3HTKC

Crystal structure of mms21 and smc5 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
molecule keywords Structural maintenance of chromosomes protein 5
total genus 75
structure length 254
sequence length 254
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1010 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3htkC01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3htkC02
2L43A 2LV9A 2VPBA 1VD4A 1VFYA 5B75A 5C13A 2K4DA 5LKXA 3GV4A 3L11A 5B76A 4FIPA 4X3GA 3U5PA 3O34A 4P5OB 4N4FA 4L7XA 1WESA 3HCTA 1WEWA 2ECWA 2KU3A 4LJNA 2YSMA 4BBQA 2KWKA 4UP5A 2L80A 4ZQLA 2M85A 3U5OA 2F42A 1V87A 5H1UA 1WGMA 2LGGA 2IDAA 1WFKA 2JMIA 2VJFA 2NAAA 4I7DA 3T6RA 2HYED 4NN2A 4N3WA 1WEQA 3RPGC 2G43A 2XEUA 4Q6FA 1U6GB 3KV6A 2YHOA 2E6SA 4PPEA 1WEMA 4GNEA 4CA1A 1WENA 2YUCA 1WEVA 4WZ2A 2M3HA 2MD8C 2DX8A 5D1KB 4BHWA 3ZVYA 4R7EA 2ECGA 4A4CA 2D8SA 1JOCA 5KH9A 2FUUA 3M99A 5H1VA 4V3KC 2YREA 2MIQA 5FB0A 1HYJA 4UI9B 4LK9A 2VJEA 3O7AA 3LQIA 3DQVR 1X4IA 2YT5A 2C2VS 2H0DB 2L75A 2ECJA 2VPDA 2ECVA 3IHPA 4LADB 4YBTA 2QICA 2FSAA 5KH3A 3N9QA 4C9ZA 1ZBDB 1WEEA 4S3OC 5AITA 3SOXA 2CKLA 1WE9A 5B77A 3N9OA 2LGVA 1VYXA 1N87A 4AUQB 4FO9A 2YQMA 5LCWB 4R8PK 3SOWA 2EA6A 5FEYA 3LQJA 1K2FA 2CSZA 2FUIA 5TRBA 2K17A 1Z6UA 5H9MA 4R2YA 3N9LA 3ZYQA 5TDWA 5G05B 1DVPA 3PURA 4ZUXU 2RI7A 5TBNA 1T1HA 2LQ6A 2LGLA 3T7LA 2JMDA 2ZETC 3C6WA 4CCGX 3LRQA 2K16A 3QZVA 3L1ZB 2L5UA 2H0DA 3I2DA 4FK5A 5H1TA 5FERA 3KQIA 4QF3A 2XB1A 1JM7B 2KIZA 2PNXA 1Z60A 2MT5A 2KYUA 2YHNA 2CT2A 4LLBA 1Z2QA 3ZVZB 2ECNA 2I50A 4UP0A 2LN0A 1BORA 2ECTA 2Y43A 5LKTA 3ASLA 3O70A 2HDPA 2YURA 2E6RA 1X4UA 1LDJB 4A49A 1HYIA 3EB5A 4O64A 4MVTA 5B79A 5TDRA 5D1LB 3M62A 2LRIC 3NG2A 2KWNA 2ECIA 1RMDA 4WZ0A 4A4BA 2Y1MA 3HCUA 3U5MA 4XI1A 4LKAA 1FP0A 2MA5A 2M6MA 5JG6A 3N9PA 4I7CA 2LGKA 4GNGA 4GNFA 2LXPC 2YSJA 3HTKC 5LKZA 3N9MA 2LXHC 3KV5A 4FJCA 1WILA 3SOUA 2MNZA 4YBMA 2VPGA 2QJ0A 3M63A 5TABA 2KE1A 4AYCB 1G25A 4W4UA 4I7BA 2C2LA 1JM7A 3PUQA 2EGPA 3U5NA 2BAYA 3ZPV1 4YAXA 1LDKC 4PTBA 2G45A 3C5KA 2QIZA 5I3LA 2JMJA 5FB1A 3DPLR 3V43A 2YYRA 4YBSA 2VNFA 3ZPVE 4YABA 3VK6A 5D1MB 5AIUA 2MNYA 3LQHA 2KGGA 2KWOA 2YQLA 2Y1NA 2MUMA 4V3LC 2KFTA 3O35A 2RSDA 3PHDA 4MSXA 5G04B 4B86C 2VP7A 3ZTGA 4ZDTA 4GNDA 4AVXA 3EB6A 2YU4A 1E4UA 2KREA 4WA6A 2CKLB 4YATA 3HCSA 2AN6A 2JRJA 1WEOA 5DKAA 3KNVA 2PUYA 5KH7A 1F62A 5DINA 4YC9A 2EODA 2KWJA 4S3OB 4L58A 3N9NA 3FL2A 1MM3A 5C11A 2K1JA 5J3XA 3SHBA 5EYAF 2VPEA 3O33A 2LDRA 5B78A 2MA6A 5B8DA 2L0BA 5LKUA 1XWHA 2M1RA 2MD7B 4F52B 4B7YC 2YW8A 3O36A 2CSYA 1CHCA 2KGIA 3L1XA 3RTRB 1MM2A 1WEPA 2F6JA 4AYCA 1FBVA 4GB0A 4AP4A 4IC3A 3O37A 4QF2A 2KR4A 2VJEB 2G6QA 4TKPB 3GL6A 1IYMA 4WZ3B 3RPGB 2OXQC 4IC2A 2F6NA 5G0FA 3MHHA 1WIMA 1X4JA 4A0CD 3ZNIA 1WEUA 3MHSA 2UZGA 2VJFB 4YADA
chains in the Genus database with same CATH superfamily
1MNEA 1ZU5A 2BE5F 2HSBA 1MMNA 1FTSA 1VD4A 5B75A 5KYNA 4G7ZF 2QY9A 1TWGA 4FIPA 5DS5A 1Z7Qc 2NUPA 3TOLA 2YL7A 4N4FA 4P5OB 4E17A 1WESA 3L34A 2WB7A 3RKOF 3G4ZA 1CGNA 3MX3A 4BBQA 4J30B 4UP5A 2L80A 2DB4A 2PX0A 4CBEA 2IXNA 3LEOA 3RF3A 3Q1DA 2F42A 1V87A 2JM3A 1Z6AA 3KYJA 1WGMA 2LGGA 2EPNA 3NG1A 1HE9A 3FOOA 3EHMA 2BC5A 1NG1A 3E9VA 3L1MA 2XL4A 3LS0A 5E3CA 4NN2A 4N3WA 2G43A 2FAPB 2XEUA 4EKWA 4DBRA 2OJED 3RQGA 3KYIA 4NCQA 2YRFA 3FXHA 2E6SA 4PPEA 1AUEA 1WEMA 4CA1A 1WENA 2P6VA 2YUCA 1ST6A 2XOZA 4WZ2A 2MD8C 2YZSA 4RD9A 4PFOA 2ECGA 4J32B 1MMAA 1QZXA 4O6NA 2FUUA 4IAOA 2IYLD 4OINF 2R7RA 3ZQVA 4V3KC 3O55A 2MIQA 3AQCA 1NFNA 1WASA 3LEVA 4LK9A 3O7AA 1V74B 3LQIA 3JRMO 2YT5A 3GM2A 2C2VS 1D0YA 4I3MA 2Q9AA 4AE4A 3LLKA 2VPDA 5SVXA 2WVNA 2ETSA 4MVMA 4LADB 1JPJA 2M64A 2FSAA 3RH3A 1L7CA 2XLVA 1WGWA 1OW8A 2GFHA 1ORYA 3DKAA 1EKYA 3SOXA 4PR9A 3C63A 3EGXA 3K1HA 3U9JA 3X1OA 2VC9A 1N87A 5K3QA 5LCWB 2J9BA 3VM6A 3ZC4A 2AVKA 4BJ5A 2EA6A 3M1CB 2CSZA 2V26A 3SXZA 4I1MA 4JIOA 1RJ9A 2Q7RA 2HMQA 4KC9A 3M4CA 3RYLA 2VCAA 5FZTA 4ONSA 5B1BC 3ZYQA 2R02A 1NLXA 2DSMA 1OR3A 3PURA 3DM9B 1ZHXA 4CSAC 5TBNA 3C62A 2LGLA 3T7LA 4MTOA 2H7OA 3C6WA 1O3UA 4O6MA 3HNKA 2J9UA 3IQTA 4LDKA 4UDVA 2HKVA 3LRQA 2H0DA 3I2DA 4FK5A 5H1TA 2GWWA 1IZMA 2XB1A 2A69F 3SEOA 4H9DA 3QVZA 5K0IA 2L9JA 3ZSUA 4EHPA 4LLBA 4LLCA 1Z2QA 2R03A 4C3EA 2I50A 4D4XA 2GAQA 3B0PA 2YL3A 1LKXA 3LUTB 2Y43A 5LKTA 3M7KA 2PNOA 4EUKB 1U0BB 4QQ4A 4IAQA 4OD4A 5DS6A 4A49A 1HYIA 3EB5A 4O64A 5D1LB 5B79A 3M62A 2MYSA 3NG2A 3NYJA 4O6YA 2KWNA 2GA0A 4JW1A 1K40A 4XI1A 1LM3B 4LACB 3ABLC 5B1AC 1FP0A 3N9PA 5E2QA 4ZLCA 4YN0B 2LGKA 1JPNA 4G78A 5SVYA 2YSJA 5LKZA 1CPRA 3K7DA 4IWBA 2XP0A 3EPVA 3SOUA 1Y4CA 5KYWB 3KDEC 2MNZA 3RQFA 5JVEA 1QLEC 2VPGA 5TABA 4CX9A 2TMVP 3Q6MA 3LLIA 4EBBA 4W4UA 1T6QA 5SVIB 2C2LA 1OQCA 4Z9JA 2QLAA 2XOYA 3CAXA 5B3SC 2ZXRA 1T6IA 2FFHA 2BAYA 1FAPB 4ANJA 2PP4A 4NTFA 4C3DA 1FR0A 3V5XA 3FMSA 4JURI 1LDKC 4PTBA 2R7OA 1H9GA 2B0HA 5I3LA 5JS5A 2RSEB 4O7GA 3L0IA 3FHDA 4JEBA 1HY5A 4EWCA 3DXJF 4E7ZA 1OCZC 3DWDA 2VNFA 2X0CA 3ZPVE 3VK6A 5AIUA 2EPKX 2J7PA 1K04A 3WHNA 2J46A 2Y1NA 4PJLA 2MUMA 2KFTA 2ZXOA 4MW3A 3RVYA 2YKZA 2DYSC 3S27A 4A2NB 3NMJA 2AP3A 2VP7A 3IPMO 2B0JA 4FESA 3GM1A 2NUTA 2XLWA 2ZXPA 2VCBA 2R9RB 4MVQA 5AC4A 3HCSA 1T6UA 2JRJA 4ULVA 4H4KC 2XLDA 3KNVA 3R2PA 3SZRA 4D4NA 1YLMA 2EODA 3AG4C 2AU5A 3PHF2 4OGCA 4OD5A 2RR4A 3GORA 2EIKC 5KYUB 2L81A 5L0CA 2MA6A 3FJUB 1D1CA 1LE2A 4DRHB 5B8DA 2IQJA 2Y3HA 5DLJA 3C8GD 1VYIA 5T3TA 1CHCA 2KGIA 2XOCA 3RTRB 1MM2A 4J7TA 3UMIA 3C7JA 3UGPA 3U2MA 4P9FA 2XXAA 4IC3A 1OCOC 4QF2A 1QQ3A 2KR4A 4WZ3B 4IC2A 1WWPA 4WABA 3DJNB 1WIMA 3MHHA 1X4JA 3O10A 4MNDA 3V7OA 1WEUA 2R7SA 1ZHYA 3OA1A 5T3WA 3U2LA 1MNDA 2PX3A 3UGOA 3EGDB 3PMRA 2LV9A 2VPBA 2KK1A 1YA7O 2R7WA 3JYYA 1VFYA 4K7BA 3S0XA 3U3FA 2K4DA 4NQFA 2EPOA 3U8PA 3MBGA 5LKXA 5L0GA 4X3GA 3CZ6A 2XL6A 3QVYA 1WEWA 2ECWA 1M6TA 1XWJA 2YSMA 2DJAA 2DGJA 3CQZA 2M85A 2XLMA 2V3CC 3RW0A 5CI8A 5H1UA 4K1OA 4BEMJ 1D0XA 4G7OF 4A4AA 1MBMA 4X0RA 2IDAA 1BBHA 2OU6A 1WFKA 3VAYA 1AEPA 1R4TA 5HV9A 1BR1A 4HFFB 2R05A 1G4US 4NY3A 5A69A 3WAQA 5TJ5E 2YHOA 1H9TA 3EGXB 1WOLA 5KYXB 2IXMA 1A7EA 1WEVA 2HJ3A 2AWYA 2DX8A 4CS8A 5D1KB 4BHWA 1CGOA 3NKEA 3W4YA 2D8SA 2KGOA 2CCYA 1E2XA 3UMHA 1LE4A 1FMVA 5H1VA 2A6EF 1HMDA 2PF4E 4XEFA 2LD6A 4NTBA 3JTLO 1OKKD 3M15A 2A68F 2R7UA 1N1CA 1HYJA 5L0JA 1PV3A 2VJEA 4XPWA 5L3VA 1YDIA 4YL3A 3UR3C 1JR8A 1M56C 1CGME 2H0DB 4IJJA 2L75A 2H7BA 2EIJC 2W9YA 3T6GB 1WN0A 4QI2A 4DRJB 2QICA 4DRIB 1NSGB 3S90A 3UNGC 5AITA 3NDBB 3DJUB 1VB5A 4WGZA 1RCPA 2HJMA 1C03A 1J8YF 4FO9A 2YQMA 3KPHA 2LFFA 2O9XA 1AVOB 2YVKA 3ABMC 5TRBA 2P7VA 3FOPA 1A0BA 2YVRA 5TDWA 5G05B 4MTGA 1DVPA 4PJJA 2ZXWC 1B68A 1NZEA 2RI7A 1ZVZA 4F4BA 4CS7A 1FNTc 4DOZA 1T1HA 4OIPF 4N6CA 2AWCA 1HW1A 4R32A 4FAPB 4C7OA 4CCGX 2K16A 4OGEA 3QZVA 5EK0A 2L5UA 3LVQE 3DZAA 5FERA 3KQIA 4QF3A 1NFOA 3DD7A 3Q7LA 2YHNA 2CT2A 4AL1A 3ZVZB 2D5RB 3C8ZA 4BJ5C 2LN0A 4YL1A 4DBQA 1BORA 4PFPA 3FANA 3NRHA 1W2WA 1TWAA 5F5HA 2Y39A 1VLSA 1TWCA 3US6A 1TFKB 2ZPAA 5JLIA 4MVTA 2G3KA 3HNJA 4GYTA 1Q0FA 4A4BA 2ECIA 4WZ0A 3RQEA 5JG6A 1BZ4A 3FM8C 2J0WA 4OIRF 3X2QC 1Z3IX 4GNGA 4GNFA 5EHHA 3HTKC 4BPMA 4FJCA 2P1AA 4FX5A 3IQ6A 4CSAA 2VASA 4YBMA 2QJ0A 4K0DA 1G8XA 4AYCB 3AJMA 2WVOA 1YYJA 3H2VA 4QDLA 256BA 4U5CE 5L0HA 3WG7C 2YLIA 3CSKA 4MW8A 3KKBA 1E84A 2OG2A 1JM7A 1YYXA 2L7AA 5DQTA 3K66A 2QNLA 2XRHA 4LERA 2L7PA 1JMWA 1V4AA 4E0HA 2YWAA 3PLWA 5L0IA 3C5KA 2A0UA 2G45A 1WTYA 5A6KA 4EIYA 5FB1A 1GQAA 3MLGA 2YYRA 2PBEA 1TR2A 4OIQF 2KJGA 3LQHA 2HZ8A 3WODF 1NU7D 3O35A 4YJWA 1EI7A 3T4RA 3HNLA 4MVUA 5G04B 3SUBA 4B86C 3ZTGA 2R25A 2M13A 4BJ6A 1E4UA 5KYYB 4YT5A 1APCA 2W4BA 3S84A 2AN6A 1Q0MA 3RFYA 1WEOA 4NC3A 3GEHA 1OKKA 4G0HA 2OQMA 3W8IA 5KH7A 1F62A 3B0UX 5DINA 3I4UA 1D0ZA 2LQGA 2J8WA 4OIOF 3N9NA 3EH2A 1MM3A 2OKUA 2D4UA 4U9DA 5J3XA 3V5YA 3SHBA 1U6HA 3O33A 2LDRA 5EGYA 2NG1A 1CPQA 3MYFA 3LAYA 4PACA 1XWHA 3LS1A 4C7OB 4B7YC 5D92A 2YW8A 4IGGA 2JPUA 2FGYA 3DDTA 4KNWA 4KI2A 2JUNA 1FBVA 4JVSA 5COMA 2CGEA 3SNHA 2EGMA 4H54A 1IYMA 4AK9A 1ZW2A 1QVXA 3ZVRA 4U5HA 3J06A 2Y3BA 3ZIBA 4IARA 4XLNF 2VJFB 1Z5ZA 2R7QA 1MMGA 1SF8A 3TQOA 4XWJA 1HE1A 3GV4A 2E87A 4JE9A 3V5ZA 1ORSC 3F46A 2CNWA 2YL1A 3HCTA 2KU3A 2LSEA 4DXWA 1FFTC 2MWQA 4DJ9A 3IHUA 2KWKA 3IEEA 3C18A 3U5OA 3A9CA 3A11A 1JOGA 1FMWA 3IQCA 2D8UA 4HEAJ 2KQ9A 1IW7F 3EGDA 2JMIA 1FFHA 2VJFA 1G5ZA 3W2WA 2NAAA 2A6HF 3RVZA 3MYIA 4B6IA 4I7DA 3GEEA 2HYED 1WEQA 3RPGC 2LIGA 4Q6FA 2OEXA 3EZHA 3Q6NA 2BL2A 4BJTA 2YHSA 3HLZA 4M63A 2F22A 4BJ6C 5BUOA 1RMVA 2XSEA 1TFOB 4EBJA 3U5SA 5COGA 2M3HA 3LESA 5D91A 1A7VA 4A4CA 3QZCA 2Z15A 1LS1A 5BQIA 1JOCA 5KH9A 5L0FA 5BQGA 3ECSA 1H7IA 3M99A 1O5HA 2NPUA 4XEVA 3O6XA 3MFNA 5KYYA 3M79A 2KYHA 5FB0A 1JRAA 4Z0RA 4Z9IA 1NBBA 4UI9B 1GS9A 3ZTMA 3ZG1A 1VOMA 5F28E 2CYDA 1X4IA 1S7ZA 1MQVA 3KMIA 3LNMB 2DYRC 1Z63A 2ECJA 1C17M 4U5BE 2VB6A 3AQBA 4MVSA 4BG0A 3IHPA 2YL0A 2EPLX 3NYLA 1ZBDB 1TQGA 3SYNA 4ULWA 1KTMA 3AOUA 3LDYA 2EPMX 2ZD9A 4KBLA 1YA9A 2LGVA 4J7YA 1VYXA 2E61A 5B3IA 1OCCC 3SOWA 3T9KA 1M57C 1XZQA 5FEYA 3RIPA 3LQJA 2IOQA 1Z6UA 3T6BA 4R2YA 2ASRA 4E0IA 2H8AA 2KNHA 3M4BA 5COFA 1E83A 3TULA 4JEAA 1QKRA 1YAUO 3ASOC 2LQ6A 4F1PA 1LS4A 2JMDA 2Q3TA 3JT1A 4XTKA 5A6AA 2HSQA 3FDQA 1SR2A 4PJNA 2P61A 4MTFA 3G50A 2H7VC 1YJGA 1JM7B 3I5QA 2PNXA 1Z60A 2R7VA 1KU2A 5AGFA 2ECNA 3C8GB 4UP0A 4KNVA 2M4EA 1Q0KA 2NUTB 4JJFA 4RBNA 4P6IC 4U5EE 4N06A 3O39A 2ECTA 3QMKA 3O70A 2HDPA 2E6RA 1X4UA 2YEVA 3ZDLA 5TDRA 5E3AA 3K6BA 2PFDA 1A7DA 1GGQA 3N2ZB 2MA5A 2OJQA 2LXPC 3EFOB 4U5GA 3N9MA 2LXHC 3KV5A 5BQHA 3B71A 3H2UA 2EINC 2JX0A 2R7XA 1OXKA 3M63A 2KE1A 2KC3A 1Q0GA 4Q4ZF 2EXUA 3BEHA 1ZYRF 2EILC 1LVKA 4I7BA 2OEVA 3N24A 1Z23A 2J9WA 4DVZA 1RKEB 3PUQA 3O47A 2EGPA 1E86A 3U5NA 4U5FE 1DOWA 3POVA 2P0NA 4YK5A 4Q7CA 2QIZA 5JSLA 1U89A 2J0XA 3QW0A 2JMJA 3U8VA 3V43A 1TKNA 2HFIA 4CS9A 1EA8A 4YBSA 4C3BA 4CJGA 2WVQA 2WL8A 2FFWA 1I4ZA 1MMDA 3LJBA 4LDQA 1LI5A 2KKYA 4MS2A 4CDYA 2KGGA 2KWOA 4V3LC 1I5NA 3DI5A 4WJ0A 1OW6A 2RSDA 3PHDA 4PK4A 5FCLA 4MSXA 2KW3C 4EBKA 4ZDTA 4GNDA 4AVXA 1KNYA 3ITFA 2YU4A 3SP1A 3EH1A 5E33A 1RKCA 4YT2A 1EQ1A 5L3QA 2MHRA 3R7CA 1QPUA 2XM0A 3S28A 2PUYA 3K1IA 1OXBA 1I4YA 2KWJA 2A1DD 2HMZA 2CSVA 4L58A 3BRJA 1H6GA 2VCCA 3DMDA 1K05A 3NMIA 3FL2A 2HV6A 5C11A 3DE9A 4AE4B 1ZHWA 4XEKA 2VPEA 4XLPF 2LFDA 4XPYA 5B78A 2C04A 3FVYA 2M1RA 2MD7B 4F52B 4JCHA 4U9EA 1QSPA 4CDAA 1WEPA 2F6JA 4GB0A 3GWLA 3HKKA 4NTAA 4L6RA 5F5FA 2VJEB 4TKPB 3SXMA 1WATA 3RPGB 2OXQC 3C8GA 2F6NA 5G0FA 2Q9CA 3AG2C 1T9KA 3ZQYA 3TOMA 3GEIA 3OWTA 2CRWA 2WZFA 3VYWA 4PJMA 3U0CA 3NKDA 4JJGA 3DAGA 2L43A 3DM5A 2A0BA 3L8JA 3DWWA 4AX2A 4CIPA 5DS4A 1BR2A 5C13A 3ATPA 5DVWA 4Z9HA 2XS1A 3L11A 3TJ5A 5B76A 3B0VC 4MVOA 2LAUA 3O34A 3U5PA 4N4WA 1BR4A 4L7XA 3PDMP 4YL0A 1YVIA 4E18A 4O62A 4LJNA 3QW1A 1RJ9B 4YWQA 3EFOA 3B29A 2G62A 4ZQLA 3TJ6A 4P9TA 1YZAA 3H7HA 3AGTA 4JTAB 3JSEO 3E2DA 3JRTA 4JTDB 3TD7A 3EG9B 5L0DA 3ZWIA 2Y69C 3LVRE 3KL4A 4GEHA 5A6JA 2CDQA 2QUPA 1HW2A 4AL0A 2CW0F 3VRCA 5KYUA 2I15A 3QTHA 1TWHA 3T6RA 1RKEA 5T1DB 3HNIA 3TK0A 2MKEA 3OEOA 2P57A 1U6GB 3KV6A 4IB4A 2HS5A 4GNEA 3U3BA 2QE9A 1PD0A 1VTMP 3ZVYA 4R7EA 3T6JA 5JUAA 2XLEA 4JC7A 3FAJA 4XPXA 3K1IC 2W45A 3T9OA 2XM4A 2DI3A 2L6FA 2WZGA 2YREA 3GM3A 3ZTZA 3LJUX 2GDCA 2CRRA 3EQLF 1G4WR 3SXKA 2NSGA 3AG1C 4CJOA 3DQVR 1ZU4A 1LIHA 4QI0A 1S05A 2WZLA 3PCVA 3UMKA 1ZHTA 2ECVA 3EJNA 3IQ5A 1VYKA 4YBTA 2XL8A 4JCZA 3AGUA 3JUEA 3N9QA 5KH3A 2R7TA 4C9ZA 3H65A 4JZAA 5A6BD 3G4XA 1WEEA 4S3OC 4ZLDA 4N6HA 4W8PA 3AG3C 4RDAA 1V55C 2CKLA 1HMOA 1WE9A 4U5DE 3EHNA 5B77A 2W4MA 4CDVA 3N9OA 4E7SA 1F1MA 4AUQB 2OOCA 1J8MF 4JKVA 3K33A 4MQ9F 4R8PK 2FD4A 1VLTA 3LNRA 1R5ID 5DQZA 2Q4FA 2Q00A 1K2FA 2FUIA 2K17A 4LLEA 5H9MA 4I1OB 4YT4A 4MVRA 3N9LA 2YQYA 2JD3A 4ZUXU 2C03A 1OW7A 1ZW3A 1DCQA 2ZETC 5JRAA 3ABKC 1M2VA 3L1ZB 1SYQA 1RXQA 1ZZPA 3GWNA 3DAFA 2YLGA 2CONA 5KYWA 2KIZA 2MT5A 2KYUA 4Z0OA 2Q9BA 3MDBC 1GM5A 1JAFA 2UUIA 3ASLA 1VMAA 2Y3GA 3GODA 2YURA 3DE8A 2B0OE 2XLOA 2QTVA 4YT8A 1E85A 1LDJB 1D1AA 2HUJA 3HJCA 1O87A 2LRIC 2EIMC 1RMDA 1ORJA 2Y1MA 3HCUA 3U5MA 3ASNC 4LKAA 2J7PD 2IXPA 3KH2A 1PD1A 2KKXA 2M6MA 2IXOA 2XXAB 4I7CA 3JZ0A 5GPGB 2I8BA 4LDRA 3FEHA 1YARO 3SXYA 5SVIA 1WILA 5A6BA 1XZPA 4W8KA 4MVZA 3JSZA 1D1BA 3F47A 4IRUA 1G25A 3VF0A 3W8HA 1LI7A 5CIVA 2J45A 3Q7GA 5HSWA 5AC5A 3ZPV1 2RD9A 1T01A 4YAXA 2Y3DA 5JP7A 3E70C 2XS8A 1DOVA 2L6GA 2LP4A 1ZHZA 3GANA 4Q5SF 1OR2A 3DPLR 3W2VA 4ER9A 2KSFA 5KYXA 2ICWG 2L6HA 4YABA 4BEJA 5D1MB 3NYMA 2MNYA 4WGYA 3U9MA 2J9VA 3FAPB 2YQLA 1SZIA 1UFBA 3S9OA 2OWAA 1Q0DA 1NU9C 3JYHA 3N0TA 2HV7A 3EB6A 4JRZA 2KREA 4WA6A 4O79A 2CKLB 2CNWD 4YATA 3JCUQ 1SMYF 2VH3A 1V54C 4CIHA 5DKAA 1A41A 1M2OA 1C02A 4YC9A 4GQHA 4S3OB 1OCRC 3L8IA 1L3PA 1UG7A 4JTCB 4I44A 3CEXA 3EG9A 2OCCC 4BJ1A 4CS9C 1Y6DA 5IY5C 2K1JA 2LCHA 4CS8C 1BDJB 1YZCA 5EYAF 4G7HF 4HFKB 1PCXA 1T5OA 2NUPB 4FWVA 4XQ1A 3NMKA 2L0BA 5LKUA 2X51A 3S29A 1VK5A 2NSFA 1LPEA 3O36A 3FAOA 2CSYA 3L1XA 4AYCA 2XLHA 4DVYP 2YLDA 4AP4A 4HE8D 3O37A 2G3VA 2G6QA 1M2VB 3GL6A 3I5PA 2LK4A 2IBFA 5CI9A 2IM8A 5JT4A 4A0CD 3EZIA 3B9QA 3ZNIA 3MHSA 2UUHA 2UZGA 4YADA
chains in the Genus database with same CATH topology
1MNEA 4JJGA 1Z5ZA 5T3WA 1ZU5A 1MNDA 2BE5F 2PX3A 3DAGA 3DM5A 3EGDB 3UGOA 2L43A 2R7QA 3PMRA 1MMNA 1MMGA 2LV9A 2VPBA 1FTSA 2R7WA 4AX2A 1VD4A 1VFYA 4K7BA 5DS4A 3S0XA 5B75A 1BR2A 5KYNA 5C13A 2K4DA 1SF8A 5DVWA 4XWJA 5LKXA 4G7ZF 3GV4A 3L11A 2QY9A 2E87A 5B76A 1TWGA 4FIPA 4X3GA 3B0VC 3O34A 3U5PA 5DS5A 2NUPA 4P5OB 4N4FA 1BR4A 4L7XA 3F46A 2CNWA 3CZ6A 1WESA 3HCTA 1WEWA 2ECWA 3L34A 2KU3A 2LSEA 2WB7A 4LJNA 1FFTC 3RKOF 2MWQA 2YSMA 3MX3A 4BBQA 1RJ9B 4YWQA 2KWKA 4A49A 4J30B 3EFOA 4UP5A 2L80A 2DGJA 3IEEA 3CQZA 2G62A 2PX0A 4ZQLA 4CBEA 2M85A 2IXNA 3U5OA 2V3CC 2F42A 5CI8A 1V87A 1Z6AA 5H1UA 3JRTA 1D0XA 4G7OF 3TD7A 1FMWA 3EG9B 1WGMA 2LGGA 4X0RA 2IDAA 2Y69C 1WFKA 3VAYA 3KL4A 4HEAJ 3NG1A 3EHMA 4GEHA 2KQ9A 1IW7F 3EGDA 2CDQA 1NG1A 3E9VA 2JMIA 1FFHA 3W2WA 2VJFA 2XL4A 2CW0F 2A6HF 2NAAA 1BR1A 4HFFB 5KYUA 3LS0A 4B6IA 5E3CA 4I7DA 1TWHA 3T6RA 2HYED 5T1DB 4NN2A 4N3WA 1WEQA 3RPGC 2G43A 2XEUA 4NY3A 3OEOA 4DBRA 4Q6FA 3EZHA 3Q6NA 1U6GB 4BJTA 3KV6A 2YHOA 2YHSA 3HLZA 3EGXB 2E6SA 4M63A 5KYXB 4BJ6C 4PPEA 2IXMA 5BUOA 1WEMA 4GNEA 4CA1A 2XSEA 1WENA 2P6VA 2YUCA 1WEVA 1ST6A 1PD0A 4WZ2A 2M3HA 3LESA 5D91A 2DX8A 2MD8C 4CS8A 5D1KB 4BHWA 3ZVYA 2YZSA 4RD9A 4PFOA 3T6JA 4R7EA 2ECGA 3NKEA 4A4CA 3QZCA 2Z15A 2D8SA 1LS1A 4J32B 5B79A 2KGOA 3FAJA 1MMAA 3K1IC 1JOCA 5KH9A 1QZXA 4O6NA 2FUUA 3UMHA 4IAOA 2IYLD 2W45A 3ECSA 3M99A 4OINF 1O5HA 2R7RA 1FMVA 2WZGA 5H1VA 4V3KC 2A6EF 2YREA 3O6XA 2PF4E 2MIQA 3AQCA 5KYYA 1OKKD 3EQLF 2A68F 2R7UA 3AG1C 5FB0A 1N1CA 1HYJA 3LEVA 4UI9B 4LK9A 2VJEA 3O7AA 3LQIA 3ZG1A 5L3VA 1VOMA 3DQVR 1X4IA 1S7ZA 3UR3C 1ZU4A 2YT5A 2C2VS 1D0YA 4I3MA 1M56C 2H0DB 4IJJA 3KMIA 2L75A 2Q9AA 2H7BA 4AE4A 2DYRC 4QI0A 2WZLA 3LLKA 1Z63A 2ECJA 2VPDA 2WVNA 2EIJC 3UMKA 2W9YA 4U5BE 2VB6A 3AQBA 1ZHTA 2ECVA 3EJNA 4BG0A 3IHPA 4QI2A 4LADB 1VYKA 1JPJA 4YBTA 3NYLA 2QICA 2FSAA 3RH3A 5KH3A 1WGWA 3N9QA 2R7TA 1ZBDB 4C9ZA 3H65A 4JZAA 2GFHA 3UNGC 3SYNA 1WEEA 4S3OC 4ZLDA 5AITA 4ULWA 3AG3C 4RDAA 3NDBB 1V55C 3SOXA 2CKLA 3DJUB 1WE9A 4U5DE 3EGXA 3K1HA 3EHNA 4KBLA 5B77A 2W4MA 3N9OA 2LGVA 4E7SA 3X1OA 1VYXA 1N87A 1J8YF 4AUQB 1J8MF 4FO9A 1OCCC 2YQMA 3K33A 4MQ9F 5LCWB 4R8PK 3SOWA 3ZC4A 4BJ5A 1M57C 3LNRA 2EA6A 5FEYA 5DQZA 3RIPA 3LQJA 2O9XA 3M1CB 1K2FA 2CSZA 2V26A 3ABMC 2FUIA 2IOQA 2P7VA 5TRBA 2K17A 1Z6UA 4LLEA 4I1MA 3T6BA 1RJ9A 5H9MA 4I1OB 4KC9A 4R2YA 4YT4A 3RYLA 5B1BC 3N9LA 3ZYQA 5TDWA 2KNHA 5G05B 1DVPA 2JD3A 4PJJA 3PURA 2ZXWC 1HYIA 1NZEA 1ZHXA 3DM9B 2RI7A 3ASOC 4F4BA 4CSAC 4CS7A 4ZUXU 5TBNA 4DOZA 1T1HA 4OIPF 2C03A 2LQ6A 2LGLA 3T7LA 2JMDA 2H7OA 4C7OA 2ZETC 2Q3TA 3C6WA 3JT1A 4O6MA 4XTKA 4CCGX 3FDQA 2J9UA 3ABKC 2K16A 3LRQA 3QZVA 1M2VA 3L1ZB 2L5UA 3DZAA 2H0DA 4PJNA 3I2DA 4FK5A 5H1TA 3DAFA 3KQIA 5FERA 2H7VC 4QF3A 1IZMA 2XB1A 2A69F 1JM7B 5KYWA 2KIZA 3I5QA 3SEOA 2PNXA 1Z60A 3DD7A 2R7VA 1KU2A 2MT5A 3Q7LA 2KYUA 2YHNA 2CT2A 2L9JA 3ZSUA 4LLBA 4LLCA 1Z2QA 3ZVZB 2Q9BA 4C3EA 2ECNA 2I50A 4KNVA 4UP0A 2D5RB 4BJ5C 2LN0A 2M4EA 2NUTB 4JJFA 4RBNA 5TDRA 4P6IC 4U5EE 1BORA 4N06A 3O39A 4PFPA 4DBQA 2ECTA 3B0PA 3NRHA 1LKXA 2Y43A 5LKTA 1W2WA 1TWAA 5F5HA 3QMKA 2Y39A 1VMAA 3ASLA 2Y3GA 3O70A 1TWCA 3GODA 2HDPA 2YURA 4OD4A 2E6RA 5DS6A 2ZPAA 2QTVA 4YT8A 1LDJB 2YEVA 1X4UA 3EB5A 4O64A 4MVTA 5D1LB 1D1AA 3HJCA 3M62A 1O87A 2G3KA 2MYSA 3NYJA 2EIMC 2LRIC 3NG2A 4GYTA 4O6YA 2KWNA 2ECIA 1RMDA 4WZ0A 4A4BA 2Y1MA 4JW1A 5E3AA 3HCUA 3U5MA 3K6BA 4XI1A 2PFDA 3ASNC 4LKAA 2J7PD 2IXPA 4LACB 3KH2A 1PD1A 3ABLC 3N2ZB 5B1AC 1FP0A 2MA5A 2M6MA 5JG6A 3N9PA 5E2QA 2J0WA 4ZLCA 2IXOA 2XXAB 4YN0B 4I7CA 4OIRF 2LGKA 3X2QC 2I8BA 1JPNA 1Z3IX 4GNGA 4GNFA 2LXPC 5EHHA 3HTKC 2YSJA 3EFOB 5LKZA 4U5GA 3N9MA 2LXHC 3KV5A 4FJCA 3K7DA 4IWBA 4FX5A 1WILA 4W8KA 4CSAA 3EPVA 3SOUA 2VASA 5KYWB 2MNZA 2EINC 3JSZA 1QLEC 1D1BA 4YBMA 2VPGA 2QJ0A 4K0DA 2R7XA 3M63A 5TABA 2KE1A 1G8XA 4AYCB 3F47A 3Q6MA 4IRUA 3LLIA 2WVOA 4QDLA 4EBBA 1G25A 4W4UA 4Q4ZF 4U5CE 3W8HA 3WG7C 1ZYRF 2EILC 1LVKA 4I7BA 3CSKA 2C2LA 3N24A 3KKBA 1Z23A 2OG2A 2J9WA 4DVZA 1JM7A 5B3SC 2ZXRA 3PUQA 5DQTA 2EGPA 3K66A 2FFHA 3U5NA 2XRHA 4LERA 2J45A 3Q7GA 5HSWA 2BAYA 4ANJA 2PP4A 4C3DA 4U5FE 3ZPV1 3POVA 4JURI 4YAXA 2Y3DA 1LDKC 4PTBA 3E70C 4Q7CA 2G45A 2R7OA 3C5KA 2QIZA 5I3LA 1ZHZA 2J0XA 3GANA 2JMJA 4Q5SF 5FB1A 3DPLR 3MLGA 4O7GA 3L0IA 1TKNA 3FHDA 3V43A 4CS9A 3W2VA 4EWCA 3DXJF 4E7ZA 2YYRA 1OCZC 4YBSA 4C3BA 2VNFA 5KYXA 1TR2A 2WVQA 3ZPVE 4YABA 3VK6A 2WL8A 4OIQF 4BEJA 5D1MB 5AIUA 3NYMA 1MMDA 3LJBA 2J7PA 2MNYA 2KJGA 2J46A 3LQHA 2J9VA 2KGGA 2KWOA 2YQLA 2Y1NA 4PJLA 2MUMA 1SZIA 2ZXOA 2KFTA 4V3LC 3WODF 1NU7D 3O35A 4YJWA 4WJ0A 2DYSC 3S27A 2RSDA 3T4RA 3PHDA 4PK4A 4A2NB 5FCLA 4MSXA 1NU9C 5G04B 4B86C 2VP7A 3ZTGA 3JYHA 2B0JA 4FESA 3N0TA 2KW3C 4ZDTA 2HV7A 2NUTA 4GNDA 4AVXA 2ZXPA 3ITFA 3EB6A 2YU4A 4BJ6A 3SP1A 1E4UA 3EH1A 5KYYB 2KREA 4YT5A 5E33A 4WA6A 4YT2A 4O79A 2W4BA 2CKLB 2CNWD 5L3QA 4YATA 3JCUQ 1SMYF 2AN6A 3HCSA 3RFYA 2VH3A 1WEOA 2JRJA 1V54C 4CIHA 4H4KC 1OKKA 4G0HA 5DKAA 3S28A 3KNVA 3SZRA 1M2OA 3W8IA 2PUYA 5KH7A 3B0UX 1F62A 5DINA 3I4UA 4YC9A 2EODA 2KWJA 4S3OB 1D0ZA 1OCRC 2A1DD 4L58A 3AG4C 4OIOF 3DMDA 4I44A 3EG9A 2OCCC 4BJ1A 4CS9C 3FL2A 3N9NA 3EH2A 2HV6A 5IY5C 1MM3A 5C11A 4AE4B 2K1JA 4CS8C 3PHF2 1ZHWA 5J3XA 3SHBA 4OD5A 5EYAF 2VPEA 4G7HF 4HFKB 3O33A 4XLPF 5EGYA 2EIKC 5KYUB 1PCXA 2L81A 2NUPB 2LDRA 5B78A 4FWVA 2NG1A 2MA6A 1D1CA 2C04A 5B8DA 3FVYA 2L0BA 5LKUA 2X51A 3LAYA 1XWHA 3LS1A 2Y3HA 3S29A 1VK5A 4C7OB 5DLJA 2M1RA 2MD7B 4F52B 4B7YC 1VYIA 5D92A 5T3TA 2YW8A 3O36A 4JCHA 2CSYA 1CHCA 2KGIA 2FGYA 4KNWA 3L1XA 3RTRB 1MM2A 3UMIA 1WEPA 2F6JA 4KI2A 3UGPA 4AYCA 1FBVA 4JVSA 4DVYP 4GB0A 4AP4A 4IC3A 4HE8D 2XXAA 5F5FA 3SNHA 2CGEA 1OCOC 3O37A 4QF2A 2KR4A 2VJEB 2G3VA 2G6QA 1M2VB 4TKPB 3GL6A 1IYMA 3I5PA 4WZ3B 3RPGB 5CI9A 4AK9A 2OXQC 4IC2A 3ZVRA 2F6NA 5G0FA 2Q9CA 3AG2C 4U5HA 3DJNB 1WIMA 3MHHA 3OWTA 1X4JA 2Y3BA 4A0CD 3EZIA 3B9QA 3ZIBA 2WZFA 4MNDA 4PJMA 3VYWA 3ZNIA 3V7OA 4XLNF 1WEUA 2R7SA 1ZHYA 2UZGA 3MHSA 3NKDA 3OA1A 2VJFB 4YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L43 A;  2LV9 A;  2VPB A;  1VD4 A;  1VFY A;  5B75 A;  5C13 A;  2K4D A;  5LKX A;  3GV4 A;  3L11 A;  5B76 A;  4FIP A;  4X3G A;  3U5P A;  3O34 A;  4P5O B;  4N4F A;  4L7X A;  1WES A;  3HCT A;  1WEW A;  2ECW A;  2KU3 A;  4LJN A;  2YSM A;  4BBQ A;  2KWK A;  4UP5 A;  2L80 A;  4ZQL A;  2M85 A;  3U5O A;  2F42 A;  1V87 A;  5H1U A;  1WGM A;  2LGG A;  2IDA A;  1WFK A;  2JMI A;  2VJF A;  2NAA A;  4I7D A;  3T6R A;  2HYE D;  4NN2 A;  4N3W A;  1WEQ A;  3RPG C;  2G43 A;  2XEU A;  4Q6F A;  1U6G B;  3KV6 A;  2YHO A;  2E6S A;  4PPE A;  1WEM A;  4GNE A;  4CA1 A;  1WEN A;  2YUC A;  1WEV A;  4WZ2 A;  2M3H A;  2MD8 C;  2DX8 A;  5D1K B;  4BHW A;  3ZVY A;  4R7E A;  2ECG A;  4A4C A;  2D8S A;  1JOC A;  5KH9 A;  2FUU A;  3M99 A;  5H1V A;  4V3K C;  2YRE A;  2MIQ A;  5FB0 A;  1HYJ A;  4UI9 B;  4LK9 A;  2VJE A;  3O7A A;  3LQI A;  3DQV R;  1X4I A;  2YT5 A;  2C2V S;  2H0D B;  2L75 A;  2ECJ A;  2VPD A;  2ECV A;  3IHP A;  4LAD B;  4YBT A;  2QIC A;  2FSA A;  5KH3 A;  3N9Q A;  4C9Z A;  1ZBD B;  1WEE A;  4S3O C;  5AIT A;  3SOX A;  2CKL A;  1WE9 A;  5B77 A;  3N9O A;  2LGV A;  1VYX A;  1N87 A;  4AUQ B;  4FO9 A;  2YQM A;  5LCW B;  4R8P K;  3SOW A;  2EA6 A;  5FEY A;  3LQJ A;  1K2F A;  2CSZ A;  2FUI A;  5TRB A;  2K17 A;  1Z6U A;  5H9M A;  4R2Y A;  3N9L A;  3ZYQ A;  5TDW A;  5G05 B;  1DVP A;  3PUR A;  4ZUX U;  2RI7 A;  5TBN A;  1T1H A;  2LQ6 A;  2LGL A;  3T7L A;  2JMD A;  2ZET C;  3C6W A;  4CCG X;  3LRQ A;  2K16 A;  3QZV A;  3L1Z B;  2L5U A;  2H0D A;  3I2D A;  4FK5 A;  5H1T A;  5FER A;  3KQI A;  4QF3 A;  2XB1 A;  1JM7 B;  2KIZ A;  2PNX A;  1Z60 A;  2MT5 A;  2KYU A;  2YHN A;  2CT2 A;  4LLB A;  1Z2Q A;  3ZVZ B;  2ECN A;  2I50 A;  4UP0 A;  2LN0 A;  1BOR A;  2ECT A;  2Y43 A;  5LKT A;  3ASL A;  3O70 A;  2HDP A;  2YUR A;  2E6R A;  1X4U A;  1LDJ B;  4A49 A;  1HYI A;  3EB5 A;  4O64 A;  4MVT A;  5B79 A;  5TDR A;  5D1L B;  3M62 A;  2LRI C;  3NG2 A;  2KWN A;  2ECI A;  1RMD A;  4WZ0 A;  4A4B A;  2Y1M A;  3HCU A;  3U5M A;  4XI1 A;  4LKA A;  1FP0 A;  2MA5 A;  2M6M A;  5JG6 A;  3N9P A;  4I7C A;  2LGK A;  4GNG A;  4GNF A;  2LXP C;  2YSJ A;  3HTK C;  5LKZ A;  3N9M A;  2LXH C;  3KV5 A;  4FJC A;  1WIL A;  3SOU A;  2MNZ A;  4YBM A;  2VPG A;  2QJ0 A;  3M63 A;  5TAB A;  2KE1 A;  4AYC B;  1G25 A;  4W4U A;  4I7B A;  2C2L A;  1JM7 A;  3PUQ A;  2EGP A;  3U5N A;  2BAY A;  3ZPV 1;  4YAX A;  1LDK C;  4PTB A;  2G45 A;  3C5K A;  2QIZ A;  5I3L A;  2JMJ A;  5FB1 A;  3DPL R;  3V43 A;  2YYR A;  4YBS A;  2VNF A;  3ZPV E;  4YAB A;  3VK6 A;  5D1M B;  5AIU A;  2MNY A;  3LQH A;  2KGG A;  2KWO A;  2YQL A;  2Y1N A;  2MUM A;  4V3L C;  2KFT A;  3O35 A;  2RSD A;  3PHD A;  4MSX A;  5G04 B;  4B86 C;  2VP7 A;  3ZTG A;  4ZDT A;  4GND A;  4AVX A;  3EB6 A;  2YU4 A;  1E4U A;  2KRE A;  4WA6 A;  2CKL B;  4YAT A;  3HCS A;  2AN6 A;  2JRJ A;  1WEO A;  5DKA A;  3KNV A;  2PUY A;  5KH7 A;  1F62 A;  5DIN A;  4YC9 A;  2EOD A;  2KWJ A;  4S3O B;  4L58 A;  3N9N A;  3FL2 A;  1MM3 A;  5C11 A;  2K1J A;  5J3X A;  3SHB A;  5EYA F;  2VPE A;  3O33 A;  2LDR A;  5B78 A;  2MA6 A;  5B8D A;  2L0B A;  5LKU A;  1XWH A;  2M1R A;  2MD7 B;  4F52 B;  4B7Y C;  2YW8 A;  3O36 A;  2CSY A;  1CHC A;  2KGI A;  3L1X A;  3RTR B;  1MM2 A;  1WEP A;  2F6J A;  4AYC A;  1FBV A;  4GB0 A;  4AP4 A;  4IC3 A;  3O37 A;  4QF2 A;  2KR4 A;  2VJE B;  2G6Q A;  4TKP B;  3GL6 A;  1IYM A;  4WZ3 B;  3RPG B;  2OXQ C;  4IC2 A;  2F6N A;  5G0F A;  3MHH A;  1WIM A;  1X4J A;  4A0C D;  3ZNI A;  1WEU A;  3MHS A;  2UZG A;  2VJF B;  4YAD A; 
#chains in the Genus database with same CATH topology
 1MNE A;  1ZU5 A;  2BE5 F;  2HSB A;  1MMN A;  1FTS A;  1VD4 A;  5B75 A;  5KYN A;  4G7Z F;  2QY9 A;  1TWG A;  4FIP A;  5DS5 A;  1Z7Q c;  2NUP A;  3TOL A;  2YL7 A;  4N4F A;  4P5O B;  4E17 A;  1WES A;  3L34 A;  2WB7 A;  3RKO F;  3G4Z A;  1CGN A;  3MX3 A;  4BBQ A;  4J30 B;  4UP5 A;  2L80 A;  2DB4 A;  2PX0 A;  4CBE A;  2IXN A;  3LEO A;  3RF3 A;  3Q1D A;  2F42 A;  1V87 A;  2JM3 A;  1Z6A A;  3KYJ A;  1WGM A;  2LGG A;  2EPN A;  3NG1 A;  1HE9 A;  3FOO A;  3EHM A;  2BC5 A;  1NG1 A;  3E9V A;  3L1M A;  2XL4 A;  3LS0 A;  5E3C A;  4NN2 A;  4N3W A;  2G43 A;  2FAP B;  2XEU A;  4EKW A;  4DBR A;  2OJE D;  3RQG A;  3KYI A;  4NCQ A;  2YRF A;  3FXH A;  2E6S A;  4PPE A;  1AUE A;  1WEM A;  4CA1 A;  1WEN A;  2P6V A;  2YUC A;  1ST6 A;  2XOZ A;  4WZ2 A;  2MD8 C;  2YZS A;  4RD9 A;  4PFO A;  2ECG A;  4J32 B;  1MMA A;  1QZX A;  4O6N A;  2FUU A;  4IAO A;  2IYL D;  4OIN F;  2R7R A;  3ZQV A;  4V3K C;  3O55 A;  2MIQ A;  3AQC A;  1NFN A;  1WAS A;  3LEV A;  4LK9 A;  3O7A A;  1V74 B;  3LQI A;  3JRM O;  2YT5 A;  3GM2 A;  2C2V S;  1D0Y A;  4I3M A;  2Q9A A;  4AE4 A;  3LLK A;  2VPD A;  5SVX A;  2WVN A;  2ETS A;  4MVM A;  4LAD B;  1JPJ A;  2M64 A;  2FSA A;  3RH3 A;  1L7C A;  2XLV A;  1WGW A;  1OW8 A;  2GFH A;  1ORY A;  3DKA A;  1EKY A;  3SOX A;  4PR9 A;  3C63 A;  3EGX A;  3K1H A;  3U9J A;  3X1O A;  2VC9 A;  1N87 A;  5K3Q A;  5LCW B;  2J9B A;  3VM6 A;  3ZC4 A;  2AVK A;  4BJ5 A;  2EA6 A;  3M1C B;  2CSZ A;  2V26 A;  3SXZ A;  4I1M A;  4JIO A;  1RJ9 A;  2Q7R A;  2HMQ A;  4KC9 A;  3M4C A;  3RYL A;  2VCA A;  5FZT A;  4ONS A;  5B1B C;  3ZYQ A;  2R02 A;  1NLX A;  2DSM A;  1OR3 A;  3PUR A;  3DM9 B;  1ZHX A;  4CSA C;  5TBN A;  3C62 A;  2LGL A;  3T7L A;  4MTO A;  2H7O A;  3C6W A;  1O3U A;  4O6M A;  3HNK A;  2J9U A;  3IQT A;  4LDK A;  4UDV A;  2HKV A;  3LRQ A;  2H0D A;  3I2D A;  4FK5 A;  5H1T A;  2GWW A;  1IZM A;  2XB1 A;  2A69 F;  3SEO A;  4H9D A;  3QVZ A;  5K0I A;  2L9J A;  3ZSU A;  4EHP A;  4LLB A;  4LLC A;  1Z2Q A;  2R03 A;  4C3E A;  2I50 A;  4D4X A;  2GAQ A;  3B0P A;  2YL3 A;  1LKX A;  3LUT B;  2Y43 A;  5LKT A;  3M7K A;  2PNO A;  4EUK B;  1U0B B;  4QQ4 A;  4IAQ A;  4OD4 A;  5DS6 A;  4A49 A;  1HYI A;  3EB5 A;  4O64 A;  5D1L B;  5B79 A;  3M62 A;  2MYS A;  3NG2 A;  3NYJ A;  4O6Y A;  2KWN A;  2GA0 A;  4JW1 A;  1K40 A;  4XI1 A;  1LM3 B;  4LAC B;  3ABL C;  5B1A C;  1FP0 A;  3N9P A;  5E2Q A;  4ZLC A;  4YN0 B;  2LGK A;  1JPN A;  4G78 A;  5SVY A;  2YSJ A;  5LKZ A;  1CPR A;  3K7D A;  4IWB A;  2XP0 A;  3EPV A;  3SOU A;  1Y4C A;  5KYW B;  3KDE C;  2MNZ A;  3RQF A;  5JVE A;  1QLE C;  2VPG A;  5TAB A;  4CX9 A;  2TMV P;  3Q6M A;  3LLI A;  4EBB A;  4W4U A;  1T6Q A;  5SVI B;  2C2L A;  1OQC A;  4Z9J A;  2QLA A;  2XOY A;  3CAX A;  5B3S C;  2ZXR A;  1T6I A;  2FFH A;  2BAY A;  1FAP B;  4ANJ A;  2PP4 A;  4NTF A;  4C3D A;  1FR0 A;  3V5X A;  3FMS A;  4JUR I;  1LDK C;  4PTB A;  2R7O A;  1H9G A;  2B0H A;  5I3L A;  5JS5 A;  2RSE B;  4O7G A;  3L0I A;  3FHD A;  4JEB A;  1HY5 A;  4EWC A;  3DXJ F;  4E7Z A;  1OCZ C;  3DWD A;  2VNF A;  2X0C A;  3ZPV E;  3VK6 A;  5AIU A;  2EPK X;  2J7P A;  1K04 A;  3WHN A;  2J46 A;  2Y1N A;  4PJL A;  2MUM A;  2KFT A;  2ZXO A;  4MW3 A;  3RVY A;  2YKZ A;  2DYS C;  3S27 A;  4A2N B;  3NMJ A;  2AP3 A;  2VP7 A;  3IPM O;  2B0J A;  4FES A;  3GM1 A;  2NUT A;  2XLW A;  2ZXP A;  2VCB A;  2R9R B;  4MVQ A;  5AC4 A;  3HCS A;  1T6U A;  2JRJ A;  4ULV A;  4H4K C;  2XLD A;  3KNV A;  3R2P A;  3SZR A;  4D4N A;  1YLM A;  2EOD A;  3AG4 C;  2AU5 A;  3PHF 2;  4OGC A;  4OD5 A;  2RR4 A;  3GOR A;  2EIK C;  5KYU B;  2L81 A;  5L0C A;  2MA6 A;  3FJU B;  1D1C A;  1LE2 A;  4DRH B;  5B8D A;  2IQJ A;  2Y3H A;  5DLJ A;  3C8G D;  1VYI A;  5T3T A;  1CHC A;  2KGI A;  2XOC A;  3RTR B;  1MM2 A;  4J7T A;  3UMI A;  3C7J A;  3UGP A;  3U2M A;  4P9F A;  2XXA A;  4IC3 A;  1OCO C;  4QF2 A;  1QQ3 A;  2KR4 A;  4WZ3 B;  4IC2 A;  1WWP A;  4WAB A;  3DJN B;  1WIM A;  3MHH A;  1X4J A;  3O10 A;  4MND A;  3V7O A;  1WEU A;  2R7S A;  1ZHY A;  3OA1 A;  5T3W A;  3U2L A;  1MND A;  2PX3 A;  3UGO A;  3EGD B;  3PMR A;  2LV9 A;  2VPB A;  2KK1 A;  1YA7 O;  2R7W A;  3JYY A;  1VFY A;  4K7B A;  3S0X A;  3U3F A;  2K4D A;  4NQF A;  2EPO A;  3U8P A;  3MBG A;  5LKX A;  5L0G A;  4X3G A;  3CZ6 A;  2XL6 A;  3QVY A;  1WEW A;  2ECW A;  1M6T A;  1XWJ A;  2YSM A;  2DJA A;  2DGJ A;  3CQZ A;  2M85 A;  2XLM A;  2V3C C;  3RW0 A;  5CI8 A;  5H1U A;  4K1O A;  4BEM J;  1D0X A;  4G7O F;  4A4A A;  1MBM A;  4X0R A;  2IDA A;  1BBH A;  2OU6 A;  1WFK A;  3VAY A;  1AEP A;  1R4T A;  5HV9 A;  1BR1 A;  4HFF B;  2R05 A;  1G4U S;  4NY3 A;  5A69 A;  3WAQ A;  5TJ5 E;  2YHO A;  1H9T A;  3EGX B;  1WOL A;  5KYX B;  2IXM A;  1A7E A;  1WEV A;  2HJ3 A;  2AWY A;  2DX8 A;  4CS8 A;  5D1K B;  4BHW A;  1CGO A;  3NKE A;  3W4Y A;  2D8S A;  2KGO A;  2CCY A;  1E2X A;  3UMH A;  1LE4 A;  1FMV A;  5H1V A;  2A6E F;  1HMD A;  2PF4 E;  4XEF A;  2LD6 A;  4NTB A;  3JTL O;  1OKK D;  3M15 A;  2A68 F;  2R7U A;  1N1C A;  1HYJ A;  5L0J A;  1PV3 A;  2VJE A;  4XPW A;  5L3V A;  1YDI A;  4YL3 A;  3UR3 C;  1JR8 A;  1M56 C;  1CGM E;  2H0D B;  4IJJ A;  2L75 A;  2H7B A;  2EIJ C;  2W9Y A;  3T6G B;  1WN0 A;  4QI2 A;  4DRJ B;  2QIC A;  4DRI B;  1NSG B;  3S90 A;  3UNG C;  5AIT A;  3NDB B;  3DJU B;  1VB5 A;  4WGZ A;  1RCP A;  2HJM A;  1C03 A;  1J8Y F;  4FO9 A;  2YQM A;  3KPH A;  2LFF A;  2O9X A;  1AVO B;  2YVK A;  3ABM C;  5TRB A;  2P7V A;  3FOP A;  1A0B A;  2YVR A;  5TDW A;  5G05 B;  4MTG A;  1DVP A;  4PJJ A;  2ZXW C;  1B68 A;  1NZE A;  2RI7 A;  1ZVZ A;  4F4B A;  4CS7 A;  1FNT c;  4DOZ A;  1T1H A;  4OIP F;  4N6C A;  2AWC A;  1HW1 A;  4R32 A;  4FAP B;  4C7O A;  4CCG X;  2K16 A;  4OGE A;  3QZV A;  5EK0 A;  2L5U A;  3LVQ E;  3DZA A;  5FER A;  3KQI A;  4QF3 A;  1NFO A;  3DD7 A;  3Q7L A;  2YHN A;  2CT2 A;  4AL1 A;  3ZVZ B;  2D5R B;  3C8Z A;  4BJ5 C;  2LN0 A;  4YL1 A;  4DBQ A;  1BOR A;  4PFP A;  3FAN A;  3NRH A;  1W2W A;  1TWA A;  5F5H A;  2Y39 A;  1VLS A;  1TWC A;  3US6 A;  1TFK B;  2ZPA A;  5JLI A;  4MVT A;  2G3K A;  3HNJ A;  4GYT A;  1Q0F A;  4A4B A;  2ECI A;  4WZ0 A;  3RQE A;  5JG6 A;  1BZ4 A;  3FM8 C;  2J0W A;  4OIR F;  3X2Q C;  1Z3I X;  4GNG A;  4GNF A;  5EHH A;  3HTK C;  4BPM A;  4FJC A;  2P1A A;  4FX5 A;  3IQ6 A;  4CSA A;  2VAS A;  4YBM A;  2QJ0 A;  4K0D A;  1G8X A;  4AYC B;  3AJM A;  2WVO A;  1YYJ A;  3H2V A;  4QDL A;  256B A;  4U5C E;  5L0H A;  3WG7 C;  2YLI A;  3CSK A;  4MW8 A;  3KKB A;  1E84 A;  2OG2 A;  1JM7 A;  1YYX A;  2L7A A;  5DQT A;  3K66 A;  2QNL A;  2XRH A;  4LER A;  2L7P A;  1JMW A;  1V4A A;  4E0H A;  2YWA A;  3PLW A;  5L0I A;  3C5K A;  2A0U A;  2G45 A;  1WTY A;  5A6K A;  4EIY A;  5FB1 A;  1GQA A;  3MLG A;  2YYR A;  2PBE A;  1TR2 A;  4OIQ F;  2KJG A;  3LQH A;  2HZ8 A;  3WOD F;  1NU7 D;  3O35 A;  4YJW A;  1EI7 A;  3T4R A;  3HNL A;  4MVU A;  5G04 B;  3SUB A;  4B86 C;  3ZTG A;  2R25 A;  2M13 A;  4BJ6 A;  1E4U A;  5KYY B;  4YT5 A;  1APC A;  2W4B A;  3S84 A;  2AN6 A;  1Q0M A;  3RFY A;  1WEO A;  4NC3 A;  3GEH A;  1OKK A;  4G0H A;  2OQM A;  3W8I A;  5KH7 A;  1F62 A;  3B0U X;  5DIN A;  3I4U A;  1D0Z A;  2LQG A;  2J8W A;  4OIO F;  3N9N A;  3EH2 A;  1MM3 A;  2OKU A;  2D4U A;  4U9D A;  5J3X A;  3V5Y A;  3SHB A;  1U6H A;  3O33 A;  2LDR A;  5EGY A;  2NG1 A;  1CPQ A;  3MYF A;  3LAY A;  4PAC A;  1XWH A;  3LS1 A;  4C7O B;  4B7Y C;  5D92 A;  2YW8 A;  4IGG A;  2JPU A;  2FGY A;  3DDT A;  4KNW A;  4KI2 A;  2JUN A;  1FBV A;  4JVS A;  5COM A;  2CGE A;  3SNH A;  2EGM A;  4H54 A;  1IYM A;  4AK9 A;  1ZW2 A;  1QVX A;  3ZVR A;  4U5H A;  3J06 A;  2Y3B A;  3ZIB A;  4IAR A;  4XLN F;  2VJF B;  1Z5Z A;  2R7Q A;  1MMG A;  1SF8 A;  3TQO A;  4XWJ A;  1HE1 A;  3GV4 A;  2E87 A;  4JE9 A;  3V5Z A;  1ORS C;  3F46 A;  2CNW A;  2YL1 A;  3HCT A;  2KU3 A;  2LSE A;  4DXW A;  1FFT C;  2MWQ A;  4DJ9 A;  3IHU A;  2KWK A;  3IEE A;  3C18 A;  3U5O A;  3A9C A;  3A11 A;  1JOG A;  1FMW A;  3IQC A;  2D8U A;  4HEA J;  2KQ9 A;  1IW7 F;  3EGD A;  2JMI A;  1FFH A;  2VJF A;  1G5Z A;  3W2W A;  2NAA A;  2A6H F;  3RVZ A;  3MYI A;  4B6I A;  4I7D A;  3GEE A;  2HYE D;  1WEQ A;  3RPG C;  2LIG A;  4Q6F A;  2OEX A;  3EZH A;  3Q6N A;  2BL2 A;  4BJT A;  2YHS A;  3HLZ A;  4M63 A;  2F22 A;  4BJ6 C;  5BUO A;  1RMV A;  2XSE A;  1TFO B;  4EBJ A;  3U5S A;  5COG A;  2M3H A;  3LES A;  5D91 A;  1A7V A;  4A4C A;  3QZC A;  2Z15 A;  1LS1 A;  5BQI A;  1JOC A;  5KH9 A;  5L0F A;  5BQG A;  3ECS A;  1H7I A;  3M99 A;  1O5H A;  2NPU A;  4XEV A;  3O6X A;  3MFN A;  5KYY A;  3M79 A;  2KYH A;  5FB0 A;  1JRA A;  4Z0R A;  4Z9I A;  1NBB A;  4UI9 B;  1GS9 A;  3ZTM A;  3ZG1 A;  1VOM A;  5F28 E;  2CYD A;  1X4I A;  1S7Z A;  1MQV A;  3KMI A;  3LNM B;  2DYR C;  1Z63 A;  2ECJ A;  1C17 M;  4U5B E;  2VB6 A;  3AQB A;  4MVS A;  4BG0 A;  3IHP A;  2YL0 A;  2EPL X;  3NYL A;  1ZBD B;  1TQG A;  3SYN A;  4ULW A;  1KTM A;  3AOU A;  3LDY A;  2EPM X;  2ZD9 A;  4KBL A;  1YA9 A;  2LGV A;  4J7Y A;  1VYX A;  2E61 A;  5B3I A;  1OCC C;  3SOW A;  3T9K A;  1M57 C;  1XZQ A;  5FEY A;  3RIP A;  3LQJ A;  2IOQ A;  1Z6U A;  3T6B A;  4R2Y A;  2ASR A;  4E0I A;  2H8A A;  2KNH A;  3M4B A;  5COF A;  1E83 A;  3TUL A;  4JEA A;  1QKR A;  1YAU O;  3ASO C;  2LQ6 A;  4F1P A;  1LS4 A;  2JMD A;  2Q3T A;  3JT1 A;  4XTK A;  5A6A A;  2HSQ A;  3FDQ A;  1SR2 A;  4PJN A;  2P61 A;  4MTF A;  3G50 A;  2H7V C;  1YJG A;  1JM7 B;  3I5Q A;  2PNX A;  1Z60 A;  2R7V A;  1KU2 A;  5AGF A;  2ECN A;  3C8G B;  4UP0 A;  4KNV A;  2M4E A;  1Q0K A;  2NUT B;  4JJF A;  4RBN A;  4P6I C;  4U5E E;  4N06 A;  3O39 A;  2ECT A;  3QMK A;  3O70 A;  2HDP A;  2E6R A;  1X4U A;  2YEV A;  3ZDL A;  5TDR A;  5E3A A;  3K6B A;  2PFD A;  1A7D A;  1GGQ A;  3N2Z B;  2MA5 A;  2OJQ A;  2LXP C;  3EFO B;  4U5G A;  3N9M A;  2LXH C;  3KV5 A;  5BQH A;  3B71 A;  3H2U A;  2EIN C;  2JX0 A;  2R7X A;  1OXK A;  3M63 A;  2KE1 A;  2KC3 A;  1Q0G A;  4Q4Z F;  2EXU A;  3BEH A;  1ZYR F;  2EIL C;  1LVK A;  4I7B A;  2OEV A;  3N24 A;  1Z23 A;  2J9W A;  4DVZ A;  1RKE B;  3PUQ A;  3O47 A;  2EGP A;  1E86 A;  3U5N A;  4U5F E;  1DOW A;  3POV A;  2P0N A;  4YK5 A;  4Q7C A;  2QIZ A;  5JSL A;  1U89 A;  2J0X A;  3QW0 A;  2JMJ A;  3U8V A;  3V43 A;  1TKN A;  2HFI A;  4CS9 A;  1EA8 A;  4YBS A;  4C3B A;  4CJG A;  2WVQ A;  2WL8 A;  2FFW A;  1I4Z A;  1MMD A;  3LJB A;  4LDQ A;  1LI5 A;  2KKY A;  4MS2 A;  4CDY A;  2KGG A;  2KWO A;  4V3L C;  1I5N A;  3DI5 A;  4WJ0 A;  1OW6 A;  2RSD A;  3PHD A;  4PK4 A;  5FCL A;  4MSX A;  2KW3 C;  4EBK A;  4ZDT A;  4GND A;  4AVX A;  1KNY A;  3ITF A;  2YU4 A;  3SP1 A;  3EH1 A;  5E33 A;  1RKC A;  4YT2 A;  1EQ1 A;  5L3Q A;  2MHR A;  3R7C A;  1QPU A;  2XM0 A;  3S28 A;  2PUY A;  3K1I A;  1OXB A;  1I4Y A;  2KWJ A;  2A1D D;  2HMZ A;  2CSV A;  4L58 A;  3BRJ A;  1H6G A;  2VCC A;  3DMD A;  1K05 A;  3NMI A;  3FL2 A;  2HV6 A;  5C11 A;  3DE9 A;  4AE4 B;  1ZHW A;  4XEK A;  2VPE A;  4XLP F;  2LFD A;  4XPY A;  5B78 A;  2C04 A;  3FVY A;  2M1R A;  2MD7 B;  4F52 B;  4JCH A;  4U9E A;  1QSP A;  4CDA A;  1WEP A;  2F6J A;  4GB0 A;  3GWL A;  3HKK A;  4NTA A;  4L6R A;  5F5F A;  2VJE B;  4TKP B;  3SXM A;  1WAT A;  3RPG B;  2OXQ C;  3C8G A;  2F6N A;  5G0F A;  2Q9C A;  3AG2 C;  1T9K A;  3ZQY A;  3TOM A;  3GEI A;  3OWT A;  2CRW A;  2WZF A;  3VYW A;  4PJM A;  3U0C A;  3NKD A;  4JJG A;  3DAG A;  2L43 A;  3DM5 A;  2A0B A;  3L8J A;  3DWW A;  4AX2 A;  4CIP A;  5DS4 A;  1BR2 A;  5C13 A;  3ATP A;  5DVW A;  4Z9H A;  2XS1 A;  3L11 A;  3TJ5 A;  5B76 A;  3B0V C;  4MVO A;  2LAU A;  3O34 A;  3U5P A;  4N4W A;  1BR4 A;  4L7X A;  3PDM P;  4YL0 A;  1YVI A;  4E18 A;  4O62 A;  4LJN A;  3QW1 A;  1RJ9 B;  4YWQ A;  3EFO A;  3B29 A;  2G62 A;  4ZQL A;  3TJ6 A;  4P9T A;  1YZA A;  3H7H A;  3AGT A;  4JTA B;  3JSE O;  3E2D A;  3JRT A;  4JTD B;  3TD7 A;  3EG9 B;  5L0D A;  3ZWI A;  2Y69 C;  3LVR E;  3KL4 A;  4GEH A;  5A6J A;  2CDQ A;  2QUP A;  1HW2 A;  4AL0 A;  2CW0 F;  3VRC A;  5KYU A;  2I15 A;  3QTH A;  1TWH A;  3T6R A;  1RKE A;  5T1D B;  3HNI A;  3TK0 A;  2MKE A;  3OEO A;  2P57 A;  1U6G B;  3KV6 A;  4IB4 A;  2HS5 A;  4GNE A;  3U3B A;  2QE9 A;  1PD0 A;  1VTM P;  3ZVY A;  4R7E A;  3T6J A;  5JUA A;  2XLE A;  4JC7 A;  3FAJ A;  4XPX A;  3K1I C;  2W45 A;  3T9O A;  2XM4 A;  2DI3 A;  2L6F A;  2WZG A;  2YRE A;  3GM3 A;  3ZTZ A;  3LJU X;  2GDC A;  2CRR A;  3EQL F;  1G4W R;  3SXK A;  2NSG A;  3AG1 C;  4CJO A;  3DQV R;  1ZU4 A;  1LIH A;  4QI0 A;  1S05 A;  2WZL A;  3PCV A;  3UMK A;  1ZHT A;  2ECV A;  3EJN A;  3IQ5 A;  1VYK A;  4YBT A;  2XL8 A;  4JCZ A;  3AGU A;  3JUE A;  3N9Q A;  5KH3 A;  2R7T A;  4C9Z A;  3H65 A;  4JZA A;  5A6B D;  3G4X A;  1WEE A;  4S3O C;  4ZLD A;  4N6H A;  4W8P A;  3AG3 C;  4RDA A;  1V55 C;  2CKL A;  1HMO A;  1WE9 A;  4U5D E;  3EHN A;  5B77 A;  2W4M A;  4CDV A;  3N9O A;  4E7S A;  1F1M A;  4AUQ B;  2OOC A;  1J8M F;  4JKV A;  3K33 A;  4MQ9 F;  4R8P K;  2FD4 A;  1VLT A;  3LNR A;  1R5I D;  5DQZ A;  2Q4F A;  2Q00 A;  1K2F A;  2FUI A;  2K17 A;  4LLE A;  5H9M A;  4I1O B;  4YT4 A;  4MVR A;  3N9L A;  2YQY A;  2JD3 A;  4ZUX U;  2C03 A;  1OW7 A;  1ZW3 A;  1DCQ A;  2ZET C;  5JRA A;  3ABK C;  1M2V A;  3L1Z B;  1SYQ A;  1RXQ A;  1ZZP A;  3GWN A;  3DAF A;  2YLG A;  2CON A;  5KYW A;  2KIZ A;  2MT5 A;  2KYU A;  4Z0O A;  2Q9B A;  3MDB C;  1GM5 A;  1JAF A;  2UUI A;  3ASL A;  1VMA A;  2Y3G A;  3GOD A;  2YUR A;  3DE8 A;  2B0O E;  2XLO A;  2QTV A;  4YT8 A;  1E85 A;  1LDJ B;  1D1A A;  2HUJ A;  3HJC A;  1O87 A;  2LRI C;  2EIM C;  1RMD A;  1ORJ A;  2Y1M A;  3HCU A;  3U5M A;  3ASN C;  4LKA A;  2J7P D;  2IXP A;  3KH2 A;  1PD1 A;  2KKX A;  2M6M A;  2IXO A;  2XXA B;  4I7C A;  3JZ0 A;  5GPG B;  2I8B A;  4LDR A;  3FEH A;  1YAR O;  3SXY A;  5SVI A;  1WIL A;  5A6B A;  1XZP A;  4W8K A;  4MVZ A;  3JSZ A;  1D1B A;  3F47 A;  4IRU A;  1G25 A;  3VF0 A;  3W8H A;  1LI7 A;  5CIV A;  2J45 A;  3Q7G A;  5HSW A;  5AC5 A;  3ZPV 1;  2RD9 A;  1T01 A;  4YAX A;  2Y3D A;  5JP7 A;  3E70 C;  2XS8 A;  1DOV A;  2L6G A;  2LP4 A;  1ZHZ A;  3GAN A;  4Q5S F;  1OR2 A;  3DPL R;  3W2V A;  4ER9 A;  2KSF A;  5KYX A;  2ICW G;  2L6H A;  4YAB A;  4BEJ A;  5D1M B;  3NYM A;  2MNY A;  4WGY A;  3U9M A;  2J9V A;  3FAP B;  2YQL A;  1SZI A;  1UFB A;  3S9O A;  2OWA A;  1Q0D A;  1NU9 C;  3JYH A;  3N0T A;  2HV7 A;  3EB6 A;  4JRZ A;  2KRE A;  4WA6 A;  4O79 A;  2CKL B;  2CNW D;  4YAT A;  3JCU Q;  1SMY F;  2VH3 A;  1V54 C;  4CIH A;  5DKA A;  1A41 A;  1M2O A;  1C02 A;  4YC9 A;  4GQH A;  4S3O B;  1OCR C;  3L8I A;  1L3P A;  1UG7 A;  4JTC B;  4I44 A;  3CEX A;  3EG9 A;  2OCC C;  4BJ1 A;  4CS9 C;  1Y6D A;  5IY5 C;  2K1J A;  2LCH A;  4CS8 C;  1BDJ B;  1YZC A;  5EYA F;  4G7H F;  4HFK B;  1PCX A;  1T5O A;  2NUP B;  4FWV A;  4XQ1 A;  3NMK A;  2L0B A;  5LKU A;  2X51 A;  3S29 A;  1VK5 A;  2NSF A;  1LPE A;  3O36 A;  3FAO A;  2CSY A;  3L1X A;  4AYC A;  2XLH A;  4DVY P;  2YLD A;  4AP4 A;  4HE8 D;  3O37 A;  2G3V A;  2G6Q A;  1M2V B;  3GL6 A;  3I5P A;  2LK4 A;  2IBF A;  5CI9 A;  2IM8 A;  5JT4 A;  4A0C D;  3EZI A;  3B9Q A;  3ZNI A;  3MHS A;  2UUH A;  2UZG A;  4YAD A; 
#chains in the Genus database with same CATH homology
 1MNE A;  4JJG A;  1Z5Z A;  5T3W A;  1ZU5 A;  1MND A;  2BE5 F;  2PX3 A;  3DAG A;  3DM5 A;  3EGD B;  3UGO A;  2L43 A;  2R7Q A;  3PMR A;  1MMN A;  1MMG A;  2LV9 A;  2VPB A;  1FTS A;  2R7W A;  4AX2 A;  1VD4 A;  1VFY A;  4K7B A;  5DS4 A;  3S0X A;  5B75 A;  1BR2 A;  5KYN A;  5C13 A;  2K4D A;  1SF8 A;  5DVW A;  4XWJ A;  5LKX A;  4G7Z F;  3GV4 A;  3L11 A;  2QY9 A;  2E87 A;  5B76 A;  1TWG A;  4FIP A;  4X3G A;  3B0V C;  3O34 A;  3U5P A;  5DS5 A;  2NUP A;  4P5O B;  4N4F A;  1BR4 A;  4L7X A;  3F46 A;  2CNW A;  3CZ6 A;  1WES A;  3HCT A;  1WEW A;  2ECW A;  3L34 A;  2KU3 A;  2LSE A;  2WB7 A;  4LJN A;  1FFT C;  3RKO F;  2MWQ A;  2YSM A;  3MX3 A;  4BBQ A;  1RJ9 B;  4YWQ A;  2KWK A;  4A49 A;  4J30 B;  3EFO A;  4UP5 A;  2L80 A;  2DGJ A;  3IEE A;  3CQZ A;  2G62 A;  2PX0 A;  4ZQL A;  4CBE A;  2M85 A;  2IXN A;  3U5O A;  2V3C C;  2F42 A;  5CI8 A;  1V87 A;  1Z6A A;  5H1U A;  3JRT A;  1D0X A;  4G7O F;  3TD7 A;  1FMW A;  3EG9 B;  1WGM A;  2LGG A;  4X0R A;  2IDA A;  2Y69 C;  1WFK A;  3VAY A;  3KL4 A;  4HEA J;  3NG1 A;  3EHM A;  4GEH A;  2KQ9 A;  1IW7 F;  3EGD A;  2CDQ A;  1NG1 A;  3E9V A;  2JMI A;  1FFH A;  3W2W A;  2VJF A;  2XL4 A;  2CW0 F;  2A6H F;  2NAA A;  1BR1 A;  4HFF B;  5KYU A;  3LS0 A;  4B6I A;  5E3C A;  4I7D A;  1TWH A;  3T6R A;  2HYE D;  5T1D B;  4NN2 A;  4N3W A;  1WEQ A;  3RPG C;  2G43 A;  2XEU A;  4NY3 A;  3OEO A;  4DBR A;  4Q6F A;  3EZH A;  3Q6N A;  1U6G B;  4BJT A;  3KV6 A;  2YHO A;  2YHS A;  3HLZ A;  3EGX B;  2E6S A;  4M63 A;  5KYX B;  4BJ6 C;  4PPE A;  2IXM A;  5BUO A;  1WEM A;  4GNE A;  4CA1 A;  2XSE A;  1WEN A;  2P6V A;  2YUC A;  1WEV A;  1ST6 A;  1PD0 A;  4WZ2 A;  2M3H A;  3LES A;  5D91 A;  2DX8 A;  2MD8 C;  4CS8 A;  5D1K B;  4BHW A;  3ZVY A;  2YZS A;  4RD9 A;  4PFO A;  3T6J A;  4R7E A;  2ECG A;  3NKE A;  4A4C A;  3QZC A;  2Z15 A;  2D8S A;  1LS1 A;  4J32 B;  5B79 A;  2KGO A;  3FAJ A;  1MMA A;  3K1I C;  1JOC A;  5KH9 A;  1QZX A;  4O6N A;  2FUU A;  3UMH A;  4IAO A;  2IYL D;  2W45 A;  3ECS A;  3M99 A;  4OIN F;  1O5H A;  2R7R A;  1FMV A;  2WZG A;  5H1V A;  4V3K C;  2A6E F;  2YRE A;  3O6X A;  2PF4 E;  2MIQ A;  3AQC A;  5KYY A;  1OKK D;  3EQL F;  2A68 F;  2R7U A;  3AG1 C;  5FB0 A;  1N1C A;  1HYJ A;  3LEV A;  4UI9 B;  4LK9 A;  2VJE A;  3O7A A;  3LQI A;  3ZG1 A;  5L3V A;  1VOM A;  3DQV R;  1X4I A;  1S7Z A;  3UR3 C;  1ZU4 A;  2YT5 A;  2C2V S;  1D0Y A;  4I3M A;  1M56 C;  2H0D B;  4IJJ A;  3KMI A;  2L75 A;  2Q9A A;  2H7B A;  4AE4 A;  2DYR C;  4QI0 A;  2WZL A;  3LLK A;  1Z63 A;  2ECJ A;  2VPD A;  2WVN A;  2EIJ C;  3UMK A;  2W9Y A;  4U5B E;  2VB6 A;  3AQB A;  1ZHT A;  2ECV A;  3EJN A;  4BG0 A;  3IHP A;  4QI2 A;  4LAD B;  1VYK A;  1JPJ A;  4YBT A;  3NYL A;  2QIC A;  2FSA A;  3RH3 A;  5KH3 A;  1WGW A;  3N9Q A;  2R7T A;  1ZBD B;  4C9Z A;  3H65 A;  4JZA A;  2GFH A;  3UNG C;  3SYN A;  1WEE A;  4S3O C;  4ZLD A;  5AIT A;  4ULW A;  3AG3 C;  4RDA A;  3NDB B;  1V55 C;  3SOX A;  2CKL A;  3DJU B;  1WE9 A;  4U5D E;  3EGX A;  3K1H A;  3EHN A;  4KBL A;  5B77 A;  2W4M A;  3N9O A;  2LGV A;  4E7S A;  3X1O A;  1VYX A;  1N87 A;  1J8Y F;  4AUQ B;  1J8M F;  4FO9 A;  1OCC C;  2YQM A;  3K33 A;  4MQ9 F;  5LCW B;  4R8P K;  3SOW A;  3ZC4 A;  4BJ5 A;  1M57 C;  3LNR A;  2EA6 A;  5FEY A;  5DQZ A;  3RIP A;  3LQJ A;  2O9X A;  3M1C B;  1K2F A;  2CSZ A;  2V26 A;  3ABM C;  2FUI A;  2IOQ A;  2P7V A;  5TRB A;  2K17 A;  1Z6U A;  4LLE A;  4I1M A;  3T6B A;  1RJ9 A;  5H9M A;  4I1O B;  4KC9 A;  4R2Y A;  4YT4 A;  3RYL A;  5B1B C;  3N9L A;  3ZYQ A;  5TDW A;  2KNH A;  5G05 B;  1DVP A;  2JD3 A;  4PJJ A;  3PUR A;  2ZXW C;  1HYI A;  1NZE A;  1ZHX A;  3DM9 B;  2RI7 A;  3ASO C;  4F4B A;  4CSA C;  4CS7 A;  4ZUX U;  5TBN A;  4DOZ A;  1T1H A;  4OIP F;  2C03 A;  2LQ6 A;  2LGL A;  3T7L A;  2JMD A;  2H7O A;  4C7O A;  2ZET C;  2Q3T A;  3C6W A;  3JT1 A;  4O6M A;  4XTK A;  4CCG X;  3FDQ A;  2J9U A;  3ABK C;  2K16 A;  3LRQ A;  3QZV A;  1M2V A;  3L1Z B;  2L5U A;  3DZA A;  2H0D A;  4PJN A;  3I2D A;  4FK5 A;  5H1T A;  3DAF A;  3KQI A;  5FER A;  2H7V C;  4QF3 A;  1IZM A;  2XB1 A;  2A69 F;  1JM7 B;  5KYW A;  2KIZ A;  3I5Q A;  3SEO A;  2PNX A;  1Z60 A;  3DD7 A;  2R7V A;  1KU2 A;  2MT5 A;  3Q7L A;  2KYU A;  2YHN A;  2CT2 A;  2L9J A;  3ZSU A;  4LLB A;  4LLC A;  1Z2Q A;  3ZVZ B;  2Q9B A;  4C3E A;  2ECN A;  2I50 A;  4KNV A;  4UP0 A;  2D5R B;  4BJ5 C;  2LN0 A;  2M4E A;  2NUT B;  4JJF A;  4RBN A;  5TDR A;  4P6I C;  4U5E E;  1BOR A;  4N06 A;  3O39 A;  4PFP A;  4DBQ A;  2ECT A;  3B0P A;  3NRH A;  1LKX A;  2Y43 A;  5LKT A;  1W2W A;  1TWA A;  5F5H A;  3QMK A;  2Y39 A;  1VMA A;  3ASL A;  2Y3G A;  3O70 A;  1TWC A;  3GOD A;  2HDP A;  2YUR A;  4OD4 A;  2E6R A;  5DS6 A;  2ZPA A;  2QTV A;  4YT8 A;  1LDJ B;  2YEV A;  1X4U A;  3EB5 A;  4O64 A;  4MVT A;  5D1L B;  1D1A A;  3HJC A;  3M62 A;  1O87 A;  2G3K A;  2MYS A;  3NYJ A;  2EIM C;  2LRI C;  3NG2 A;  4GYT A;  4O6Y A;  2KWN A;  2ECI A;  1RMD A;  4WZ0 A;  4A4B A;  2Y1M A;  4JW1 A;  5E3A A;  3HCU A;  3U5M A;  3K6B A;  4XI1 A;  2PFD A;  3ASN C;  4LKA A;  2J7P D;  2IXP A;  4LAC B;  3KH2 A;  1PD1 A;  3ABL C;  3N2Z B;  5B1A C;  1FP0 A;  2MA5 A;  2M6M A;  5JG6 A;  3N9P A;  5E2Q A;  2J0W A;  4ZLC A;  2IXO A;  2XXA B;  4YN0 B;  4I7C A;  4OIR F;  2LGK A;  3X2Q C;  2I8B A;  1JPN A;  1Z3I X;  4GNG A;  4GNF A;  2LXP C;  5EHH A;  3HTK C;  2YSJ A;  3EFO B;  5LKZ A;  4U5G A;  3N9M A;  2LXH C;  3KV5 A;  4FJC A;  3K7D A;  4IWB A;  4FX5 A;  1WIL A;  4W8K A;  4CSA A;  3EPV A;  3SOU A;  2VAS A;  5KYW B;  2MNZ A;  2EIN C;  3JSZ A;  1QLE C;  1D1B A;  4YBM A;  2VPG A;  2QJ0 A;  4K0D A;  2R7X A;  3M63 A;  5TAB A;  2KE1 A;  1G8X A;  4AYC B;  3F47 A;  3Q6M A;  4IRU A;  3LLI A;  2WVO A;  4QDL A;  4EBB A;  1G25 A;  4W4U A;  4Q4Z F;  4U5C E;  3W8H A;  3WG7 C;  1ZYR F;  2EIL C;  1LVK A;  4I7B A;  3CSK A;  2C2L A;  3N24 A;  3KKB A;  1Z23 A;  2OG2 A;  2J9W A;  4DVZ A;  1JM7 A;  5B3S C;  2ZXR A;  3PUQ A;  5DQT A;  2EGP A;  3K66 A;  2FFH A;  3U5N A;  2XRH A;  4LER A;  2J45 A;  3Q7G A;  5HSW A;  2BAY A;  4ANJ A;  2PP4 A;  4C3D A;  4U5F E;  3ZPV 1;  3POV A;  4JUR I;  4YAX A;  2Y3D A;  1LDK C;  4PTB A;  3E70 C;  4Q7C A;  2G45 A;  2R7O A;  3C5K A;  2QIZ A;  5I3L A;  1ZHZ A;  2J0X A;  3GAN A;  2JMJ A;  4Q5S F;  5FB1 A;  3DPL R;  3MLG A;  4O7G A;  3L0I A;  1TKN A;  3FHD A;  3V43 A;  4CS9 A;  3W2V A;  4EWC A;  3DXJ F;  4E7Z A;  2YYR A;  1OCZ C;  4YBS A;  4C3B A;  2VNF A;  5KYX A;  1TR2 A;  2WVQ A;  3ZPV E;  4YAB A;  3VK6 A;  2WL8 A;  4OIQ F;  4BEJ A;  5D1M B;  5AIU A;  3NYM A;  1MMD A;  3LJB A;  2J7P A;  2MNY A;  2KJG A;  2J46 A;  3LQH A;  2J9V A;  2KGG A;  2KWO A;  2YQL A;  2Y1N A;  4PJL A;  2MUM A;  1SZI A;  2ZXO A;  2KFT A;  4V3L C;  3WOD F;  1NU7 D;  3O35 A;  4YJW A;  4WJ0 A;  2DYS C;  3S27 A;  2RSD A;  3T4R A;  3PHD A;  4PK4 A;  4A2N B;  5FCL A;  4MSX A;  1NU9 C;  5G04 B;  4B86 C;  2VP7 A;  3ZTG A;  3JYH A;  2B0J A;  4FES A;  3N0T A;  2KW3 C;  4ZDT A;  2HV7 A;  2NUT A;  4GND A;  4AVX A;  2ZXP A;  3ITF A;  3EB6 A;  2YU4 A;  4BJ6 A;  3SP1 A;  1E4U A;  3EH1 A;  5KYY B;  2KRE A;  4YT5 A;  5E33 A;  4WA6 A;  4YT2 A;  4O79 A;  2W4B A;  2CKL B;  2CNW D;  5L3Q A;  4YAT A;  3JCU Q;  1SMY F;  2AN6 A;  3HCS A;  3RFY A;  2VH3 A;  1WEO A;  2JRJ A;  1V54 C;  4CIH A;  4H4K C;  1OKK A;  4G0H A;  5DKA A;  3S28 A;  3KNV A;  3SZR A;  1M2O A;  3W8I A;  2PUY A;  5KH7 A;  3B0U X;  1F62 A;  5DIN A;  3I4U A;  4YC9 A;  2EOD A;  2KWJ A;  4S3O B;  1D0Z A;  1OCR C;  2A1D D;  4L58 A;  3AG4 C;  4OIO F;  3DMD A;  4I44 A;  3EG9 A;  2OCC C;  4BJ1 A;  4CS9 C;  3FL2 A;  3N9N A;  3EH2 A;  2HV6 A;  5IY5 C;  1MM3 A;  5C11 A;  4AE4 B;  2K1J A;  4CS8 C;  3PHF 2;  1ZHW A;  5J3X A;  3SHB A;  4OD5 A;  5EYA F;  2VPE A;  4G7H F;  4HFK B;  3O33 A;  4XLP F;  5EGY A;  2EIK C;  5KYU B;  1PCX A;  2L81 A;  2NUP B;  2LDR A;  5B78 A;  4FWV A;  2NG1 A;  2MA6 A;  1D1C A;  2C04 A;  5B8D A;  3FVY A;  2L0B A;  5LKU A;  2X51 A;  3LAY A;  1XWH A;  3LS1 A;  2Y3H A;  3S29 A;  1VK5 A;  4C7O B;  5DLJ A;  2M1R A;  2MD7 B;  4F52 B;  4B7Y C;  1VYI A;  5D92 A;  5T3T A;  2YW8 A;  3O36 A;  4JCH A;  2CSY A;  1CHC A;  2KGI A;  2FGY A;  4KNW A;  3L1X A;  3RTR B;  1MM2 A;  3UMI A;  1WEP A;  2F6J A;  4KI2 A;  3UGP A;  4AYC A;  1FBV A;  4JVS A;  4DVY P;  4GB0 A;  4AP4 A;  4IC3 A;  4HE8 D;  2XXA A;  5F5F A;  3SNH A;  2CGE A;  1OCO C;  3O37 A;  4QF2 A;  2KR4 A;  2VJE B;  2G3V A;  2G6Q A;  1M2V B;  4TKP B;  3GL6 A;  1IYM A;  3I5P A;  4WZ3 B;  3RPG B;  5CI9 A;  4AK9 A;  2OXQ C;  4IC2 A;  3ZVR A;  2F6N A;  5G0F A;  2Q9C A;  3AG2 C;  4U5H A;  3DJN B;  1WIM A;  3MHH A;  3OWT A;  1X4J A;  2Y3B A;  4A0C D;  3EZI A;  3B9Q A;  3ZIB A;  2WZF A;  4MND A;  4PJM A;  3VYW A;  3ZNI A;  3V7O A;  4XLN F;  1WEU A;  2R7S A;  1ZHY A;  2UZG A;  3MHS A;  3NKD A;  3OA1 A;  2VJF B;  4YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...