;  2MWQ A;  1E86 A;  2VPE A;  3W8I A;  4PJM A;  2EGP A;  2GAQ A;  1LIH A;  1EA8 A;  3RFY A;  2ETS A;  4DBR A;  4ZQL A;  3KPH A;  2OJE D;  2F22 A;  4YBS A;  5GPG B;  1NU7 D;  1C02 A;  2KKY A;  4MVS A;  2EPO A;  2AU5 A;  2KGG A;  1A41 A;  4U5D E;  2RI7 A;  2C04 A;  2JMD A;  4Z0R A;  1UFB A;  1FTS A;  2FFH A;  3NG2 A;  2UUI A;  4PFP A;  3HKK A;  4IGG A;  4MSX A;  1BR2 A;  3RYL A;  4CCG X;  3FAN A;  2CGE A;  5L0H A;  4U5B E;  1LVK A;  4PK4 A;  3EH1 A;  4NN2 A;  4G7Z F;  2IXN A;  1I4Y A;  2CYD A;  4JTC B;  1U0B B;  4XPX A;  2XS8 A;  3MYF A;  2C03 A;  3ZQV A;  1BZ4 A;  3EB5 A;  4JEA A;  2KWN A;  4F52 B;  2MNY A;  3GL6 A;  5B1B C;  2MIQ A;  1WEE A;  2PP4 A;  2Y3B A;  1N87 A;  2LGG A;  5E33 A;  2KR4 A;  2WZF A;  3B71 A;  4JE9 A;  1S05 A;  4A2N B;  4C7O B;  2H8A A;  3IQC A;  3KNV A;  4FAP B;  2HMQ A;  3TOM A;  2IYL D;  4XLN F;  4PJL A;  1PCX A;  2LGL A;  5DQZ A;  2K1J A;  3LLK A;  1Z6A A;  4H4K C;  5KYX B;  4BJ5 C;  1WWP A;  2VCC A;  2HSB A;  3C5K A;  4OGC A;  2ZPA A;  3DE9 A;  4PJN A;  5SVY A;  4D4N A;  2ECG A;  4MVR A;  3O6X A;  2KWJ A;  2J9V A;  2XM0 A;  2CW0 F;  3HNK A;  4MTF A;  4CJO A;  1SMY F;  4K0D A;  3EFO B;  1D1A A;  1V4A A;  3NYL A;  2H7B A;  5DVW A;  3RPG B;  3ATP A;  2AWC A;  5KYY A;  3AQC A;  2MT5 A;  4CJG A;  3B9Q A;  3DE8 A;  5JT4 A;  2CKL B;  1OCZ C;  3RW0 A;  4OIP F;  3U5P A;  2JX0 A;  3L8I A;  2LAU A;  2RR4 A;  5H1V A;  1BOR A;  3LLI A;  4L7X A;  3AG3 C;  4YK5 A;  1K40 A;  3FEH A;  2HJ3 A;  3W8H A;  3LAY A;  3KH2 A;  4GEH A;  2M4E A;  3JSE O;  2XOZ A;  3RTR B;  3SOU A;  5EYA F;  4Z9J A;  4ZLD A;  1OR2 A;  4XQ1 A;  5H1U A;  4ULW A;  3VYW A;  2MKE A;  1YZA A;  1E83 A;  1WEW A;  4WGZ A;  1XZQ A;  1WEU A;  5SVX A;  1V54 C;  3K1I A;  3EGD A;  5SVI B;  2Z15 A;  2HV6 A;  4JEB A;  2ZXP A;  1JR8 A;  4YWQ A;  2NAA A;  3KKB A;  3LS1 A;  2Y43 A;  5G05 B;  4MVT A;  3T6J A;  1M2O A;  4MS2 A;  4O62 A;  3QW0 A;  1AVO B;  1BDJ B;  3K1H A;  5JSL A;  5COG A;  3WAQ A;  2HV7 A;  3NYM A;  4R32 A;  3LRQ A;  4PR9 A;  4J7T A;  2VCB A;  4O64 A;  3B0U X;  2VJF B;  4B7Y C;  4AL0 A;  4B86 C;  1OKK A;  4DRJ B;  1PD0 A;  2XLM A;  3S27 A;  1CGM E;  4N6C A;  2NUP B;  3EGX A;  4E18 A;  3LJB A;  2GDC A;  1UG7 A;  1IW7 F;  1M56 C;  2XL4 A;  4AE4 A;  2VCA A;  1QLE C;  2MNZ A;  2H0D B;  5FCL A;  3U5N A;  4PTB A;  3L11 A;  2XOY A;  2LRI C;  3O47 A;  5AIU A;  3S29 A;  2ECV A;  4P6I C;  3ZPV E;  2XS1 A;  2ZXW C;  5FZT A;  4YL0 A;  3JYH A;  2VPD A;  2HZ8 A;  1L7C A;  3T4R A;  1MM2 A;  4XWJ A;  3MHH A;  5TAB A;  4KNW A;  1J8Y F;  3V43 A;  2L75 A;  4NTA A;  2KK1 A;  4C3B A;  3KYJ A;  2CSZ A;  2J9U A;  2JMJ A;  1MMD A;  3M63 A;  2YW8 A;  3QVZ A;  3B0V C;  3M99 A;  2YHO A;  1OXB A;  2YL0 A;  4HE8 D;  2R05 A;  3C8G A;  2M1R A;  4PFO A;  2KIZ A;  1ZYR F;  2GA0 A;  1Z2Q A;  2J0W A;  2Q9B A;  3L1X A;  2EPM X;  3LES A;  4UI9 B;  4YAX A;  2WL8 A;  5KH3 A;  3ZTZ A;  4O6Y A;  5L3Q A;  3QMK A;  3LQH A;  2G3K A;  5K3Q A;  3SNH A;  3UMI A;  4U5H A;  1YAR O;  5B77 A;  1Z6U A;  2KYH A;  3SP1 A;  1WN0 A;  1BR1 A;  2G3V A;  3MLG A;  4CIP A;  3X1O A;  4J30 B;  2V26 A;  3EG9 A;  2PX0 A;  5FB1 A;  3X2Q C;  2F6J A;  1GM5 A;  4JRZ A;  1YYJ A;  5A6A A;  4WZ3 B;  4MTG A;  4XLP F;  5T3T A;  2YL3 A;  5D1L B;  1ZU5 A;  2OJQ A;  2OXQ C;  2L5U A;  2BL2 A;  2KC3 A;  3UR3 C;  1LS4 A;  3QTH A;  1RMD A;  1KTM A;  2B0O E;  3K1I C;  1K2F A;  3JYY A;  4XI1 A;  1VD4 A;  3O36 A;  3EB6 A;  1QQ3 A;  2YZS A;  4YN0 B;  5D91 A;  1ZHZ A;  2LK4 A;  1RKE A;  2RD9 A;  3DMD A;  4LLE A;  4CBE A;  4LER A;  2GWW A;  4JCZ A;  5L0G A;  1MBM A;  2MYS A;  4O6M A;  3M4C A;  5C11 A;  4N3W A;  3NDB B;  3OEO A;  1W2W A;  3DM5 A;  4I7C A;  3F47 A;  3Q6M A;  4XEF A;  5EK0 A;  2I15 A;  4EUK B;  3GEH A;  3UGO A;  2HSQ A;  5B8D A;  1S7Z A;  2EPN A;  2DSM A;  4YT8 A;  5D1K B;  3WOD F;  5DS4 A;  3IQ6 A;  2M3H A;  1O87 A;  4AX2 A;  1I5N A;  1D1C A;  1M2V A;  2C2V S;  3FVY A;  1JM7 B;  4P9T A;  1NG1 A;  2Y69 C;  2R9R B;  3ZVZ B;  1CPR A;  3JZ0 A;  4BG0 A;  5JP7 A;  5BQI A;  2OEV A;  4JVS A;  3VRC A;  3S90 A;  4AP4 A;  1VMA A;  3M7K A;  1T1H A;  1BR4 A;  4Z9H A;  2Y3G A;  5L0C A;  3O70 A;  1HY5 A;  3WHN A;  5KYW A;  2J0X A;  4GNG A;  3LDY A;  5KYU A;  2XLH A;  4YAB A;  3ABL C;  4MTO A;  2LXH C;  3E70 C;  2Y1N A;  2L7A A;  3RKO F;  2EIK C;  4MVU A;  4BEJ A;  1WIL A;  1TWH A;  3JRM O;  4H54 A;  4G0H A;  3M79 A;  4DVY P;  3GAN A;  3T7L A;  1JMW A;  2CNW A;  3UMK A;  5FB0 A;  2DB4 A;  1FP0 A;  4C3E A;  3O37 A;  3US6 A;  3ECS A;  1MQV A;  4MVM A;  4FIP A;  1TWA A;  1Z3I X;  2JM3 A;  3AG4 C;  5DS5 A;  4G7O F;  4D4X A;  2DI3 A;  1GGQ A;  2DJA A;  2YRE A;  4E0I A;  1T9K A;  3QW1 A;  1JPN A;  2VB6 A;  2KGO A;  2FUU A;  4WZ0 A;  2XOC A;  2M64 A;  4ONS A;  4N06 A;  3TUL A;  1WEM A;  2LDR A;  4F1P A;  1EKY A;  2W45 A;  3PUR A;  1K04 A;  3SEO A;  1WEN A;  4KBL A;  3TD7 A;  3RF3 A;  4YAT A;  4HEA J;  2I8B A;  3BRJ A;  1I4Z A;  3U9J A;  3DZA A;  2G45 A;  3NG1 A;  2A1D D;  3N9P A;  4R8P K;  2YYR A;  4BBQ A;  2ZXR A;  4CS8 A;  2UZG A;  1OKK D;  1XZP A;  2XP0 A;  4V3L C;  3SHB A;  2ECI A;  4AE4 B;  3EHN A;  4EBJ A;  5G0F A;  1ZW2 A;  5H1T A;  3E9V A;  1YJG A;  1OW8 A;  5T3W A;  1JOC A;  2VPG A;  3EHM A;  5JUA A;  5KH7 A;  4IWB A;  1LS1 A;  3HNI A;  5B1A C;  1A0B A;  3OWT A;  3NMJ A;  1ZU4 A;  4NC3 A;  5CI9 A;  4I1M A;  5B3I A;  1WGW A;  2LP4 A;  1O3U A;  3MX3 A;  3Q1D A;  2R7W A;  2UUH A;  2G43 A;  2P61 A;  3O10 A;  2R7U A;  3AQB A;  3ZTM A;  3KQI A;  5TDR A;  1DVP A;  2FUI A;  4IC3 A;  2XM4 A;  2R7R A;  2KE1 A;  4CSA C;  4C3D A;  2HS5 A;  2A69 F;  3CEX A;  3LVQ E;  2KFT A;  5TJ5 E;  2YUC A;  2WVQ A;  3H65 A;  5L3V A;  3Q6N A;  5I3L A;  3S9O A;  3RVY A;  3T9O A;  1O5H A;  3U0C A;  1VYX A;  3C8G D;  4JCH A;  3KMI A;  2G62 A;  1ZHX A;  3JCU Q;  2BAY A;  2HMZ A;  5A6J A;  2JUN A;  3ZG1 A;  4ZLC A;  4YT4 A;  1T5O A;  3CAX A;  5HV9 A;  4YL3 A;  3PUQ A;  3FXH A;  2X51 A;  4IC2 A;  4EHP A;  1ZVZ A;  3ZIB A;  3Q7L A;  1G4W R;  3U2L A;  3T9K A;  3GM1 A;  4ULV A;  2R02 A;  1MMN A;  2L0B A;  4ZUX U;  4LLB A;  1YZC A;  3C18 A;  1SR2 A;  2OQM A;  3N9O A;  1YLM A;  2M85 A;  1ORJ A;  4N4W A;  5AGF A;  1Q0M A;  2VPB A;  2QNL A;  2P7V A;  1HE9 A;  2VP7 A;  4MND A;  2LSE A;  1L3P A;  1RKE B;  5EGY A;  2VJE A;  2EOD A;  3JTL O;  2IOQ A;  3AG1 C;  2KGI A;  1ZHY A;  2TMV P;  3PHF 2;  3N0T A;  3LUT B;  2XXA A;  3A9C A;  1MND A;  2LQ6 A;  1PD1 A;  1Y6D A;  3RH3 A;  5KYN A;  5FER A;  2MUM A;  1NU9 C;  5G04 B;  4YBM A;  5A6B A;  3V5X A;  3FAP B;  2XLW A;  5IY5 C;  2QLA A;  1FFT C;  2QJ0 A;  4V3K C;  3UMH A;  1J8M F;  2EPL X;  2CRW A;  5BQG A;  1M6T A;  1ZW3 A;  2VAS A;  3SZR A;  2YEV A;  2LQG A;  5TDW A;  2IXM A;  4XEK A;  4QF3 A;  4A49 A;  2P1A A;  2YL1 A;  4AYC A;  1OW7 A;  4I3M A;  3ABK C;  1D1B A;  1CPQ A;  4OD4 A;  3DDT A;  2LFD A;  1FR0 A;  3EH2 A;  2YU4 A;  2QIC A;  4P9F A;  2H7V C;  1TR2 A;  5A69 A;  1E4U A;  2A68 F;  4LJN A;  2XL6 A;  5L0F A;  2R7S A;  4U5F E;  4Q4Z F;  1WGM A;  1D0X A;  4OIO F;  4J32 B;  3TOL A;  1NBB A;  5KYU B;  5BUO A;  1YVI A;  1KU2 A;  5H9M A;  2A6H F;  3KL4 A;  4FO9 A;  3AJM A;  3DAF A;  3JSZ A;  1OXK A;  2YQM A;  2FGY A;  2OEX A;  1YA9 A;  2Q9C A;  3NKD A;  3DD7 A;  2AP3 A;  2QUP A;  1IYM A;  4RDA A;  3NKE A;  3U9M A;  4EIY A;  2NSF A;  4JTA B;  2CNW D;  2EIJ C;  4O6N A;  4G78 A;  2CRR A;  2KNH A;  3PLW A;  2E6S A;  3AG2 C;  1ZBD B;  3R7C A;  2MA6 A;  3AGU A;  1G25 A;  2RSE B;  3ZVY A;  5FEY A;  1H7I A;  1CGO A;  2LN0 A;  4PPE A;  4NQF A;  4H9D A;  1AEP A;  4XPY A;  1NFO A;  4E7S A;  2HJM A;  1MMA A;  2OKU A;  4I44 A;  1V55 C;  5HSW A;  1HMO A;  4NTB A;  3HJC A;  1GS9 A;  2R03 A;  3M4B A;  3B0P A;  3LEO A;  4EKW A;  3W4Y A;  5E3A A;  3DJN B;  5LKT A;  3RQE A;  2IBF A;  2LV9 A;  2YSJ A;  4Q6F A;  2B0J A;  1VOM A;  1WE9 A;  2K4D A;  1LDJ B;  4AUQ B;  3KYI A;  2P0N A;  1LI5 A;  3W2V A;  3N2Z B;  1HMD A;  3POV A;  2EIM C;  3MYI A;  3EJN A;  3GM3 A;  4JJF A;  5KYX A;  4O7G A;  4CDV A;  1SF8 A;  4JW1 A;  3SXZ A;  2H7O A;  2WVO A;  1B68 A;  1T6Q A;  2MD7 B;  2LXP C;  1X4I A;  1X4U A;  2J46 A;  2VH3 A;  1K05 A;  1VB5 A;  1YA7 O;  3LNR A;  3GM2 A;  1D0Y A;  3ZC4 A;  2CSY A;  3G4X A;  5DKA A;  1FMW A;  1CGN A;  4YC9 A;  1ZHW A;  4DBQ A;  3EFO A;  2Q00 A;  1Z5Z A;  2F42 A;  4JJG A;  1KNY A;  2Y3D A;  3I5P A;  4DXW A;  1AUE A;  2CSV A;  2YRF A;  4QF2 A;  3LVR E;  3F46 A;  4CDA A;  4BJ6 A;  1WEO A;  3K66 A;  1NZE A;  3FM8 C;  2RSD A;  1Q0G A;  2PF4 E;  2KW3 C;  2JRJ A;  2WZG A;  2A0U A;  3GV4 A;  3RIP A;  3CZ6 A;  4W8P A;  2YLD A;  2L6F A;  4X3G A;  3EZI A;  2I50 A;  5E3C A;  2L43 A;  3PMR A;  3ASN C;  3E2D A;  4U5E E;  3L8J A;  2Y39 A;  4DJ9 A;  5COF A;  2K17 A; 
#chains in the Genus database with same CATH homology
 2QY9 A;  3U5P A;  3SHB A;  5CI8 A;  3I4U A;  1X4J A;  5H1V A;  1BOR A;  2YHS A;  3LLI A;  4L7X A;  3AG3 C;  4QI2 A;  4AE4 B;  2ECI A;  2YHN A;  1ZHT A;  3EHN A;  4XTK A;  3W8H A;  3L0I A;  3LAY A;  5G0F A;  3KH2 A;  5H1T A;  4GEH A;  3E9V A;  3HLZ A;  2M4E A;  1U6G B;  1WEP A;  3FDQ A;  3EQL F;  4W8K A;  2MD8 C;  3N9M A;  3ABM C;  5T3W A;  3KV6 A;  3RTR B;  3SOX A;  1JOC A;  3SOU A;  4NY3 A;  2VPG A;  2Y1M A;  3EHM A;  3U5O A;  5EYA F;  5KH7 A;  4IWB A;  1LS1 A;  4ZLD A;  5B1A C;  5H1U A;  5B79 A;  3OWT A;  3IEE A;  5E2Q A;  4C7O A;  1ZU4 A;  4EWC A;  5CI9 A;  3IHP A;  4I1M A;  5KYY B;  1WGW A;  4ULW A;  3VYW A;  3MX3 A;  2IXP A;  2R7W A;  2G43 A;  1WEW A;  3ZVR A;  1MMG A;  1WEU A;  2R7U A;  5LKU A;  1V54 C;  1HYJ A;  3EGD A;  4DVZ A;  1IZM A;  4UP0 A;  2Z15 A;  2HV6 A;  3AQB A;  2ZXP A;  3KQI A;  3ZSU A;  5TDR A;  1OCC C;  3VK6 A;  1DVP A;  2FUI A;  4YWQ A;  4RBN A;  2VJE B;  2EIN C;  3L1Z B;  4IC3 A;  3FAJ A;  2NAA A;  4W4U A;  2R7R A;  2KE1 A;  4CSA C;  3KKB A;  4C3D A;  3LS1 A;  2Y43 A;  4P5O B;  5AIT A;  5G05 B;  2DX8 A;  4MVT A;  3T6J A;  4CS9 A;  3PHD A;  2A69 F;  1N1C A;  2XXA B;  2KFT A;  1M2O A;  4BJ5 A;  4QDL A;  4GB0 A;  2HDP A;  4CS7 A;  2YUC A;  2P6V A;  2WVQ A;  3K1H A;  3H65 A;  3ZTG A;  3I2D A;  5L3V A;  2WB7 A;  3Q6N A;  4O79 A;  5I3L A;  2HV7 A;  1RJ9 B;  2QIZ A;  3O35 A;  3NYM A;  1O5H A;  2ECN A;  3O34 A;  1VYX A;  4JCH A;  2DYR C;  3LRQ A;  1Z23 A;  3KMI A;  2G62 A;  1ZHX A;  3JCU Q;  4HFF B;  2W4M A;  3EGD B;  3ASL A;  2BAY A;  2K16 A;  3SOW A;  4O64 A;  2D5R B;  3B0U X;  2IXO A;  4TKP B;  3HCS A;  1D0Z A;  3L34 A;  2WVN A;  3ZG1 A;  4ZLC A;  2VJF B;  4OIQ F;  4K7B A;  4B86 C;  4B7Y C;  4B6I A;  4YT4 A;  1OKK A;  4F4B A;  3MHS A;  3U5M A;  4CA1 A;  1PD0 A;  3S27 A;  4LLC A;  3PUQ A;  2CKL A;  2D8S A;  2NUP B;  2X51 A;  4IC2 A;  3EGX A;  3ZIB A;  1OCR C;  3Q7L A;  3DXJ F;  3LJB A;  1IW7 F;  2V3C C;  2PUY A;  2JD3 A;  1FBV A;  1LDK C;  2XSE A;  2R7V A;  1M56 C;  2XL4 A;  4AE4 A;  4GNE A;  1QLE C;  2MNZ A;  2H0D B;  5FCL A;  4X0R A;  3U5N A;  4U5G A;  4AYC B;  4PTB A;  1MMN A;  2L0B A;  4OIR F;  3EPV A;  4YT2 A;  2NG1 A;  2FSA A;  4ZUX U;  3L11 A;  1CHC A;  3N24 A;  2LRI C;  4LLB A;  5AIU A;  2KYU A;  3GOD A;  3S29 A;  3N9O A;  2ECV A;  5J3X A;  4YT5 A;  4P6I C;  2M85 A;  5DS6 A;  3ZPV E;  5LKX A;  3LS0 A;  4A4C A;  2ZXW C;  3OA1 A;  1SZI A;  3M62 A;  2MA5 A;  4UP5 A;  2KWO A;  1Z63 A;  4KI2 A;  4BHW A;  4ZDT A;  3JYH A;  2VPD A;  1TWG A;  3T4R A;  1MM2 A;  4XWJ A;  2VPB A;  3MHH A;  2L9J A;  2OCC C;  5T1D B;  4KNW A;  5TAB A;  1J8Y F;  3QZV A;  4FJC A;  3V43 A;  1JPJ A;  2L75 A;  4AVX A;  2EA6 A;  3EGX B;  3ZNI A;  4C3B A;  2P7V A;  4QI0 A;  2CSZ A;  3FHD A;  5B76 A;  2VP7 A;  4MND A;  2J9U A;  2LSE A;  1HYI A;  3K7D A;  5EGY A;  1FFH A;  2JMJ A;  4BJ6 C;  2VJE A;  1MMD A;  2EOD A;  3EZH A;  2IOQ A;  3M63 A;  1VYK A;  2YW8 A;  3AG1 C;  2KGI A;  2C2L A;  1ZHY A;  3B0V C;  2NUT B;  4Q7C A;  2YT5 A;  3QZC A;  3PHF 2;  2KU3 A;  3M99 A;  2CT2 A;  3N0T A;  2XXA A;  2YHO A;  1MND A;  5F5F A;  2LQ6 A;  1PD1 A;  2ZXO A;  4GNF A;  2J45 A;  2Y3H A;  3HCT A;  4HE8 D;  4IAO A;  3RH3 A;  4CSA A;  2XEU A;  1OCO C;  4RD9 A;  5KYN A;  5FER A;  3JT1 A;  3DQV R;  4HFK B;  5F5H A;  4PFO A;  1RJ9 A;  2R7X A;  2KIZ A;  2M1R A;  2MUM A;  1NU9 C;  4I7B A;  1ZYR F;  1QZX A;  4YAD A;  5G04 B;  1Z2Q A;  4YBM A;  2J0W A;  3DAG A;  3ZYQ A;  2Q9B A;  5IY5 C;  3L1X A;  2W9Y A;  2PNX A;  3LES A;  4UI9 B;  1FFT C;  4YAX A;  2WL8 A;  5KH3 A;  2KWK A;  1WES A;  2QJ0 A;  5B78 A;  2VJF A;  4V3K C;  3S28 A;  3UMH A;  3T6R A;  4O6Y A;  4BJT A;  1MNE A;  3QMK A;  5L3Q A;  2ECW A;  1G8X A;  2BE5 F;  2G3K A;  1J8M F;  3LQH A;  3SNH A;  3UMI A;  5C13 A;  2NUP A;  1TWC A;  4U5H A;  4LAD B;  2VAS A;  3SZR A;  1Z6U A;  3ZPV 1;  5B77 A;  2YEV A;  3N9N A;  4I7D A;  4R7E A;  5TDW A;  1V87 A;  2IXM A;  3SP1 A;  1BR1 A;  2G3V A;  2R7Q A;  2ECJ A;  4QF3 A;  4A49 A;  4R2Y A;  3MLG A;  2H0D A;  2L81 A;  3X1O A;  4J30 B;  2V26 A;  3V7O A;  3EG9 A;  2PX0 A;  2LGV A;  5FB1 A;  4AYC A;  3X2Q C;  2F6J A;  4FK5 A;  3K6B A;  3ABK C;  1D1B A;  4I3M A;  2ZET C;  2J7P D;  4OD4 A;  4WZ3 B;  4JZA A;  4XLP F;  2XRH A;  5T3T A;  2QTV A;  5DIN A;  3EH2 A;  2YU4 A;  2QIC A;  5D1L B;  1ZU5 A;  2OXQ C;  2H7V C;  2L5U A;  2PX3 A;  4KC9 A;  1TR2 A;  3UR3 C;  1E4U A;  3DPL R;  3HTK C;  3O7A A;  2F6N A;  2A68 F;  2LGK A;  4LJN A;  2R7S A;  1RMD A;  4U5F E;  4MQ9 F;  3K1I C;  2AN6 A;  4Q4Z F;  5DLJ A;  1K2F A;  1WGM A;  1WIM A;  1D0X A;  4OIO F;  4J32 B;  3NRH A;  4LK9 A;  4XI1 A;  4DOZ A;  1VD4 A;  3O36 A;  5KYU B;  3EB6 A;  5BUO A;  2YZS A;  2E87 A;  5KH9 A;  4N4F A;  2R7O A;  4YN0 B;  4S3O C;  1KU2 A;  5H9M A;  4FWV A;  2A6H F;  5D91 A;  1ZHZ A;  1F62 A;  3KL4 A;  1WFK A;  2VNF A;  4FO9 A;  3DAF A;  2DGJ A;  3JSZ A;  3WG7 C;  4CS9 C;  3VAY A;  2YQM A;  3DMD A;  4LLE A;  4CBE A;  4LER A;  4U5C E;  3EG9 B;  4E7Z A;  2NUT A;  2FGY A;  2Q9C A;  3NKD A;  2MYS A;  1JM7 A;  3DD7 A;  4O6M A;  3LQJ A;  1IYM A;  1VK5 A;  3SYN A;  4A0C D;  3UGP A;  5C11 A;  4N3W A;  4PJJ A;  2KRE A;  4RDA A;  3OEO A;  3NDB B;  1W2W A;  3DM5 A;  3NKE A;  5EHH A;  3FL2 A;  3HCU A;  4I7C A;  3F47 A;  3Q6M A;  4OIN F;  2CDQ A;  4BJ1 A;  3UGO A;  3DM9 B;  4G7H F;  4JUR I;  2CNW D;  2PFD A;  2R7T A;  5B8D A;  5TBN A;  2EIJ C;  3C6W A;  3RPG C;  4O6N A;  2WZL A;  2DYS C;  2KNH A;  4ANJ A;  3ASO C;  1S7Z A;  1LKX A;  5B3S C;  1Z60 A;  2E6S A;  3AG2 C;  3Q7G A;  4YT8 A;  5D1K B;  3WOD F;  3NYJ A;  1ZBD B;  3DJU B;  5DS4 A;  2GFH A;  2M3H A;  2MA6 A;  3M1C B;  2E6R A;  1O87 A;  2A6E F;  3S0X A;  1G25 A;  2YQL A;  2L80 A;  3ZVY A;  5FEY A;  4AX2 A;  1D1C A;  4A4B A;  4AK9 A;  2G6Q A;  2OG2 A;  1M2V A;  2C2V S;  2LN0 A;  3FVY A;  4Q5S F;  5D1M B;  1JM7 B;  1NG1 A;  2Q3T A;  2Y69 C;  3LQI A;  3ZVZ B;  2MWQ A;  2VPE A;  4PPE A;  3W8I A;  4PJM A;  4BG0 A;  2EGP A;  2IDA A;  2J7P A;  2KQ9 A;  4JVS A;  4I44 A;  1MMA A;  4E7S A;  3RFY A;  1FMV A;  1TKN A;  4DBR A;  1V55 C;  4ZQL A;  5HSW A;  4LKA A;  4AP4 A;  3HJC A;  4OD5 A;  1XWH A;  1VMA A;  4YBS A;  5LCW B;  3B0P A;  1T1H A;  1BR4 A;  1NU7 D;  4M63 A;  5E3A A;  2Y3G A;  4CS8 C;  3DJN B;  3O70 A;  2KGG A;  2J9W A;  4U5D E;  5LKT A;  2RI7 A;  2C04 A;  5KYW A;  2J0X A;  2ECT A;  2JMD A;  4GNG A;  3N9L A;  2LV9 A;  2YSJ A;  2FFH A;  1FTS A;  4IJJ A;  4Q6F A;  2B0J A;  1VOM A;  4YBT A;  3NG2 A;  4PFP A;  1WE9 A;  2K4D A;  5KYU A;  1LDJ B;  1M2V B;  4MSX A;  1BR2 A;  4AUQ B;  3RYL A;  4CCG X;  2YSM A;  4C9Z A;  2CGE A;  4U5B E;  1LVK A;  4PK4 A;  4YAB A;  3EH1 A;  3ABL C;  3W2V A;  4NN2 A;  3LEV A;  4G7Z F;  2IXN A;  3N2Z B;  2LXH C;  3E70 C;  3POV A;  2EIM C;  4I1O B;  3EJN A;  2Y1N A;  4JJF A;  5KYX A;  4O7G A;  2C03 A;  1SF8 A;  4JW1 A;  2H7O A;  2WVO A;  3N9Q A;  3EB5 A;  3RKO F;  3I5Q A;  4L58 A;  2MD7 B;  2EIK C;  4BEJ A;  1WIL A;  4LAC B;  3K33 A;  2KWN A;  1X4I A;  1X4U A;  2LXP C;  4F52 B;  1TWH A;  2J46 A;  2VH3 A;  2W4B A;  5B1B C;  2JMI A;  2MIQ A;  2MNY A;  4G0H A;  2HYE D;  1WEE A;  3ITF A;  4WA6 A;  2EIL C;  3LNR A;  4DVY P;  2M6M A;  2XB1 A;  3GAN A;  3T7L A;  2PP4 A;  2Y3B A;  2CNW A;  2Q9A A;  1D0Y A;  3ZC4 A;  1N87 A;  2CSY A;  2LGG A;  5TRB A;  5KYW B;  3UMK A;  5E33 A;  5FB0 A;  1FP0 A;  2KR4 A;  5DKA A;  3W2W A;  4C3E A;  4KNV A;  3JRT A;  3O37 A;  2WZF A;  3UNG C;  4A2N B;  1FMW A;  5B75 A;  5LKZ A;  3ECS A;  4C7O B;  3GL6 A;  4IRU A;  4YC9 A;  1VYI A;  1ZHW A;  4DBQ A;  4FIP A;  3KNV A;  3EFO A;  1TWA A;  1Z5Z A;  1Z3I X;  2O9X A;  3AG4 C;  4JJG A;  2KJG A;  5DS5 A;  5DQT A;  4G7O F;  2F42 A;  2IYL D;  2Y3D A;  4WJ0 A;  4XLN F;  3O33 A;  4PJL A;  1PCX A;  4FES A;  2LGL A;  5DQZ A;  2K1J A;  3I5P A;  3LLK A;  2YRE A;  1Z6A A;  4H4K C;  4GYT A;  5KYX B;  4BJ5 C;  4EBB A;  4QF2 A;  4S3O B;  1JPN A;  1ST6 A;  3C5K A;  2ZPA A;  3F46 A;  2VB6 A;  2KGO A;  1WEV A;  4BJ6 A;  4PJN A;  2FUU A;  4WZ2 A;  1WEO A;  4WZ0 A;  3K66 A;  2ECG A;  1WEM A;  4N06 A;  1NZE A;  2LDR A;  2RSD A;  4CIH A;  3O6X A;  2KWJ A;  3O39 A;  2W45 A;  2J9V A;  3PUR A;  2YUR A;  3SEO A;  2CW0 F;  4KBL A;  1VFY A;  1WEN A;  3TD7 A;  2PF4 E;  2KW3 C;  2JRJ A;  4YAT A;  2WZG A;  3CQZ A;  1SMY F;  2I8B A;  4HEA J;  4K0D A;  3T6B A;  3GV4 A;  4FX5 A;  3RIP A;  4YJW A;  3CZ6 A;  3DZA A;  3EFO B;  1D1A A;  2G45 A;  3NG1 A;  3NYL A;  2H7B A;  5DVW A;  1WEQ A;  3RPG B;  2A1D D;  4X3G A;  3N9P A;  3EZI A;  2I50 A;  4R8P K;  2YYR A;  5E3C A;  4BBQ A;  5KYY A;  1MM3 A;  2L43 A;  3AQC A;  2ZXR A;  3CSK A;  3PMR A;  5JG6 A;  5D92 A;  3ASN C;  4CS8 A;  2MT5 A;  3B9Q A;  1M57 C;  2UZG A;  1OKK D;  3KV5 A;  4U5E E;  2CKL B;  2Y39 A;  1OCZ C;  4GND A;  4OIP F;  4V3L C;  2K17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...