3HTKC

Crystal structure of mms21 and smc5 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
b'DNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Structural maintenance of chromosomes protein 5
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
total genus 75
structure length 254
sequence length 254
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1010 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3htkC01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3htkC02
4LKAA 4I7CA 3LQHA 3KV5A 2KU3A 2YSJA 3O70A 4QF3A 3EB5A 3MHSA 2FUIA 5H1TA 5FB0A 3KV6A 5B78A 4LLBA 5FERA 4LADB 5B75A 5D1KB 3L1ZB 2L43A 2K4DA 1WILA 1V87A 3ZVYA 2E6SA 4YBTA 1FBVA 2KR4A 2KYUA 3FL2A 4YABA 2KGIA 3SOUA 2LXPC 2ECVA 2KWNA 5B77A 4GNEA 2VPEA 1MM2A 3M62A 2H0DB 3HCTA 4FIPA 1XWHA 3HCUA 2I50A 2L0BA 3N9OA 3KQIA 1X4IA 5I3LA 1G25A 5D1MB 1HYJA 2OXQC 1WEMA 2Y43A 2K1JA 2MD8C 5D1LB 1LDJB 4GNGA 3PUQA 4LK9A 3EB6A 4A4BA 4YC9A 3SHBA 4S3OC 5AIUA 3O37A 5G05B 4ZDTA 3ZVZB 2G43A 5TRBA 4N4FA 1FP0A 4B86C 1E4UA 5EYAF 4W4UA 4NN2A 4WZ3B 2LRIC 2JMIA 2JMJA 4A49A 2YSMA 2CSYA 2MUMA 2ECTA 2CKLA 2PNXA 2EODA 2JMDA 2XEUA 1WEWA 2ECGA 2KE1A 3RPGC 5LKZA 1WGMA 2KREA 2M3HA 3U5OA 3NG2A 1WFKA 4FJCA 2LGVA 2G6QA 5DKAA 4L7XA 1X4JA 3M63A 2VJFB 4F52B 3SOXA 2YW8A 5LCWB 5H9MA 2NAAA 2K17A 4MSXA 3U5NA 1JM7B 4AYCA 2VP7A 2DX8A 2VNFA 4AP4A 1HYIA 4UI9B 1F62A 2M1RA 1WIMA 2MNZA 2MIQA 2YHNA 3O33A 5FB1A 3O35A 4I7BA 3U5MA 3PHDA 2MD7B 4YADA 2LGGA 4FO9A 1JOCA 2XB1A 2EA6A 5G04B 1ZBDB 4IC2A 2QIZA 2F6JA 2AN6A 1Z60A 2MNYA 4YATA 2KFTA 4WZ0A 1WEPA 5KH9A 2VPDA 3GV4A 3T6RA 2G45A 4I7DA 2LGLA 2VJEA 3N9PA 2PUYA 2IDAA 1VFYA 3C6WA 5LKXA 1BORA 2M6MA 5TBNA 1N87A 2L75A 1X4UA 1IYMA 3HTKC 5LKUA 2YQMA 4BBQA 4AUQB 4UP0A 3N9LA 4V3LC 3MHHA 1MM3A 2F42A 3N9MA 5KH7A 2E6RA 1WENA 5JG6A 3ZPVE 2YQLA 2ECIA 1T1HA 3V43A 5B8DA 2FUUA 5C11A 2L80A 3O36A 4IC3A 2L5UA 2LGKA 2YHOA 2JRJA 2ECWA 2ZETC 2KWOA 4C9ZA 4O64A 2YU4A 5H1VA 4X3GA 2C2LA 2CKLB 4TKPB 4WA6A 4GNDA 2RI7A 2VPGA 4R2YA 3ZTGA 5DINA 2RSDA 3ZPV1 1WE9A 2ECJA 3O7AA 3T7LA 2KIZA 2YREA 3N9NA 4PPEA 5G0FA 1K2FA 2MA6A 4LJNA 1RMDA 4ZQLA 2F6NA 4B7YC 2HYED 2YYRA 1U6GB 2EGPA 5C13A 1DVPA 4CA1A 4AYCB 1WEEA 3RTRB 3LQJA 1WEOA 3LQIA 4A0CD 4PTBA 3QZVA 4GNFA 2LN0A 2H0DA 2K16A 2QICA 2BAYA 2HDPA 4P5OB 1Z6UA 3LRQA 2KWKA 3I2DA 4V3KC 2YUCA 4FK5A 3U5PA 3C5KA 3ZNIA 2LXHC 4R8PK 5LKTA 4WZ2A 2D8SA 2FSAA 4Q6FA 4BHWA 5AITA 4QF2A 2YURA 1WEVA 3DQVR 4S3OB 3KNVA 4XI1A 1WEUA 4N3WA 1CHCA 4AVXA 2Y1NA 5TDRA 3O34A 3IHPA 2KWJA 2VJEB 3M99A 3DPLR 1VYXA 2Y1MA 1Z2QA 2UZGA 3GL6A 3HCSA 3VK6A 4YBSA 5J3XA 2CSZA 2MA5A 5FEYA 3RPGB 5H1UA 1WESA 4UP5A 4YAXA 2CT2A 2QJ0A 5B76A 2LDRA 2VJFA 3N9QA 1VD4A 2KGGA 4L58A 2YT5A 5TDWA 4MVTA 5B79A 4CCGX 1WEQA 3ASLA 3ZYQA 4ZUXU 2MT5A 2ECNA 1JM7A 5TABA 4GB0A 2C2VS 3L11A 4R7EA 3L1XA 2VPBA 4YBMA 2M85A 3SOWA 5KH3A 2LV9A 1LDKC 3PURA 2LQ6A 4A4CA
chains in the Genus database with same CATH superfamily
2J9WA 4LKAA 2R7TA 1DCQA 2YSJA 1Z5ZA 3NDBB 2HZ8A 4MVUA 4LLBA 3LVRE 3RW0A 4LADB 2CONA 3T6JA 4LDQA 2L43A 2QTVA 2K4DA 3A11A 1WILA 1V87A 3NMKA 1G5ZA 2DGJA 1D0XA 3FL2A 3LESA 4XPWA 5B77A 5BQIA 2VPEA 3GWNA 3M4BA 3HCTA 1T6UA 2R03A 5DVWA 2EIMC 3BRJA 4RD9A 3PHF2 5D91A 3GEHA 1X4IA 3KQIA 1FFHA 4A2NB 3KL4A 1WEMA 4X0RA 2VASA 3NYJA 1J8YF 5D1LB 2R7WA 2L7PA 4GNGA 3UMIA 3PUQA 2EXUA 4XEFA 3X1OA 3TQOA 4A4BA 4U5CE 1Z7Qc 3O37A 2YLIA 3ZVZB 2H7VC 4N4FA 3FHDA 1RKEA 2FD4A 2WB7A 2LRIC 2JMJA 4LLEA 2LSEA 2XLHA 4BJ5C 3V5YA 2PBEA 3H2VA 2ECTA 1D1AA 1OXKA 3JYHA 3L34A 2PNXA 2JMDA 2YQYA 1Z6AA 3DAGA 4ZLDA 3RPGC 1HMOA 1VYKA 4FJCA 2LGVA 2WZLA 1Q0KA 3EFOB 1OR2A 4I1OB 2VJFB 4F52B 2CRRA 4BJTA 1V55C 2NAAA 3U9MA 1MMGA 2K17A 5A6JA 2GWWA 2LIGA 3JYYA 2DX8A 4AP4A 4JW1A 4WGZA 3O47A 2P57A 2NUPB 2M1RA 3JTLO 1WIMA 1TFOB 2A0UA 2CGEA 2B0JA 2MIQA 4P6IC 5F5HA 1PD0A 3CEXA 2NUTA 4J32B 4O7GA 5L3QA 1FAPB 4C7OB 4YL0A 2LFDA 1I4YA 2XB1A 3AG3C 3LS1A 1SR2A 5A6BD 1Q0DA 3EGDB 1ST6A 1VLTA 3I5QA 2AN6A 1A7DA 4NQFA 1VTMP 4CSAA 3G50A 2VPDA 3O6XA 2G45A 4I7DA 4AE4A 5L0CA 1H9TA 3ZIBA 1HY5A 4OIPF 3ECSA 4GEHA 1M2OA 1LS1A 3DWWA 3HTKC 3UGPA 2YQMA 4BBQA 3N9LA 1G8XA 1E84A 2X51A 2A68F 5KYXA 1MM3A 1M2VA 2ZD9A 3GWLA 3GM2A 3QMKA 2YQLA 1OW8A 5B8DA 1T6IA 2OWAA 2L80A 4DVZA 3WAQA 1E85A 1OR3A 3BEHA 2GAQA 2Q9BA 2YHOA 2JRJA 2ECWA 2XLMA 4BG0A 3K66A 3UMKA 3SUBA 2YU4A 5H1VA 4N6CA 4X3GA 2C2LA 3S28A 2CKLB 2KW3C 4OINF 3H65A 4P9TA 2TMVP 4XQ1A 2XRHA 1FMWA 1CPRA 2GFHA 4GNDA 5E2QA 2RI7A 2VPGA 1UFBA 5L0JA 4DBQA 3N9NA 4I44A 4E17A 4LERA 1NFNA 2MA6A 2KYHA 3C62A 2A0BA 5EK0A 4DOZA 2XS8A 4B7YC 4JTAB 2DJAA 4IB4A 5C13A 2KK1A 3ZSUA 2KKYA 4AYCB 4O6NA 3RTRB 5FZTA 4F4BA 3EGXB 2LN0A 3UMHA 2K16A 3ZWIA 3SXYA 4P5OB 3VYWA 1G4US 1ZHZA 3KDEC 4F1PA 4YWQA 1CGOA 1W2WA 3MLGA 3HNLA 1A7EA 1GGQA 2OQMA 4R8PK 5E33A 3OEOA 4Q6FA 4ULWA 5AITA 1LE4A 4S3OB 4OIQF 3EHMA 5B1BC 1BR2A 3KNVA 3AG2C 1LKXA 4N3WA 1YZCA 2EPLX 3B0UX 2XLVA 4AVXA 3T6GB 2Y1NA 1AEPA 4J30B 3KPHA 2VJEB 1OCOC 1ZZPA 1Z2QA 2R9RB 2M13A 1D0ZA 3FMSA 2UZGA 3U8VA 4PFPA 3FJUB 3EG9A 3R2PA 4MVSA 5J3XA 2EINC 4ONSA 5CIVA 5FEYA 4XLNF 3QW0A 4CS9A 4PK4A 1BZ4A 1OCZC 2XSEA 1NFOA 3N9QA 2YT5A 1OW7A 2HUJA 4MVTA 4L6RA 1JPJA 2J7PD 1ZW3A 1ZVZA 1ZYRF 1V4AA 4ZUXU 4JTCB 2ECNA 1JM7A 5TABA 5BUOA 3E2DA 3L11A 2GDCA 4R7EA 4YT8A 2H7OA 2J0XA 5KH3A 2LV9A 2AVKA 2YZSA 2BL2A 2LQ6A 5JSLA 1D1BA 2Q4FA 4U5HA 4U9DA 4W8KA 2AWCA 2ETSA 1PD1A 1V74B 4QF3A 2EPNA 5B78A 1VLSA 5COFA 1FFTC 5FERA 3EZIA 4K7BA 4CIPA 4DVYP 5EHHA 3ATPA 3L1ZB 1TKNA 3POVA 256BA 4CX9A 3FANA 1FBVA 2KR4A 2HV6A 3CQZA 2J9VA 3SOUA 2LXPC 2ECVA 2LD6A 3M62A 2H0DB 3T4RA 2P6VA 2I50A 3PDMP 1OKKA 2KGOA 2PX3A 2RD9A 1B68A 1QSPA 1MBMA 3N9OA 4AL1A 5D1MB 2OXQC 5KYUA 2K1JA 3Q6NA 2ASRA 4LK9A 2XOYA 3HKKA 3JCUQ 4ZDTA 4PJLA 1HE9A 4DRHB 5TRBA 4Q7CA 5BQHA 3C18A 1S7ZA 3JUEA 4B86C 4CSAC 5SVYA 2CNWD 2UUHA 1Q0GA 5JVEA 1A41A 2E61A 3DXJF 4LACB 4MVOA 5KYNA 1E2XA 3L8JA 2L6FA 1HW2A 2EODA 2R7QA 1LIHA 3S29A 2XEUA 5L0HA 1WEWA 3SYNA 2Y39A 1IZMA 4JURI 2V3CC 2CSVA 2FFWA 2E87A 3ZG1A 4MTFA 3U5OA 2XLDA 3VF0A 1PV3A 1WFKA 5D92A 2G6QA 2CCYA 1WTYA 1X4JA 4XEKA 4Z0OA 1NU7D 3GM3A 1KTMA 3KMIA 1GS9A 2KJGA 4JJFA 4PFOA 5B3IA 3LDYA 2YL0A 2VH3A 3U5NA 3VAYA 2VP7A 2VNFA 3AG4C 3Q7GA 3DMDA 3IEEA 1F62A 3FEHA 1QVXA 3W2VA 4FAPB 3N0TA 4MW3A 2YHNA 4MTOA 3O33A 4G7ZF 4BJ6A 3O35A 2DYRC 1ORJA 4JEBA 5L0DA 2KC3A 4LDKA 3WG7C 2LGGA 3ASNC 2CRWA 4IWBA 1A7VA 2EA6A 5G04B 1RKCA 2GA0A 4YT5A 5AC5A 5DS4A 4IC2A 2QIZA 1YZAA 1YLMA 1T5OA 3K33A 1WEPA 3FOPA 2JX0A 2LGLA 3QW1A 2MYSA 1NBBA 3T6BA 3HNKA 3SXMA 3RFYA 2B0HA 3C6WA 1BORA 4OGCA 5A6KA 2WVQA 1IYMA 2IXNA 2M64A 4BEMJ 2R7OA 3LLIA 4AUQB 3U0CA 2IBFA 3MYFA 4UP0A 3M4CA 3W4YA 1WWPA 2E6RA 2Z15A 4ZLCA 5DQTA 3M1CB 3C8GA 5JG6A 2A6EF 3ZPVE 5B1AC 3ZDLA 4J7YA 3MYIA 1YA7O 2L5UA 4JRZA 4JC7A 2IM8A 2LGKA 4YL1A 2ZETC 2KWOA 4C9ZA 1D0YA 1M57C 5E3AA 3B71A 3RH3A 4XPXA 3I4UA 1XZQA 1YARO 3W2WA 5HV9A 2D4UA 1E86A 1H7IA 5A6BA 1ORSC 4CDYA 4Q4ZF 4WABA 5DINA 3NYLA 4U5FE 4CS9C 4MVRA 4E7SA 2OEVA 5KYWB 1YDIA 3T7LA 4PPEA 1LS4A 2WZFA 1K2FA 1C02A 2Q9AA 5JS5A 1RMDA 3QZCA 2AU5A 1FR0A 4RBNA 3KH2A 2EGPA 1E83A 1YAUO 5JRAA 3DE8A 2H8AA 3E9VA 3R7CA 2BC5A 3IQ5A 1RCPA 2HJMA 3QZVA 4XPYA 4GNFA 2LP4A 3ZVRA 2QICA 2HDPA 5SVIB 1Z6UA 4AL0A 2L9JA 2YUCA 2M4EA 4HFFB 4FK5A 2HSBA 3EH2A 5T3WA 1TFKB 2R7UA 1L7CA 3US6A 4QI0A 1UG7A 3JRMO 5LKTA 2Q3TA 4WZ2A 2IQJA 3ZQYA 4O6YA 3UNGC 2R05A 4HE8D 3QTHA 1O87A 1QPUA 5T1DB 1KU2A 1FNTc 4K0DA 1CHCA 4MS2A 2KWJA 5A6AA 3M99A 1Q0MA 2Y69C 1LE2A 3DJUB 4JE9A 3GL6A 3HCSA 4O6MA 1U89A 1OXBA 5K3QA 3LAYA 1LVKA 3EH1A 3LJBA 3GODA 2CSZA 5L0IA 3AJMA 5AC4A 2MA5A 2JUNA 3RPGB 5H1UA 3MX3A 5B3SC 1WESA 3AQBA 5B76A 3NMJA 2HMQA 3EJNA 3EFOA 3GORA 2YVKA 2A69F 3AOUA 2P7VA 2VJFA 2KNHA 1G4WR 1NU9C 2LFFA 3AGTA 3B0VC 2NSGA 3V5XA 4G7OF 3M15A 1GM5A 2R25A 4I3MA 3RVZA 3C7JA 3DZAA 1WEQA 3HLZA 3RF3A 2OKUA 2PF4E 4PR9A 2MT5A 2C2VS 1VYIA 3NRHA 4QDLA 2NUPA 4YBMA 1QZXA 1YYJA 4U5EE 2HS5A 4H9DA 4E0HA 1ORYA 4ER9A 1LDKC 3ZTZA 3U8PA 2CW0F 3DWDA 3M79A 1ZHTA 2XL4A 3SEOA 1JOGA 3LQHA 2BE5F 3KV5A 4EKWA 2RSEB 3O70A 4JVSA 3MHSA 3DM9B 5H1TA 5FB0A 3SXKA 4C7OA 1Y4CA 4CS8A 5B75A 1CPQA 1LI7A 4EBKA 5T3TA 3PMRA 2R7VA 2XLEA 2XL8A 1JRAA 3EGDA 1MMDA 3W8HA 1JMWA 1A0BA 2VCBA 2E6SA 3C63A 3W8IA 5JLIA 4YBTA 1TQGA 2KYUA 4NC3A 2KGIA 5KYYB 1DOWA 2KSFA 2WL8A 3UGOA 1HE1A 1Z23A 2C04A 3U2LA 4FIPA 4BJ6C 3L0IA 1XWHA 3DDTA 2WVOA 2QLAA 5I3LA 4XTKA 1G25A 3B29A 1HYJA 2DSMA 2Y43A 1IW7F 1ZW2A 1YJGA 4PACA 3IPMO 2XOCA 4WGYA 3S27A 4O79A 4DRJB 1NZEA 4AX2A 3RYLA 4YC9A 3SHBA 5AIUA 4N6HA 4DRIB 3K1IC 1FP0A 3DJNB 5CI9A 4W4UA 4NN2A 2IXPA 4WZ3B 3RKOF 5L0FA 3CZ6A 5JUAA 3TD7A 4A49A 2VC9A 4EBBA 1ZHYA 3JT1A 2CSYA 4KNWA 2CKLA 4J7TA 2J45A 4MNDA 4YT2A 3O55A 2J8WA 3RIPA 3LUTB 4CIHA 2ECGA 1SMYF 2KE1A 3S84A 4P9FA 3LVQE 3MDBC 5LKZA 4YL3A 1WGMA 2B0OE 3NG2A 2OJQA 1T01A 5DKAA 2PP4A 1C03A 4QI2A 3SOXA 2YW8A 5LCWB 1TWCA 2HMZA 4PJMA 3JSZA 4C3EA 4OGEA 1R4TA 4MSXA 5K0IA 3DI5A 1RJ9B 4AYCA 2XXAB 2MKEA 4EUKB 1HYIA 4UI9B 3EGXA 2EIJC 2MNZA 3LS0A 3EZHA 1KNYA 2AP3A 5FB1A 4U5DE 4EWCA 3U5MA 2W4BA 3V5ZA 2OU6A 3RQFA 2CNWA 3HNJA 4EIYA 5COMA 2FAPB 3K7DA 2YLGA 2O9XA 2XP0A 2P1AA 3M7KA 2R7XA 1ZBDB 4BJ1A 4C3BA 3VM6A 4YATA 4D4XA 2KFTA 3GV4A 4JCHA 3WHNA 2PFDA 1Z63A 3T6RA 2VJEA 1LI5A 3N9PA 2PUYA 1V54C 2QY9A 2IDAA 1HMDA 1VFYA 2ZXRA 5LKXA 2M6MA 1ZU5A 4LDRA 4G78A 3B0PA 5BQGA 3WODF 4GQHA 3IQCA 2PNOA 4V3LC 1H9GA 3MHHA 1M56C 2F42A 2G3KA 1NLXA 4XEVA 2RR4A 1QLEC 3G4ZA 4YK5A 3LLKA 2ECIA 3TOMA 4B6IA 1BBHA 4HEAJ 2CYDA 3V7OA 5C11A 4U5BE 3U3FA 2F22A 4ULVA 1EI7A 3Q1DA 1F1MA 4W8PA 1U0BB 1RKEB 4DXWA 3JSEO 2Q00A 2EPMX 2NSFA 2EILC 4TKPB 2DYSC 2ZXWC 1OW6A 4WJ0A 2NG1A 1BR1A 4ANJA 4KI2A 3AG1C 2AWYA 2Q7RA 2OCCC 3ZTGA 4MQ9F 4YT4A 1BDJB 2RSDA 3ZPV1 3NKEA 2PX0A 1WE9A 2ECJA 2R7RA 4DBRA 3LEVA 2ZXOA 5GPGB 4AK9A 5G0FA 1WN0A 2W45A 4LJNA 1L3PA 4JJGA 2F6NA 1YA9A 3SNHA 3DD7A 2UUIA 1U6GB 2XS1A 5COGA 1DVPA 1WEEA 1S05A 3LQIA 1Y6DA 4Z0RA 4Z9JA 2C03A 1QKRA 2QE9A 4A0CD 1OCRC 4PTBA 1I5NA 2Q9CA 4CDVA 4JKVA 5FCLA 2H0DA 4JZAA 2BAYA 3LRQA 1ZHXA 4EBJA 3I2DA 4A4AA 3K1IA 4Z9IA 2NUTB 4Q5SF 4CS8C 4KC9A 2Y3DA 4OD4A 3C8ZA 4OD5A 2LXHC 4OIRF 2D8SA 2FSAA 2EPOA 4QF2A 3DQVR 1VOMA 2YVRA 1TR2A 1C17M 1T9KA 5AGFA 2NPUA 1YVIA 5TDRA 4AE4B 3H2UA 3FDQA 4FX5A 3OWTA 4BPMA 2Y1MA 3CSKA 2LCHA 4G0HA 3TJ5A 5A69A 3VK6A 3FVYA 4JIOA 1WOLA 4YBSA 3L1MA 3EHNA 3DE9A 4D4NA 3U5SA 3RQGA 4OIOF 4MW8A 1HW1A 2P61A 4IGGA 2W9YA 3ABMC 4YAXA 5KYXB 1M2VB 5DS5A 1VMAA 2LDRA 3LNRA 1VD4A 2KGGA 5L0GA 4L58A 2Y3GA 1R5ID 5B79A 2IOQA 4IJJA 2KKXA 1SF8A 3TJ6A 4GB0A 1J8MF 3J06A 4H54A 2VPBA 2OEXA 3FAOA 2M85A 4CDAA 1APCA 1Z3IX 4E7ZA 3PURA 4DJ9A 4CS7A 2I8BA 3F47A 4A4CA 3TOLA 4I7CA 2KQ9A 2KU3A 2G3VA 2J9BA 2P0NA 3EB5A 2FUIA 3KV6A 1TWGA 2HKVA 3C8GD 4U9EA 2YL7A 3L8IA 4IRUA 5D1KB 4NTBA 2YWAA 3ZVYA 4MVQA 2JM3A 3B9QA 2D8UA 4YABA 5JT4A 1LM3B 1WGWA 2KWNA 4GNEA 1SYQA 5JP7A 1MM2A 2A6HF 2QNLA 1RXQA 5E3CA 3KYJA 2ZXPA 5F5FA 3HCUA 2L0BA 2HJ3A 3EPVA 3VRCA 2WZGA 1JAFA 1OCCC 2MD8C 1MNEA 1LDJB 2IXMA 3EB6A 3I5PA 4IAQA 1DOVA 3NG1A 4KBLA 4S3OC 5G05B 2G43A 3T9KA 3QVYA 3PCVA 2YRFA 1XWJA 1E4UA 4N06A 3ZQVA 5EYAF 4NY3A 2JMIA 4NTFA 3K6BA 3JZ0A 2YSMA 3FOOA 3U3BA 3IQ6A 4N4WA 2MUMA 2Y3BA 3EG9B 2R02A 2XLWA 2DB4A 2XLOA 4QQ4A 4IARA 3ABLC 3FAJA 5KYWA 2KREA 2VB6A 2M3HA 1H6GA 3S90A 3N2ZB 1K05A 4L7XA 3M63A 3A9CA 3E70C 2J46A 5H9MA 3O10A 4XLPF 3Q6MA 2ICWG 4BEJA 4YN0B 2L81A 1NG1A 3NKDA 1NSGB 1K40A 2XL6A 4JTDB 3SXZA 1JM7B 5HSWA 3EQLF 1JR8A 1WASA 2XM4A 4MVZA 1QQ3A 2J9UA 3MFNA 5SVIA 1TWAA 3MBGA 4H4KC 1TWHA 4I7BA 1JPNA 2YKZA 2HFIA 2IXOA 2LK4A 2MD7B 3HJCA 3PHDA 4YADA 4Z9HA 4LLCA 3PLWA 1AVOB 4R32A 3AQCA 3RVYA 3OA1A 4MTGA 4YJWA 3FM8C 3SZRA 4FO9A 2L6GA 2YL1A 4JEAA 5DLJA 1JOCA 4CBEA 4CJOA 3QVZA 2F6JA 1Z60A 2MNYA 5EGYA 4WZ0A 2J7PA 1M6TA 2WVNA 5TJ5E 5KH9A 3ASOC 4FESA 3CAXA 5L3VA 4E0IA 2OG2A 3GEIA 2A1DD 4O62A 2EGMA 4PJJA 1EKYA 5TBNA 4IAOA 4BJ5A 2OOCA 1YYXA 1N87A 3DAFA 2L75A 1X4UA 1O5HA 5LKUA 4CJGA 4HFKB 1ZU4A 4E18A 5KYUB 1U6HA 1PCXA 3N9MA 2JD3A 5KH7A 2V26A 1WENA 1CGNA 2EPKX 1T1HA 2DI3A 3V43A 2FFHA 1LPEA 2FUUA 5DQZA 2L6HA 2XOZA 3O36A 4IC3A 3X2QC 5IY5C 4G7HF 3N24A 1EQ1A 3Q7LA 1SZIA 4O64A 3K1HA 4RDAA 3TK0A 2YL3A 5F28E 2I15A 1CGME 3FAPB 3ZC4A 4WA6A 1XZPA 4GYTA 2ZPAA 2HSQA 1OQCA 2YEVA 2X0CA 4PJNA 4R2YA 3IQTA 4XWJA 4UDVA 3KKBA 3O7AA 2D5RB 2KIZA 2YREA 1Q0FA 2MHRA 2J0WA 2LAUA 3DM5A 2HV7A 1AUEA 2R7SA 3GEEA 4ZQLA 1VB5A 2YHSA 1RMVA 2HYED 2YYRA 2H7BA 4C3DA 1T6QA 3O39A 4CA1A 3JRTA 3GANA 5KYYA 3LQJA 1WEOA 1D1CA 1N1CA 4FWVA 4U5GA 3ABKC 2EIKC 3UR3C 2MWQA 3IHUA 3U2MA 3KYIA 4I1MA 2KWKA 4V3KC 2LQGA 4K1OA 3ITFA 1FMVA 2IYLD 1VK5A 2OJED 3T9OA 3U5PA 3C5KA 3ZNIA 3FXHA 4NTAA 4BHWA 1O3UA 1ZHWA 2YURA 3G4XA 1WEVA 1BR4A 3LJUX 2W4MA 3NYMA 3NMIA 1MNDA 4XI1A 3LNMB 1FTSA 3HNIA 1WATA 1EA8A 1WEUA 2XM0A 5DS6A 2L7AA 3O34A 3IHPA 3AGUA 2CDQA 3DPLR 1VYXA 1K04A 5SVXA 3S9OA 5CI8A 3RQEA 2VCAA 3GM1A 1MMNA 3LEOA 4UP5A 3U9JA 2CT2A 2QJ0A 4KNVA 2QUPA 3C8GB 3ZTMA 4NCQA 4M63A 5TDWA 2Y3HA 1OKKD 3F46A 4CCGX 3DKAA 3ASLA 3ZYQA 3SP1A 3S0XA 1RJ9A 3TULA 2XXAA 2G62A 2JPUA 1MMAA 3L1XA 3H7HA 4JCZA 1I4ZA 1MQVA 2VCCA 3SOWA 4MVMA 1GQAA 2FGYA 2YLDA 4EHPA
chains in the Genus database with same CATH topology
2J9WA 2XL4A 4U5HA 4LKAA 4W8KA 3SEOA 4I7CA 3LQHA 2BE5F 3KV5A 2KQ9A 2R7TA 2KU3A 2G3VA 1Z5ZA 2YSJA 1PD1A 3O70A 4JVSA 3NDBB 4QF3A 3EB5A 3MHSA 3DM9B 2FUIA 5H1TA 5FB0A 3KV6A 5B78A 4LLBA 1FFTC 5FERA 1TWGA 3EZIA 4C7OA 4CS8A 4LADB 5B75A 4K7BA 5T3TA 4DVYP 3T6JA 3PMRA 5EHHA 2R7VA 4IRUA 5D1KB 3L1ZB 2L43A 1TKNA 3EGDA 2QTVA 2K4DA 1MMDA 3POVA 1WILA 3W8HA 1V87A 3ZVYA 2E6SA 3W8IA 4YBTA 2DGJA 1D0XA 1FBVA 2KR4A 2HV6A 3B9QA 2KYUA 3FL2A 4YABA 2KGIA 3CQZA 3LESA 4A4CA 2J9VA 3SOUA 5KYYB 2WL8A 3UGOA 2LXPC 2ECVA 1WGWA 2KWNA 5B77A 4GNEA 2VPEA 1Z23A 1MM2A 2A6HF 3M62A 2C04A 2H0DB 3HCTA 5E3CA 4FIPA 4BJ6C 3L0IA 3T4RA 5DVWA 2EIMC 2WVOA 2ZXPA 2P6VA 5F5FA 1XWHA 2I50A 2L0BA 3HCUA 4RD9A 3PHF2 3N9OA 1OKKA 2KGOA 2PX3A 5D91A 1X4IA 3KQIA 1FFHA 5I3LA 4XTKA 5D1MB 4A2NB 1G25A 1HYJA 2OXQC 3EPVA 3KL4A 1WEMA 4X0RA 2WZGA 5KYUA 2VASA 1OCCC 2K1JA 2Y43A 1IW7F 3Q6NA 2MD8C 3NYJA 1J8YF 5D1LB 1MNEA 2R7WA 1LDJB 4GNGA 3UMIA 3PUQA 2IXMA 4LK9A 3S27A 4O79A 3EB6A 3I5PA 3X1OA 1NZEA 4AX2A 3RYLA 4A4BA 3JCUQ 3NG1A 4U5CE 4YC9A 4KBLA 3SHBA 4S3OC 5AIUA 3O37A 4PJLA 5G05B 4ZDTA 2G43A 3ZVZB 2H7VC 5TRBA 4Q7CA 4N4FA 3FHDA 1S7ZA 3K1IC 1FP0A 3DJNB 4B86C 4CSAC 1E4UA 5CI9A 4N06A 5EYAF 4CS7A 2CNWD 4NY3A 4NN2A 2IXPA 4W4UA 4WZ3B 3RKOF 2WB7A 3CZ6A 2JMIA 2LRIC 3TD7A 3K6BA 2JMJA 4LLEA 4A49A 3DXJF 4EBBA 2LSEA 4LACB 2YSMA 1ZHYA 3JT1A 5KYNA 2CSYA 4BJ5C 2MUMA 2Y3BA 4KNWA 2CKLA 2ECTA 1D1AA 2J45A 4MNDA 3JYHA 3L34A 4YT2A 2PNXA 2EODA 2R7QA 3S29A 3EG9B 2JMDA 3RIPA 2XEUA 1Z6AA 3DAGA 4CIHA 4ZLDA 1WEWA 2ECGA 1SMYF 2KE1A 3SYNA 3RPGC 2Y39A 5LKZA 1IZMA 1VYKA 4JURI 2V3CC 2E87A 3ABLC 3FAJA 5KYWA 1WGMA 2KREA 2VB6A 3ZG1A 2M3HA 3U5OA 3NG2A 1WFKA 4FJCA 2LGVA 5D92A 2WZLA 2G6QA 3EFOB 5DKAA 4I1OB 3N2ZB 4L7XA 2PP4A 1X4JA 3M63A 2VJFB 3E70C 4QI2A 4F52B 3SOXA 2YW8A 5LCWB 4BJTA 2J46A 1TWCA 5H9MA 4XLPF 1V55C 1NU7D 2NAAA 3Q6MA 4BEJA 4PJMA 3KMIA 3JSZA 4YN0B 2KJGA 4JJFA 2L81A 4C3EA 4PFOA 1NG1A 1MMGA 2K17A 2VH3A 3NKDA 4MSXA 3U5NA 1JM7B 1RJ9B 3VAYA 2VP7A 4AYCA 2XXAB 3AG4C 2DX8A 5HSWA 2VNFA 4AP4A 4JW1A 1HYIA 4UI9B 3Q7GA 3DMDA 3IEEA 3EGXA 2EIJC 1F62A 2NUPB 3EQLF 2M1RA 1WIMA 2MNZA 3LS0A 2CGEA 3EZHA 2B0JA 3W2VA 3N0TA 2MIQA 2J9UA 2YHNA 3O33A 4G7ZF 4BJ6A 5FB1A 1TWAA 3O35A 4H4KC 1TWHA 4P6IC 4U5DE 5F5HA 1JPNA 4I7BA 1PD0A 2DYRC 4EWCA 2W4BA 3U5MA 2IXOA 2MD7B 3PHDA 3HJCA 4YADA 2CNWA 2NUTA 4LLCA 3WG7C 4J32B 3K7DA 2LGGA 4O7GA 3AQCA 3ASNC 3OA1A 5L3QA 4YJWA 4C7OB 4IWBA 3SZRA 4FO9A 5DLJA 1JOCA 2XB1A 2EA6A 3AG3C 5G04B 3LS1A 4CBEA 2O9XA 4YT5A 2R7XA 1ZBDB 5DS4A 3EGDB 4IC2A 1ST6A 4BJ1A 2QIZA 3I5QA 4C3BA 2F6JA 2AN6A 1Z60A 2MNYA 4YATA 3K33A 2KFTA 5EGYA 4WZ0A 2J7PA 1WEPA 2WVNA 4CSAA 5KH9A 3ASOC 2VPDA 3GV4A 4JCHA 3O6XA 4FESA 2PFDA 1Z63A 2G45A 3T6RA 4I7DA 2LGLA 5L3VA 4AE4A 2MYSA 2VJEA 2OG2A 3T6BA 1V54C 2A1DD 2QY9A 2IDAA 3RFYA 1VFYA 2PUYA 3N9PA 2ZXRA 3C6WA 5LKXA 1BORA 4PJJA 2M6MA 5TBNA 1ZU5A 4IAOA 3ZIBA 4BJ5A 1N87A 3DAFA 4OIPF 3ECSA 2L75A 4GEHA 1X4UA 2WVQA 1M2OA 1O5HA 3B0PA 1LS1A 1IYMA 3HTKC 5LKUA 3UGPA 3WODF 2IXNA 2YQMA 4BBQA 2R7OA 3LLIA 4HFKB 4AUQB 1ZU4A 4UP0A 5KYUB 3N9LA 1G8XA 4V3LC 2X51A 3MHHA 2A68F 5KYXA 1MM3A 1M56C 2F42A 1PCXA 2G3KA 1M2VA 3N9MA 2JD3A 5KH7A 2V26A 2E6RA 1WENA 2Z15A 4ZLCA 5DQTA 3M1CB 5JG6A 2A6EF 1QLEC 3QMKA 3ZPVE 5B1AC 3LLKA 2YQLA 2ECIA 1T1HA 4B6IA 3V43A 5B8DA 2FFHA 2FUUA 4HEAJ 3V7OA 5C11A 4U5BE 5DQZA 2L80A 3O36A 4IC3A 4DVZA 2L5UA 2LGKA 2Q9BA 2YHOA 3X2QC 5IY5C 2JRJA 4G7HF 3N24A 2ECWA 2ZETC 3Q7LA 2KWOA 4C9ZA 1D0YA 1M57C 5E3AA 1SZIA 4BG0A 3K66A 3UMKA 4O64A 2YU4A 5H1VA 3RH3A 3K1HA 4RDAA 4X3GA 2C2LA 3S28A 2CKLB 2KW3C 4OINF 3H65A 3I4UA 2EILC 4TKPB 2XRHA 2DYSC 2ZXWC 4WJ0A 1FMWA 3W2WA 2GFHA 3ZC4A 4WA6A 2NG1A 2ZPAA 4GYTA 1BR1A 4ANJA 5E2QA 4KI2A 4GNDA 2YEVA 3AG1C 2RI7A 4PJNA 2VPGA 2OCCC 4R2YA 4Q4ZF 4MQ9F 3ZTGA 4YT4A 5DINA 3NYLA 4U5FE 4XWJA 4CS9C 2RSDA 3NKEA 3KKBA 3ZPV1 2PX0A 4E7SA 5KYWB 1WE9A 2ECJA 3O7AA 2D5RB 2R7RA 4DBRA 4DBQA 3LEVA 3T7LA 2ZXOA 2KIZA 2YREA 3N9NA 2J0WA 4AK9A 3DM5A 4PPEA 4I44A 5G0FA 2WZFA 1K2FA 4LERA 2MA6A 2HV7A 2Q9AA 2W45A 4LJNA 2R7SA 1RMDA 4JJGA 4ZQLA 2F6NA 3QZCA 3DD7A 3SNHA 2YHSA 4DOZA 2HYED 4B7YC 4RBNA 3KH2A 2YYRA 2H7BA 1U6GB 2EGPA 4C3DA 5C13A 3O39A 1DVPA 3ZSUA 4CA1A 4AYCB 3JRTA 3GANA 1WEEA 3E9VA 4O6NA 5KYYA 3LQJA 1WEOA 1D1CA 3LQIA 3RTRB 1N1CA 2C03A 4F4BA 4FWVA 4A0CD 3EGXB 1OCRC 4PTBA 3QZVA 2Q9CA 4GNFA 5FCLA 2LN0A 2H0DA 4U5GA 3UMHA 4JZAA 3ZVRA 2K16A 3ABKC 2BAYA 2QICA 2EIKC 2HDPA 3UR3C 2MWQA 3VYWA 4P5OB 1Z6UA 3LRQA 1ZHZA 1ZHXA 4I1MA 2KWKA 3I2DA 4V3KC 2L9JA 2YUCA 2M4EA 4HFFB 4FK5A 3EH2A 5T3WA 4YWQA 3ITFA 1FMVA 2R7UA 2NUTB 1W2WA 3MLGA 2IYLD 1VK5A 4Q5SF 4QI0A 3U5PA 4CS8C 3C5KA 3ZNIA 4KC9A 2Y3DA 4OD4A 4OD5A 2LXHC 4OIRF 4R8PK 5E33A 5LKTA 2Q3TA 4WZ2A 2D8SA 2FSAA 3OEOA 4Q6FA 4BHWA 4ULWA 5AITA 4O6YA 4QF2A 1ZHWA 2YURA 1WEVA 4OIQF 1BR4A 3UNGC 3DQVR 4HE8D 3EHMA 4S3OB 2W4MA 3NYMA 5B1BC 1VOMA 1O87A 5T1DB 1TR2A 1BR2A 3KNVA 1KU2A 3AG2C 1MNDA 1LKXA 4XI1A 4K0DA 1FTSA 1WEUA 4N3WA 1CHCA 4AVXA 5DS6A 3B0UX 2Y1NA 5TDRA 4J30B 4AE4B 3O34A 3IHPA 2KWJA 3FDQA 2VJEB 2CDQA 4FX5A 3M99A 3DPLR 2Y69C 1OCOC 3OWTA 1VYXA 2Y1MA 1Z2QA 3CSKA 3DJUB 1D0ZA 2UZGA 4G0HA 3GL6A 4PFPA 3HCSA 4O6MA 5CI8A 3VK6A 3FVYA 4YBSA 3LAYA 3EG9A 1MMNA 3EHNA 5J3XA 1LVKA 3EH1A 4OIOF 3LJBA 3GODA 2CSZA 2EINC 2MA5A 5FEYA 3RPGB 5H1UA 3MX3A 4XLNF 2W9YA 5B3SC 1WESA 3AQBA 3ABMC 4UP5A 4CS9A 4YAXA 2CT2A 2QJ0A 4PK4A 5KYXB 5B76A 1OCZC 2XSEA 4KNVA 1M2VB 5DS5A 1VMAA 3EJNA 3EFOA 2A69F 2P7VA 2LDRA 3LNRA 2VJFA 3N9QA 2KNHA 1NU9C 1VD4A 3B0VC 2KGGA 4L58A 4G7OF 4M63A 2YT5A 5TDWA 2Y3GA 2Y3HA 1OKKD 3F46A 4I3MA 4MVTA 5B79A 1JPJA 2IOQA 2J7PD 3DZAA 4CCGX 1WEQA 4IJJA 3HLZA 1ZYRF 3ASLA 1SF8A 3ZYQA 2PF4E 4ZUXU 3SP1A 2ECNA 2MT5A 3S0XA 1JM7A 1RJ9A 5TABA 2XXAA 5BUOA 4GB0A 2C2VS 1VYIA 1J8MF 2G62A 1MMAA 3L11A 4R7EA 3L1XA 2VPBA 4YT8A 2H7OA 3NRHA 2J0XA 4QDLA 2NUPA 4YBMA 1QZXA 2M85A 4U5EE 3SOWA 5KH3A 2LV9A 1LDKC 1Z3IX 4E7ZA 2FGYA 3PURA 2YZSA 2CW0F 2I8BA 2LQ6A 3F47A 1ZHTA 1D1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKA A;  4I7C A;  3LQH A;  3KV5 A;  2KU3 A;  2YSJ A;  3O70 A;  4QF3 A;  3EB5 A;  3MHS A;  2FUI A;  5H1T A;  5FB0 A;  3KV6 A;  5B78 A;  4LLB A;  5FER A;  4LAD B;  5B75 A;  5D1K B;  3L1Z B;  2L43 A;  2K4D A;  1WIL A;  1V87 A;  3ZVY A;  2E6S A;  4YBT A;  1FBV A;  2KR4 A;  2KYU A;  3FL2 A;  4YAB A;  2KGI A;  3SOU A;  2LXP C;  2ECV A;  2KWN A;  5B77 A;  4GNE A;  2VPE A;  1MM2 A;  3M62 A;  2H0D B;  3HCT A;  4FIP A;  1XWH A;  3HCU A;  2I50 A;  2L0B A;  3N9O A;  3KQI A;  1X4I A;  5I3L A;  1G25 A;  5D1M B;  1HYJ A;  2OXQ C;  1WEM A;  2Y43 A;  2K1J A;  2MD8 C;  5D1L B;  1LDJ B;  4GNG A;  3PUQ A;  4LK9 A;  3EB6 A;  4A4B A;  4YC9 A;  3SHB A;  4S3O C;  5AIU A;  3O37 A;  5G05 B;  4ZDT A;  3ZVZ B;  2G43 A;  5TRB A;  4N4F A;  1FP0 A;  4B86 C;  1E4U A;  5EYA F;  4W4U A;  4NN2 A;  4WZ3 B;  2LRI C;  2JMI A;  2JMJ A;  4A49 A;  2YSM A;  2CSY A;  2MUM A;  2ECT A;  2CKL A;  2PNX A;  2EOD A;  2JMD A;  2XEU A;  1WEW A;  2ECG A;  2KE1 A;  3RPG C;  5LKZ A;  1WGM A;  2KRE A;  2M3H A;  3U5O A;  3NG2 A;  1WFK A;  4FJC A;  2LGV A;  2G6Q A;  5DKA A;  4L7X A;  1X4J A;  3M63 A;  2VJF B;  4F52 B;  3SOX A;  2YW8 A;  5LCW B;  5H9M A;  2NAA A;  2K17 A;  4MSX A;  3U5N A;  1JM7 B;  4AYC A;  2VP7 A;  2DX8 A;  2VNF A;  4AP4 A;  1HYI A;  4UI9 B;  1F62 A;  2M1R A;  1WIM A;  2MNZ A;  2MIQ A;  2YHN A;  3O33 A;  5FB1 A;  3O35 A;  4I7B A;  3U5M A;  3PHD A;  2MD7 B;  4YAD A;  2LGG A;  4FO9 A;  1JOC A;  2XB1 A;  2EA6 A;  5G04 B;  1ZBD B;  4IC2 A;  2QIZ A;  2F6J A;  2AN6 A;  1Z60 A;  2MNY A;  4YAT A;  2KFT A;  4WZ0 A;  1WEP A;  5KH9 A;  2VPD A;  3GV4 A;  3T6R A;  2G45 A;  4I7D A;  2LGL A;  2VJE A;  3N9P A;  2PUY A;  2IDA A;  1VFY A;  3C6W A;  5LKX A;  1BOR A;  2M6M A;  5TBN A;  1N87 A;  2L75 A;  1X4U A;  1IYM A;  3HTK C;  5LKU A;  2YQM A;  4BBQ A;  4AUQ B;  4UP0 A;  3N9L A;  4V3L C;  3MHH A;  1MM3 A;  2F42 A;  3N9M A;  5KH7 A;  2E6R A;  1WEN A;  5JG6 A;  3ZPV E;  2YQL A;  2ECI A;  1T1H A;  3V43 A;  5B8D A;  2FUU A;  5C11 A;  2L80 A;  3O36 A;  4IC3 A;  2L5U A;  2LGK A;  2YHO A;  2JRJ A;  2ECW A;  2ZET C;  2KWO A;  4C9Z A;  4O64 A;  2YU4 A;  5H1V A;  4X3G A;  2C2L A;  2CKL B;  4TKP B;  4WA6 A;  4GND A;  2RI7 A;  2VPG A;  4R2Y A;  3ZTG A;  5DIN A;  2RSD A;  3ZPV 1;  1WE9 A;  2ECJ A;  3O7A A;  3T7L A;  2KIZ A;  2YRE A;  3N9N A;  4PPE A;  5G0F A;  1K2F A;  2MA6 A;  4LJN A;  1RMD A;  4ZQL A;  2F6N A;  4B7Y C;  2HYE D;  2YYR A;  1U6G B;  2EGP A;  5C13 A;  1DVP A;  4CA1 A;  4AYC B;  1WEE A;  3RTR B;  3LQJ A;  1WEO A;  3LQI A;  4A0C D;  4PTB A;  3QZV A;  4GNF A;  2LN0 A;  2H0D A;  2K16 A;  2QIC A;  2BAY A;  2HDP A;  4P5O B;  1Z6U A;  3LRQ A;  2KWK A;  3I2D A;  4V3K C;  2YUC A;  4FK5 A;  3U5P A;  3C5K A;  3ZNI A;  2LXH C;  4R8P K;  5LKT A;  4WZ2 A;  2D8S A;  2FSA A;  4Q6F A;  4BHW A;  5AIT A;  4QF2 A;  2YUR A;  1WEV A;  3DQV R;  4S3O B;  3KNV A;  4XI1 A;  1WEU A;  4N3W A;  1CHC A;  4AVX A;  2Y1N A;  5TDR A;  3O34 A;  3IHP A;  2KWJ A;  2VJE B;  3M99 A;  3DPL R;  1VYX A;  2Y1M A;  1Z2Q A;  2UZG A;  3GL6 A;  3HCS A;  3VK6 A;  4YBS A;  5J3X A;  2CSZ A;  2MA5 A;  5FEY A;  3RPG B;  5H1U A;  1WES A;  4UP5 A;  4YAX A;  2CT2 A;  2QJ0 A;  5B76 A;  2LDR A;  2VJF A;  3N9Q A;  1VD4 A;  2KGG A;  4L58 A;  2YT5 A;  5TDW A;  4MVT A;  5B79 A;  4CCG X;  1WEQ A;  3ASL A;  3ZYQ A;  4ZUX U;  2MT5 A;  2ECN A;  1JM7 A;  5TAB A;  4GB0 A;  2C2V S;  3L11 A;  4R7E A;  3L1X A;  2VPB A;  4YBM A;  2M85 A;  3SOW A;  5KH3 A;  2LV9 A;  1LDK C;  3PUR A;  2LQ6 A;  4A4C A; 
#chains in the Genus database with same CATH topology
 2J9W A;  4LKA A;  2R7T A;  1DCQ A;  2YSJ A;  1Z5Z A;  3NDB B;  2HZ8 A;  4MVU A;  4LLB A;  3LVR E;  3RW0 A;  4LAD B;  2CON A;  3T6J A;  4LDQ A;  2L43 A;  2QTV A;  2K4D A;  3A11 A;  1WIL A;  1V87 A;  3NMK A;  1G5Z A;  2DGJ A;  1D0X A;  3FL2 A;  3LES A;  4XPW A;  5B77 A;  5BQI A;  2VPE A;  3GWN A;  3M4B A;  3HCT A;  1T6U A;  2R03 A;  5DVW A;  2EIM C;  3BRJ A;  4RD9 A;  3PHF 2;  5D91 A;  3GEH A;  1X4I A;  3KQI A;  1FFH A;  4A2N B;  3KL4 A;  1WEM A;  4X0R A;  2VAS A;  3NYJ A;  1J8Y F;  5D1L B;  2R7W A;  2L7P A;  4GNG A;  3UMI A;  3PUQ A;  2EXU A;  4XEF A;  3X1O A;  3TQO A;  4A4B A;  4U5C E;  1Z7Q c;  3O37 A;  2YLI A;  3ZVZ B;  2H7V C;  4N4F A;  3FHD A;  1RKE A;  2FD4 A;  2WB7 A;  2LRI C;  2JMJ A;  4LLE A;  2LSE A;  2XLH A;  4BJ5 C;  3V5Y A;  2PBE A;  3H2V A;  2ECT A;  1D1A A;  1OXK A;  3JYH A;  3L34 A;  2PNX A;  2JMD A;  2YQY A;  1Z6A A;  3DAG A;  4ZLD A;  3RPG C;  1HMO A;  1VYK A;  4FJC A;  2LGV A;  2WZL A;  1Q0K A;  3EFO B;  1OR2 A;  4I1O B;  2VJF B;  4F52 B;  2CRR A;  4BJT A;  1V55 C;  2NAA A;  3U9M A;  1MMG A;  2K17 A;  5A6J A;  2GWW A;  2LIG A;  3JYY A;  2DX8 A;  4AP4 A;  4JW1 A;  4WGZ A;  3O47 A;  2P57 A;  2NUP B;  2M1R A;  3JTL O;  1WIM A;  1TFO B;  2A0U A;  2CGE A;  2B0J A;  2MIQ A;  4P6I C;  5F5H A;  1PD0 A;  3CEX A;  2NUT A;  4J32 B;  4O7G A;  5L3Q A;  1FAP B;  4C7O B;  4YL0 A;  2LFD A;  1I4Y A;  2XB1 A;  3AG3 C;  3LS1 A;  1SR2 A;  5A6B D;  1Q0D A;  3EGD B;  1ST6 A;  1VLT A;  3I5Q A;  2AN6 A;  1A7D A;  4NQF A;  1VTM P;  4CSA A;  3G50 A;  2VPD A;  3O6X A;  2G45 A;  4I7D A;  4AE4 A;  5L0C A;  1H9T A;  3ZIB A;  1HY5 A;  4OIP F;  3ECS A;  4GEH A;  1M2O A;  1LS1 A;  3DWW A;  3HTK C;  3UGP A;  2YQM A;  4BBQ A;  3N9L A;  1G8X A;  1E84 A;  2X51 A;  2A68 F;  5KYX A;  1MM3 A;  1M2V A;  2ZD9 A;  3GWL A;  3GM2 A;  3QMK A;  2YQL A;  1OW8 A;  5B8D A;  1T6I A;  2OWA A;  2L80 A;  4DVZ A;  3WAQ A;  1E85 A;  1OR3 A;  3BEH A;  2GAQ A;  2Q9B A;  2YHO A;  2JRJ A;  2ECW A;  2XLM A;  4BG0 A;  3K66 A;  3UMK A;  3SUB A;  2YU4 A;  5H1V A;  4N6C A;  4X3G A;  2C2L A;  3S28 A;  2CKL B;  2KW3 C;  4OIN F;  3H65 A;  4P9T A;  2TMV P;  4XQ1 A;  2XRH A;  1FMW A;  1CPR A;  2GFH A;  4GND A;  5E2Q A;  2RI7 A;  2VPG A;  1UFB A;  5L0J A;  4DBQ A;  3N9N A;  4I44 A;  4E17 A;  4LER A;  1NFN A;  2MA6 A;  2KYH A;  3C62 A;  2A0B A;  5EK0 A;  4DOZ A;  2XS8 A;  4B7Y C;  4JTA B;  2DJA A;  4IB4 A;  5C13 A;  2KK1 A;  3ZSU A;  2KKY A;  4AYC B;  4O6N A;  3RTR B;  5FZT A;  4F4B A;  3EGX B;  2LN0 A;  3UMH A;  2K16 A;  3ZWI A;  3SXY A;  4P5O B;  3VYW A;  1G4U S;  1ZHZ A;  3KDE C;  4F1P A;  4YWQ A;  1CGO A;  1W2W A;  3MLG A;  3HNL A;  1A7E A;  1GGQ A;  2OQM A;  4R8P K;  5E33 A;  3OEO A;  4Q6F A;  4ULW A;  5AIT A;  1LE4 A;  4S3O B;  4OIQ F;  3EHM A;  5B1B C;  1BR2 A;  3KNV A;  3AG2 C;  1LKX A;  4N3W A;  1YZC A;  2EPL X;  3B0U X;  2XLV A;  4AVX A;  3T6G B;  2Y1N A;  1AEP A;  4J30 B;  3KPH A;  2VJE B;  1OCO C;  1ZZP A;  1Z2Q A;  2R9R B;  2M13 A;  1D0Z A;  3FMS A;  2UZG A;  3U8V A;  4PFP A;  3FJU B;  3EG9 A;  3R2P A;  4MVS A;  5J3X A;  2EIN C;  4ONS A;  5CIV A;  5FEY A;  4XLN F;  3QW0 A;  4CS9 A;  4PK4 A;  1BZ4 A;  1OCZ C;  2XSE A;  1NFO A;  3N9Q A;  2YT5 A;  1OW7 A;  2HUJ A;  4MVT A;  4L6R A;  1JPJ A;  2J7P D;  1ZW3 A;  1ZVZ A;  1ZYR F;  1V4A A;  4ZUX U;  4JTC B;  2ECN A;  1JM7 A;  5TAB A;  5BUO A;  3E2D A;  3L11 A;  2GDC A;  4R7E A;  4YT8 A;  2H7O A;  2J0X A;  5KH3 A;  2LV9 A;  2AVK A;  2YZS A;  2BL2 A;  2LQ6 A;  5JSL A;  1D1B A;  2Q4F A;  4U5H A;  4U9D A;  4W8K A;  2AWC A;  2ETS A;  1PD1 A;  1V74 B;  4QF3 A;  2EPN A;  5B78 A;  1VLS A;  5COF A;  1FFT C;  5FER A;  3EZI A;  4K7B A;  4CIP A;  4DVY P;  5EHH A;  3ATP A;  3L1Z B;  1TKN A;  3POV A;  256B A;  4CX9 A;  3FAN A;  1FBV A;  2KR4 A;  2HV6 A;  3CQZ A;  2J9V A;  3SOU A;  2LXP C;  2ECV A;  2LD6 A;  3M62 A;  2H0D B;  3T4R A;  2P6V A;  2I50 A;  3PDM P;  1OKK A;  2KGO A;  2PX3 A;  2RD9 A;  1B68 A;  1QSP A;  1MBM A;  3N9O A;  4AL1 A;  5D1M B;  2OXQ C;  5KYU A;  2K1J A;  3Q6N A;  2ASR A;  4LK9 A;  2XOY A;  3HKK A;  3JCU Q;  4ZDT A;  4PJL A;  1HE9 A;  4DRH B;  5TRB A;  4Q7C A;  5BQH A;  3C18 A;  1S7Z A;  3JUE A;  4B86 C;  4CSA C;  5SVY A;  2CNW D;  2UUH A;  1Q0G A;  5JVE A;  1A41 A;  2E61 A;  3DXJ F;  4LAC B;  4MVO A;  5KYN A;  1E2X A;  3L8J A;  2L6F A;  1HW2 A;  2EOD A;  2R7Q A;  1LIH A;  3S29 A;  2XEU A;  5L0H A;  1WEW A;  3SYN A;  2Y39 A;  1IZM A;  4JUR I;  2V3C C;  2CSV A;  2FFW A;  2E87 A;  3ZG1 A;  4MTF A;  3U5O A;  2XLD A;  3VF0 A;  1PV3 A;  1WFK A;  5D92 A;  2G6Q A;  2CCY A;  1WTY A;  1X4J A;  4XEK A;  4Z0O A;  1NU7 D;  3GM3 A;  1KTM A;  3KMI A;  1GS9 A;  2KJG A;  4JJF A;  4PFO A;  5B3I A;  3LDY A;  2YL0 A;  2VH3 A;  3U5N A;  3VAY A;  2VP7 A;  2VNF A;  3AG4 C;  3Q7G A;  3DMD A;  3IEE A;  1F62 A;  3FEH A;  1QVX A;  3W2V A;  4FAP B;  3N0T A;  4MW3 A;  2YHN A;  4MTO A;  3O33 A;  4G7Z F;  4BJ6 A;  3O35 A;  2DYR C;  1ORJ A;  4JEB A;  5L0D A;  2KC3 A;  4LDK A;  3WG7 C;  2LGG A;  3ASN C;  2CRW A;  4IWB A;  1A7V A;  2EA6 A;  5G04 B;  1RKC A;  2GA0 A;  4YT5 A;  5AC5 A;  5DS4 A;  4IC2 A;  2QIZ A;  1YZA A;  1YLM A;  1T5O A;  3K33 A;  1WEP A;  3FOP A;  2JX0 A;  2LGL A;  3QW1 A;  2MYS A;  1NBB A;  3T6B A;  3HNK A;  3SXM A;  3RFY A;  2B0H A;  3C6W A;  1BOR A;  4OGC A;  5A6K A;  2WVQ A;  1IYM A;  2IXN A;  2M64 A;  4BEM J;  2R7O A;  3LLI A;  4AUQ B;  3U0C A;  2IBF A;  3MYF A;  4UP0 A;  3M4C A;  3W4Y A;  1WWP A;  2E6R A;  2Z15 A;  4ZLC A;  5DQT A;  3M1C B;  3C8G A;  5JG6 A;  2A6E F;  3ZPV E;  5B1A C;  3ZDL A;  4J7Y A;  3MYI A;  1YA7 O;  2L5U A;  4JRZ A;  4JC7 A;  2IM8 A;  2LGK A;  4YL1 A;  2ZET C;  2KWO A;  4C9Z A;  1D0Y A;  1M57 C;  5E3A A;  3B71 A;  3RH3 A;  4XPX A;  3I4U A;  1XZQ A;  1YAR O;  3W2W A;  5HV9 A;  2D4U A;  1E86 A;  1H7I A;  5A6B A;  1ORS C;  4CDY A;  4Q4Z F;  4WAB A;  5DIN A;  3NYL A;  4U5F E;  4CS9 C;  4MVR A;  4E7S A;  2OEV A;  5KYW B;  1YDI A;  3T7L A;  4PPE A;  1LS4 A;  2WZF A;  1K2F A;  1C02 A;  2Q9A A;  5JS5 A;  1RMD A;  3QZC A;  2AU5 A;  1FR0 A;  4RBN A;  3KH2 A;  2EGP A;  1E83 A;  1YAU O;  5JRA A;  3DE8 A;  2H8A A;  3E9V A;  3R7C A;  2BC5 A;  3IQ5 A;  1RCP A;  2HJM A;  3QZV A;  4XPY A;  4GNF A;  2LP4 A;  3ZVR A;  2QIC A;  2HDP A;  5SVI B;  1Z6U A;  4AL0 A;  2L9J A;  2YUC A;  2M4E A;  4HFF B;  4FK5 A;  2HSB A;  3EH2 A;  5T3W A;  1TFK B;  2R7U A;  1L7C A;  3US6 A;  4QI0 A;  1UG7 A;  3JRM O;  5LKT A;  2Q3T A;  4WZ2 A;  2IQJ A;  3ZQY A;  4O6Y A;  3UNG C;  2R05 A;  4HE8 D;  3QTH A;  1O87 A;  1QPU A;  5T1D B;  1KU2 A;  1FNT c;  4K0D A;  1CHC A;  4MS2 A;  2KWJ A;  5A6A A;  3M99 A;  1Q0M A;  2Y69 C;  1LE2 A;  3DJU B;  4JE9 A;  3GL6 A;  3HCS A;  4O6M A;  1U89 A;  1OXB A;  5K3Q A;  3LAY A;  1LVK A;  3EH1 A;  3LJB A;  3GOD A;  2CSZ A;  5L0I A;  3AJM A;  5AC4 A;  2MA5 A;  2JUN A;  3RPG B;  5H1U A;  3MX3 A;  5B3S C;  1WES A;  3AQB A;  5B76 A;  3NMJ A;  2HMQ A;  3EJN A;  3EFO A;  3GOR A;  2YVK A;  2A69 F;  3AOU A;  2P7V A;  2VJF A;  2KNH A;  1G4W R;  1NU9 C;  2LFF A;  3AGT A;  3B0V C;  2NSG A;  3V5X A;  4G7O F;  3M15 A;  1GM5 A;  2R25 A;  4I3M A;  3RVZ A;  3C7J A;  3DZA A;  1WEQ A;  3HLZ A;  3RF3 A;  2OKU A;  2PF4 E;  4PR9 A;  2MT5 A;  2C2V S;  1VYI A;  3NRH A;  4QDL A;  2NUP A;  4YBM A;  1QZX A;  1YYJ A;  4U5E E;  2HS5 A;  4H9D A;  4E0H A;  1ORY A;  4ER9 A;  1LDK C;  3ZTZ A;  3U8P A;  2CW0 F;  3DWD A;  3M79 A;  1ZHT A;  2XL4 A;  3SEO A;  1JOG A;  3LQH A;  2BE5 F;  3KV5 A;  4EKW A;  2RSE B;  3O70 A;  4JVS A;  3MHS A;  3DM9 B;  5H1T A;  5FB0 A;  3SXK A;  4C7O A;  1Y4C A;  4CS8 A;  5B75 A;  1CPQ A;  1LI7 A;  4EBK A;  5T3T A;  3PMR A;  2R7V A;  2XLE A;  2XL8 A;  1JRA A;  3EGD A;  1MMD A;  3W8H A;  1JMW A;  1A0B A;  2VCB A;  2E6S A;  3C63 A;  3W8I A;  5JLI A;  4YBT A;  1TQG A;  2KYU A;  4NC3 A;  2KGI A;  5KYY B;  1DOW A;  2KSF A;  2WL8 A;  3UGO A;  1HE1 A;  1Z23 A;  2C04 A;  3U2L A;  4FIP A;  4BJ6 C;  3L0I A;  1XWH A;  3DDT A;  2WVO A;  2QLA A;  5I3L A;  4XTK A;  1G25 A;  3B29 A;  1HYJ A;  2DSM A;  2Y43 A;  1IW7 F;  1ZW2 A;  1YJG A;  4PAC A;  3IPM O;  2XOC A;  4WGY A;  3S27 A;  4O79 A;  4DRJ B;  1NZE A;  4AX2 A;  3RYL A;  4YC9 A;  3SHB A;  5AIU A;  4N6H A;  4DRI B;  3K1I C;  1FP0 A;  3DJN B;  5CI9 A;  4W4U A;  4NN2 A;  2IXP A;  4WZ3 B;  3RKO F;  5L0F A;  3CZ6 A;  5JUA A;  3TD7 A;  4A49 A;  2VC9 A;  4EBB A;  1ZHY A;  3JT1 A;  2CSY A;  4KNW A;  2CKL A;  4J7T A;  2J45 A;  4MND A;  4YT2 A;  3O55 A;  2J8W A;  3RIP A;  3LUT B;  4CIH A;  2ECG A;  1SMY F;  2KE1 A;  3S84 A;  4P9F A;  3LVQ E;  3MDB C;  5LKZ A;  4YL3 A;  1WGM A;  2B0O E;  3NG2 A;  2OJQ A;  1T01 A;  5DKA A;  2PP4 A;  1C03 A;  4QI2 A;  3SOX A;  2YW8 A;  5LCW B;  1TWC A;  2HMZ A;  4PJM A;  3JSZ A;  4C3E A;  4OGE A;  1R4T A;  4MSX A;  5K0I A;  3DI5 A;  1RJ9 B;  4AYC A;  2XXA B;  2MKE A;  4EUK B;  1HYI A;  4UI9 B;  3EGX A;  2EIJ C;  2MNZ A;  3LS0 A;  3EZH A;  1KNY A;  2AP3 A;  5FB1 A;  4U5D E;  4EWC A;  3U5M A;  2W4B A;  3V5Z A;  2OU6 A;  3RQF A;  2CNW A;  3HNJ A;  4EIY A;  5COM A;  2FAP B;  3K7D A;  2YLG A;  2O9X A;  2XP0 A;  2P1A A;  3M7K A;  2R7X A;  1ZBD B;  4BJ1 A;  4C3B A;  3VM6 A;  4YAT A;  4D4X A;  2KFT A;  3GV4 A;  4JCH A;  3WHN A;  2PFD A;  1Z63 A;  3T6R A;  2VJE A;  1LI5 A;  3N9P A;  2PUY A;  1V54 C;  2QY9 A;  2IDA A;  1HMD A;  1VFY A;  2ZXR A;  5LKX A;  2M6M A;  1ZU5 A;  4LDR A;  4G78 A;  3B0P A;  5BQG A;  3WOD F;  4GQH A;  3IQC A;  2PNO A;  4V3L C;  1H9G A;  3MHH A;  1M56 C;  2F42 A;  2G3K A;  1NLX A;  4XEV A;  2RR4 A;  1QLE C;  3G4Z A;  4YK5 A;  3LLK A;  2ECI A;  3TOM A;  4B6I A;  1BBH A;  4HEA J;  2CYD A;  3V7O A;  5C11 A;  4U5B E;  3U3F A;  2F22 A;  4ULV A;  1EI7 A;  3Q1D A;  1F1M A;  4W8P A;  1U0B B;  1RKE B;  4DXW A;  3JSE O;  2Q00 A;  2EPM X;  2NSF A;  2EIL C;  4TKP B;  2DYS C;  2ZXW C;  1OW6 A;  4WJ0 A;  2NG1 A;  1BR1 A;  4ANJ A;  4KI2 A;  3AG1 C;  2AWY A;  2Q7R A;  2OCC C;  3ZTG A;  4MQ9 F;  4YT4 A;  1BDJ B;  2RSD A;  3ZPV 1;  3NKE A;  2PX0 A;  1WE9 A;  2ECJ A;  2R7R A;  4DBR A;  3LEV A;  2ZXO A;  5GPG B;  4AK9 A;  5G0F A;  1WN0 A;  2W45 A;  4LJN A;  1L3P A;  4JJG A;  2F6N A;  1YA9 A;  3SNH A;  3DD7 A;  2UUI A;  1U6G B;  2XS1 A;  5COG A;  1DVP A;  1WEE A;  1S05 A;  3LQI A;  1Y6D A;  4Z0R A;  4Z9J A;  2C03 A;  1QKR A;  2QE9 A;  4A0C D;  1OCR C;  4PTB A;  1I5N A;  2Q9C A;  4CDV A;  4JKV A;  5FCL A;  2H0D A;  4JZA A;  2BAY A;  3LRQ A;  1ZHX A;  4EBJ A;  3I2D A;  4A4A A;  3K1I A;  4Z9I A;  2NUT B;  4Q5S F;  4CS8 C;  4KC9 A;  2Y3D A;  4OD4 A;  3C8Z A;  4OD5 A;  2LXH C;  4OIR F;  2D8S A;  2FSA A;  2EPO A;  4QF2 A;  3DQV R;  1VOM A;  2YVR A;  1TR2 A;  1C17 M;  1T9K A;  5AGF A;  2NPU A;  1YVI A;  5TDR A;  4AE4 B;  3H2U A;  3FDQ A;  4FX5 A;  3OWT A;  4BPM A;  2Y1M A;  3CSK A;  2LCH A;  4G0H A;  3TJ5 A;  5A69 A;  3VK6 A;  3FVY A;  4JIO A;  1WOL A;  4YBS A;  3L1M A;  3EHN A;  3DE9 A;  4D4N A;  3U5S A;  3RQG A;  4OIO F;  4MW8 A;  1HW1 A;  2P61 A;  4IGG A;  2W9Y A;  3ABM C;  4YAX A;  5KYX B;  1M2V B;  5DS5 A;  1VMA A;  2LDR A;  3LNR A;  1VD4 A;  2KGG A;  5L0G A;  4L58 A;  2Y3G A;  1R5I D;  5B79 A;  2IOQ A;  4IJJ A;  2KKX A;  1SF8 A;  3TJ6 A;  4GB0 A;  1J8M F;  3J06 A;  4H54 A;  2VPB A;  2OEX A;  3FAO A;  2M85 A;  4CDA A;  1APC A;  1Z3I X;  4E7Z A;  3PUR A;  4DJ9 A;  4CS7 A;  2I8B A;  3F47 A;  4A4C A;  3TOL A;  4I7C A;  2KQ9 A;  2KU3 A;  2G3V A;  2J9B A;  2P0N A;  3EB5 A;  2FUI A;  3KV6 A;  1TWG A;  2HKV A;  3C8G D;  4U9E A;  2YL7 A;  3L8I A;  4IRU A;  5D1K B;  4NTB A;  2YWA A;  3ZVY A;  4MVQ A;  2JM3 A;  3B9Q A;  2D8U A;  4YAB A;  5JT4 A;  1LM3 B;  1WGW A;  2KWN A;  4GNE A;  1SYQ A;  5JP7 A;  1MM2 A;  2A6H F;  2QNL A;  1RXQ A;  5E3C A;  3KYJ A;  2ZXP A;  5F5F A;  3HCU A;  2L0B A;  2HJ3 A;  3EPV A;  3VRC A;  2WZG A;  1JAF A;  1OCC C;  2MD8 C;  1MNE A;  1LDJ B;  2IXM A;  3EB6 A;  3I5P A;  4IAQ A;  1DOV A;  3NG1 A;  4KBL A;  4S3O C;  5G05 B;  2G43 A;  3T9K A;  3QVY A;  3PCV A;  2YRF A;  1XWJ A;  1E4U A;  4N06 A;  3ZQV A;  5EYA F;  4NY3 A;  2JMI A;  4NTF A;  3K6B A;  3JZ0 A;  2YSM A;  3FOO A;  3U3B A;  3IQ6 A;  4N4W A;  2MUM A;  2Y3B A;  3EG9 B;  2R02 A;  2XLW A;  2DB4 A;  2XLO A;  4QQ4 A;  4IAR A;  3ABL C;  3FAJ A;  5KYW A;  2KRE A;  2VB6 A;  2M3H A;  1H6G A;  3S90 A;  3N2Z B;  1K05 A;  4L7X A;  3M63 A;  3A9C A;  3E70 C;  2J46 A;  5H9M A;  3O10 A;  4XLP F;  3Q6M A;  2ICW G;  4BEJ A;  4YN0 B;  2L81 A;  1NG1 A;  3NKD A;  1NSG B;  1K40 A;  2XL6 A;  4JTD B;  3SXZ A;  1JM7 B;  5HSW A;  3EQL F;  1JR8 A;  1WAS A;  2XM4 A;  4MVZ A;  1QQ3 A;  2J9U A;  3MFN A;  5SVI A;  1TWA A;  3MBG A;  4H4K C;  1TWH A;  4I7B A;  1JPN A;  2YKZ A;  2HFI A;  2IXO A;  2LK4 A;  2MD7 B;  3HJC A;  3PHD A;  4YAD A;  4Z9H A;  4LLC A;  3PLW A;  1AVO B;  4R32 A;  3AQC A;  3RVY A;  3OA1 A;  4MTG A;  4YJW A;  3FM8 C;  3SZR A;  4FO9 A;  2L6G A;  2YL1 A;  4JEA A;  5DLJ A;  1JOC A;  4CBE A;  4CJO A;  3QVZ A;  2F6J A;  1Z60 A;  2MNY A;  5EGY A;  4WZ0 A;  2J7P A;  1M6T A;  2WVN A;  5TJ5 E;  5KH9 A;  3ASO C;  4FES A;  3CAX A;  5L3V A;  4E0I A;  2OG2 A;  3GEI A;  2A1D D;  4O62 A;  2EGM A;  4PJJ A;  1EKY A;  5TBN A;  4IAO A;  4BJ5 A;  2OOC A;  1YYX A;  1N87 A;  3DAF A;  2L75 A;  1X4U A;  1O5H A;  5LKU A;  4CJG A;  4HFK B;  1ZU4 A;  4E18 A;  5KYU B;  1U6H A;  1PCX A;  3N9M A;  2JD3 A;  5KH7 A;  2V26 A;  1WEN A;  1CGN A;  2EPK X;  1T1H A;  2DI3 A;  3V43 A;  2FFH A;  1LPE A;  2FUU A;  5DQZ A;  2L6H A;  2XOZ A;  3O36 A;  4IC3 A;  3X2Q C;  5IY5 C;  4G7H F;  3N24 A;  1EQ1 A;  3Q7L A;  1SZI A;  4O64 A;  3K1H A;  4RDA A;  3TK0 A;  2YL3 A;  5F28 E;  2I15 A;  1CGM E;  3FAP B;  3ZC4 A;  4WA6 A;  1XZP A;  4GYT A;  2ZPA A;  2HSQ A;  1OQC A;  2YEV A;  2X0C A;  4PJN A;  4R2Y A;  3IQT A;  4XWJ A;  4UDV A;  3KKB A;  3O7A A;  2D5R B;  2KIZ A;  2YRE A;  1Q0F A;  2MHR A;  2J0W A;  2LAU A;  3DM5 A;  2HV7 A;  1AUE A;  2R7S A;  3GEE A;  4ZQL A;  1VB5 A;  2YHS A;  1RMV A;  2HYE D;  2YYR A;  2H7B A;  4C3D A;  1T6Q A;  3O39 A;  4CA1 A;  3JRT A;  3GAN A;  5KYY A;  3LQJ A;  1WEO A;  1D1C A;  1N1C A;  4FWV A;  4U5G A;  3ABK C;  2EIK C;  3UR3 C;  2MWQ A;  3IHU A;  3U2M A;  3KYI A;  4I1M A;  2KWK A;  4V3K C;  2LQG A;  4K1O A;  3ITF A;  1FMV A;  2IYL D;  1VK5 A;  2OJE D;  3T9O A;  3U5P A;  3C5K A;  3ZNI A;  3FXH A;  4NTA A;  4BHW A;  1O3U A;  1ZHW A;  2YUR A;  3G4X A;  1WEV A;  1BR4 A;  3LJU X;  2W4M A;  3NYM A;  3NMI A;  1MND A;  4XI1 A;  3LNM B;  1FTS A;  3HNI A;  1WAT A;  1EA8 A;  1WEU A;  2XM0 A;  5DS6 A;  2L7A A;  3O34 A;  3IHP A;  3AGU A;  2CDQ A;  3DPL R;  1VYX A;  1K04 A;  5SVX A;  3S9O A;  5CI8 A;  3RQE A;  2VCA A;  3GM1 A;  1MMN A;  3LEO A;  4UP5 A;  3U9J A;  2CT2 A;  2QJ0 A;  4KNV A;  2QUP A;  3C8G B;  3ZTM A;  4NCQ A;  4M63 A;  5TDW A;  2Y3H A;  1OKK D;  3F46 A;  4CCG X;  3DKA A;  3ASL A;  3ZYQ A;  3SP1 A;  3S0X A;  1RJ9 A;  3TUL A;  2XXA A;  2G62 A;  2JPU A;  1MMA A;  3L1X A;  3H7H A;  4JCZ A;  1I4Z A;  1MQV A;  2VCC A;  3SOW A;  4MVM A;  1GQA A;  2FGY A;  2YLD A;  4EHP A; 
#chains in the Genus database with same CATH homology
 2J9W A;  2XL4 A;  4U5H A;  4LKA A;  4W8K A;  3SEO A;  4I7C A;  3LQH A;  2BE5 F;  3KV5 A;  2KQ9 A;  2R7T A;  2KU3 A;  2G3V A;  1Z5Z A;  2YSJ A;  1PD1 A;  3O70 A;  4JVS A;  3NDB B;  4QF3 A;  3EB5 A;  3MHS A;  3DM9 B;  2FUI A;  5H1T A;  5FB0 A;  3KV6 A;  5B78 A;  4LLB A;  1FFT C;  5FER A;  1TWG A;  3EZI A;  4C7O A;  4CS8 A;  4LAD B;  5B75 A;  4K7B A;  5T3T A;  4DVY P;  3T6J A;  3PMR A;  5EHH A;  2R7V A;  4IRU A;  5D1K B;  3L1Z B;  2L43 A;  1TKN A;  3EGD A;  2QTV A;  2K4D A;  1MMD A;  3POV A;  1WIL A;  3W8H A;  1V87 A;  3ZVY A;  2E6S A;  3W8I A;  4YBT A;  2DGJ A;  1D0X A;  1FBV A;  2KR4 A;  2HV6 A;  3B9Q A;  2KYU A;  3FL2 A;  4YAB A;  2KGI A;  3CQZ A;  3LES A;  4A4C A;  2J9V A;  3SOU A;  5KYY B;  2WL8 A;  3UGO A;  2LXP C;  2ECV A;  1WGW A;  2KWN A;  5B77 A;  4GNE A;  2VPE A;  1Z23 A;  1MM2 A;  2A6H F;  3M62 A;  2C04 A;  2H0D B;  3HCT A;  5E3C A;  4FIP A;  4BJ6 C;  3L0I A;  3T4R A;  5DVW A;  2EIM C;  2WVO A;  2ZXP A;  2P6V A;  5F5F A;  1XWH A;  2I50 A;  2L0B A;  3HCU A;  4RD9 A;  3PHF 2;  3N9O A;  1OKK A;  2KGO A;  2PX3 A;  5D91 A;  1X4I A;  3KQI A;  1FFH A;  5I3L A;  4XTK A;  5D1M B;  4A2N B;  1G25 A;  1HYJ A;  2OXQ C;  3EPV A;  3KL4 A;  1WEM A;  4X0R A;  2WZG A;  5KYU A;  2VAS A;  1OCC C;  2K1J A;  2Y43 A;  1IW7 F;  3Q6N A;  2MD8 C;  3NYJ A;  1J8Y F;  5D1L B;  1MNE A;  2R7W A;  1LDJ B;  4GNG A;  3UMI A;  3PUQ A;  2IXM A;  4LK9 A;  3S27 A;  4O79 A;  3EB6 A;  3I5P A;  3X1O A;  1NZE A;  4AX2 A;  3RYL A;  4A4B A;  3JCU Q;  3NG1 A;  4U5C E;  4YC9 A;  4KBL A;  3SHB A;  4S3O C;  5AIU A;  3O37 A;  4PJL A;  5G05 B;  4ZDT A;  2G43 A;  3ZVZ B;  2H7V C;  5TRB A;  4Q7C A;  4N4F A;  3FHD A;  1S7Z A;  3K1I C;  1FP0 A;  3DJN B;  4B86 C;  4CSA C;  1E4U A;  5CI9 A;  4N06 A;  5EYA F;  4CS7 A;  2CNW D;  4NY3 A;  4NN2 A;  2IXP A;  4W4U A;  4WZ3 B;  3RKO F;  2WB7 A;  3CZ6 A;  2JMI A;  2LRI C;  3TD7 A;  3K6B A;  2JMJ A;  4LLE A;  4A49 A;  3DXJ F;  4EBB A;  2LSE A;  4LAC B;  2YSM A;  1ZHY A;  3JT1 A;  5KYN A;  2CSY A;  4BJ5 C;  2MUM A;  2Y3B A;  4KNW A;  2CKL A;  2ECT A;  1D1A A;  2J45 A;  4MND A;  3JYH A;  3L34 A;  4YT2 A;  2PNX A;  2EOD A;  2R7Q A;  3S29 A;  3EG9 B;  2JMD A;  3RIP A;  2XEU A;  1Z6A A;  3DAG A;  4CIH A;  4ZLD A;  1WEW A;  2ECG A;  1SMY F;  2KE1 A;  3SYN A;  3RPG C;  2Y39 A;  5LKZ A;  1IZM A;  1VYK A;  4JUR I;  2V3C C;  2E87 A;  3ABL C;  3FAJ A;  5KYW A;  1WGM A;  2KRE A;  2VB6 A;  3ZG1 A;  2M3H A;  3U5O A;  3NG2 A;  1WFK A;  4FJC A;  2LGV A;  5D92 A;  2WZL A;  2G6Q A;  3EFO B;  5DKA A;  4I1O B;  3N2Z B;  4L7X A;  2PP4 A;  1X4J A;  3M63 A;  2VJF B;  3E70 C;  4QI2 A;  4F52 B;  3SOX A;  2YW8 A;  5LCW B;  4BJT A;  2J46 A;  1TWC A;  5H9M A;  4XLP F;  1V55 C;  1NU7 D;  2NAA A;  3Q6M A;  4BEJ A;  4PJM A;  3KMI A;  3JSZ A;  4YN0 B;  2KJG A;  4JJF A;  2L81 A;  4C3E A;  4PFO A;  1NG1 A;  1MMG A;  2K17 A;  2VH3 A;  3NKD A;  4MSX A;  3U5N A;  1JM7 B;  1RJ9 B;  3VAY A;  2VP7 A;  4AYC A;  2XXA B;  3AG4 C;  2DX8 A;  5HSW A;  2VNF A;  4AP4 A;  4JW1 A;  1HYI A;  4UI9 B;  3Q7G A;  3DMD A;  3IEE A;  3EGX A;  2EIJ C;  1F62 A;  2NUP B;  3EQL F;  2M1R A;  1WIM A;  2MNZ A;  3LS0 A;  2CGE A;  3EZH A;  2B0J A;  3W2V A;  3N0T A;  2MIQ A;  2J9U A;  2YHN A;  3O33 A;  4G7Z F;  4BJ6 A;  5FB1 A;  1TWA A;  3O35 A;  4H4K C;  1TWH A;  4P6I C;  4U5D E;  5F5H A;  1JPN A;  4I7B A;  1PD0 A;  2DYR C;  4EWC A;  2W4B A;  3U5M A;  2IXO A;  2MD7 B;  3PHD A;  3HJC A;  4YAD A;  2CNW A;  2NUT A;  4LLC A;  3WG7 C;  4J32 B;  3K7D A;  2LGG A;  4O7G A;  3AQC A;  3ASN C;  3OA1 A;  5L3Q A;  4YJW A;  4C7O B;  4IWB A;  3SZR A;  4FO9 A;  5DLJ A;  1JOC A;  2XB1 A;  2EA6 A;  3AG3 C;  5G04 B;  3LS1 A;  4CBE A;  2O9X A;  4YT5 A;  2R7X A;  1ZBD B;  5DS4 A;  3EGD B;  4IC2 A;  1ST6 A;  4BJ1 A;  2QIZ A;  3I5Q A;  4C3B A;  2F6J A;  2AN6 A;  1Z60 A;  2MNY A;  4YAT A;  3K33 A;  2KFT A;  5EGY A;  4WZ0 A;  2J7P A;  1WEP A;  2WVN A;  4CSA A;  5KH9 A;  3ASO C;  2VPD A;  3GV4 A;  4JCH A;  3O6X A;  4FES A;  2PFD A;  1Z63 A;  2G45 A;  3T6R A;  4I7D A;  2LGL A;  5L3V A;  4AE4 A;  2MYS A;  2VJE A;  2OG2 A;  3T6B A;  1V54 C;  2A1D D;  2QY9 A;  2IDA A;  3RFY A;  1VFY A;  2PUY A;  3N9P A;  2ZXR A;  3C6W A;  5LKX A;  1BOR A;  4PJJ A;  2M6M A;  5TBN A;  1ZU5 A;  4IAO A;  3ZIB A;  4BJ5 A;  1N87 A;  3DAF A;  4OIP F;  3ECS A;  2L75 A;  4GEH A;  1X4U A;  2WVQ A;  1M2O A;  1O5H A;  3B0P A;  1LS1 A;  1IYM A;  3HTK C;  5LKU A;  3UGP A;  3WOD F;  2IXN A;  2YQM A;  4BBQ A;  2R7O A;  3LLI A;  4HFK B;  4AUQ B;  1ZU4 A;  4UP0 A;  5KYU B;  3N9L A;  1G8X A;  4V3L C;  2X51 A;  3MHH A;  2A68 F;  5KYX A;  1MM3 A;  1M56 C;  2F42 A;  1PCX A;  2G3K A;  1M2V A;  3N9M A;  2JD3 A;  5KH7 A;  2V26 A;  2E6R A;  1WEN A;  2Z15 A;  4ZLC A;  5DQT A;  3M1C B;  5JG6 A;  2A6E F;  1QLE C;  3QMK A;  3ZPV E;  5B1A C;  3LLK A;  2YQL A;  2ECI A;  1T1H A;  4B6I A;  3V43 A;  5B8D A;  2FFH A;  2FUU A;  4HEA J;  3V7O A;  5C11 A;  4U5B E;  5DQZ A;  2L80 A;  3O36 A;  4IC3 A;  4DVZ A;  2L5U A;  2LGK A;  2Q9B A;  2YHO A;  3X2Q C;  5IY5 C;  2JRJ A;  4G7H F;  3N24 A;  2ECW A;  2ZET C;  3Q7L A;  2KWO A;  4C9Z A;  1D0Y A;  1M57 C;  5E3A A;  1SZI A;  4BG0 A;  3K66 A;  3UMK A;  4O64 A;  2YU4 A;  5H1V A;  3RH3 A;  3K1H A;  4RDA A;  4X3G A;  2C2L A;  3S28 A;  2CKL B;  2KW3 C;  4OIN F;  3H65 A;  3I4U A;  2EIL C;  4TKP B;  2XRH A;  2DYS C;  2ZXW C;  4WJ0 A;  1FMW A;  3W2W A;  2GFH A;  3ZC4 A;  4WA6 A;  2NG1 A;  2ZPA A;  4GYT A;  1BR1 A;  4ANJ A;  5E2Q A;  4KI2 A;  4GND A;  2YEV A;  3AG1 C;  2RI7 A;  4PJN A;  2VPG A;  2OCC C;  4R2Y A;  4Q4Z F;  4MQ9 F;  3ZTG A;  4YT4 A;  5DIN A;  3NYL A;  4U5F E;  4XWJ A;  4CS9 C;  2RSD A;  3NKE A;  3KKB A;  3ZPV 1;  2PX0 A;  4E7S A;  5KYW B;  1WE9 A;  2ECJ A;  3O7A A;  2D5R B;  2R7R A;  4DBR A;  4DBQ A;  3LEV A;  3T7L A;  2ZXO A;  2KIZ A;  2YRE A;  3N9N A;  2J0W A;  4AK9 A;  3DM5 A;  4PPE A;  4I44 A;  5G0F A;  2WZF A;  1K2F A;  4LER A;  2MA6 A;  2HV7 A;  2Q9A A;  2W45 A;  4LJN A;  2R7S A;  1RMD A;  4JJG A;  4ZQL A;  2F6N A;  3QZC A;  3DD7 A;  3SNH A;  2YHS A;  4DOZ A;  2HYE D;  4B7Y C;  4RBN A;  3KH2 A;  2YYR A;  2H7B A;  1U6G B;  2EGP A;  4C3D A;  5C13 A;  3O39 A;  1DVP A;  3ZSU A;  4CA1 A;  4AYC B;  3JRT A;  3GAN A;  1WEE A;  3E9V A;  4O6N A;  5KYY A;  3LQJ A;  1WEO A;  1D1C A;  3LQI A;  3RTR B;  1N1C A;  2C03 A;  4F4B A;  4FWV A;  4A0C D;  3EGX B;  1OCR C;  4PTB A;  3QZV A;  2Q9C A;  4GNF A;  5FCL A;  2LN0 A;  2H0D A;  4U5G A;  3UMH A;  4JZA A;  3ZVR A;  2K16 A;  3ABK C;  2BAY A;  2QIC A;  2EIK C;  2HDP A;  3UR3 C;  2MWQ A;  3VYW A;  4P5O B;  1Z6U A;  3LRQ A;  1ZHZ A;  1ZHX A;  4I1M A;  2KWK A;  3I2D A;  4V3K C;  2L9J A;  2YUC A;  2M4E A;  4HFF B;  4FK5 A;  3EH2 A;  5T3W A;  4YWQ A;  3ITF A;  1FMV A;  2R7U A;  2NUT B;  1W2W A;  3MLG A;  2IYL D;  1VK5 A;  4Q5S F;  4QI0 A;  3U5P A;  4CS8 C;  3C5K A;  3ZNI A;  4KC9 A;  2Y3D A;  4OD4 A;  4OD5 A;  2LXH C;  4OIR F;  4R8P K;  5E33 A;  5LKT A;  2Q3T A;  4WZ2 A;  2D8S A;  2FSA A;  3OEO A;  4Q6F A;  4BHW A;  4ULW A;  5AIT A;  4O6Y A;  4QF2 A;  1ZHW A;  2YUR A;  1WEV A;  4OIQ F;  1BR4 A;  3UNG C;  3DQV R;  4HE8 D;  3EHM A;  4S3O B;  2W4M A;  3NYM A;  5B1B C;  1VOM A;  1O87 A;  5T1D B;  1TR2 A;  1BR2 A;  3KNV A;  1KU2 A;  3AG2 C;  1MND A;  1LKX A;  4XI1 A;  4K0D A;  1FTS A;  1WEU A;  4N3W A;  1CHC A;  4AVX A;  5DS6 A;  3B0U X;  2Y1N A;  5TDR A;  4J30 B;  4AE4 B;  3O34 A;  3IHP A;  2KWJ A;  3FDQ A;  2VJE B;  2CDQ A;  4FX5 A;  3M99 A;  3DPL R;  2Y69 C;  1OCO C;  3OWT A;  1VYX A;  2Y1M A;  1Z2Q A;  3CSK A;  3DJU B;  1D0Z A;  2UZG A;  4G0H A;  3GL6 A;  4PFP A;  3HCS A;  4O6M A;  5CI8 A;  3VK6 A;  3FVY A;  4YBS A;  3LAY A;  3EG9 A;  1MMN A;  3EHN A;  5J3X A;  1LVK A;  3EH1 A;  4OIO F;  3LJB A;  3GOD A;  2CSZ A;  2EIN C;  2MA5 A;  5FEY A;  3RPG B;  5H1U A;  3MX3 A;  4XLN F;  2W9Y A;  5B3S C;  1WES A;  3AQB A;  3ABM C;  4UP5 A;  4CS9 A;  4YAX A;  2CT2 A;  2QJ0 A;  4PK4 A;  5KYX B;  5B76 A;  1OCZ C;  2XSE A;  4KNV A;  1M2V B;  5DS5 A;  1VMA A;  3EJN A;  3EFO A;  2A69 F;  2P7V A;  2LDR A;  3LNR A;  2VJF A;  3N9Q A;  2KNH A;  1NU9 C;  1VD4 A;  3B0V C;  2KGG A;  4L58 A;  4G7O F;  4M63 A;  2YT5 A;  5TDW A;  2Y3G A;  2Y3H A;  1OKK D;  3F46 A;  4I3M A;  4MVT A;  5B79 A;  1JPJ A;  2IOQ A;  2J7P D;  3DZA A;  4CCG X;  1WEQ A;  4IJJ A;  3HLZ A;  1ZYR F;  3ASL A;  1SF8 A;  3ZYQ A;  2PF4 E;  4ZUX U;  3SP1 A;  2ECN A;  2MT5 A;  3S0X A;  1JM7 A;  1RJ9 A;  5TAB A;  2XXA A;  5BUO A;  4GB0 A;  2C2V S;  1VYI A;  1J8M F;  2G62 A;  1MMA A;  3L11 A;  4R7E A;  3L1X A;  2VPB A;  4YT8 A;  2H7O A;  3NRH A;  2J0X A;  4QDL A;  2NUP A;  4YBM A;  1QZX A;  2M85 A;  4U5E E;  3SOW A;  5KH3 A;  2LV9 A;  1LDK C;  1Z3I X;  4E7Z A;  2FGY A;  3PUR A;  2YZS A;  2CW0 F;  2I8B A;  2LQ6 A;  3F47 A;  1ZHT A;  1D1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...