3HTKC

Crystal structure of mms21 and smc5 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Structural maintenance of chromosomes protein 5
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
total genus 75
structure length 254
sequence length 254
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1010 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3htkC01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3htkC02
3LQHA 4YABA 2K4DA 4MSXA 4O64A 2FUUA 2L5UA 5TBNA 3O33A 4YBSA 5J3XA 2PNXA 2YHOA 3GL6A 2EA6A 2YUCA 2K17A 2XB1A 2YYRA 4A0CD 2M6MA 3DQVR 3PHDA 2G6QA 2ECJA 3ZNIA 2DX8A 5JG6A 1WEUA 2LV9A 5DKAA 5D1KB 3HCSA 2VPDA 3O36A 3NG2A 5FEYA 2KGIA 1G25A 4LADB 3U5NA 4ZDTA 2JMIA 2JMJA 2JMDA 3U5MA 5DINA 5EYAF 2CSZA 4PPEA 1LDJB 4GNGA 5FB0A 4GB0A 5B77A 2CT2A 1WE9A 2M1RA 2M85A 2F42A 2E6SA 3RPGC 3MHSA 2VP7A 2YREA 3N9QA 2YQLA 5B79A 4YAXA 1N87A 4ZUXU 4YC9A 3C5KA 4AYCA 4YADA 2YT5A 1WEEA 4I7BA 3O34A 1HYJA 2G45A 4A49A 5FERA 2H0DA 1DVPA 3PURA 3O35A 4LK9A 2L75A 3T7LA 4N3WA 4AYCB 2YQMA 3KV5A 1VYXA 2ECGA 4P5OB 2CKLA 2KR4A 1WEWA 2H0DB 1WFKA 1RMDA 3HCUA 4MVTA 3L1ZB 2QIZA 1U6GB 2ECNA 4UP5A 1HYIA 3N9OA 4Q6FA 2YHNA 5C13A 5H1UA 2L43A 4R8PK 2ECWA 1XWHA 2I50A 4YATA 4LKAA 1Z60A 2YSMA 2QICA 3ZVZB 2YW8A 2VJEA 5I3LA 1WIMA 5B8DA 2KYUA 1WEPA 4AP4A 3KV6A 5D1LB 5B76A 1FBVA 5AITA 1WILA 4LJNA 4L58A 2VJEB 2KU3A 3VK6A 1WENA 3DPLR 2KWOA 3ZPV1 1Z6UA 3N9MA 1X4UA 4A4CA 1LDKC 3ZVYA 3LQJA 2HYED 2KWNA 4QF3A 5KH9A 4ZQLA 5TDRA 4TKPB 3C6WA 5H9MA 2VJFA 2F6NA 1FP0A 4N4FA 2MUMA 1K2FA 1IYMA 5LKUA 3SOXA 2KWKA 5LKXA 2VJFB 5B78A 3HTKC 2LGGA 4GNEA 2MD7B 5G04B 5KH3A 2ECIA 3T6RA 3V43A 2MD8C 5AIUA 3IHPA 2KIZA 3ZYQA 2JRJA 2YSJA 1ZBDB 1WEMA 2NAAA 2L80A 3PUQA 4S3OC 4FO9A 1MM2A 3M62A 5LCWB 2VNFA 5KH7A 2EGPA 3SHBA 1V87A 2ECVA 4BBQA 2K16A 4XI1A 4PTBA 5G05B 4X3GA 3ZTGA 2C2LA 2LDRA 3O7AA 4L7XA 2AN6A 1X4JA 2E6RA 4B86C 1E4UA 2UZGA 2LQ6A 3EB6A 1MM3A 5C11A 2LGVA 5TABA 2C2VS 2MT5A 2ZETC 1T1HA 1WGMA 4R7EA 4CA1A 4I7DA 3U5OA 2XEUA 2MNZA 2LGKA 3FL2A 4V3KC 5TRBA 1Z2QA 4GNFA 5D1MB 5FB1A 2FUIA 2QJ0A 2LGLA 3ASLA 1WEQA 2ECTA 2M3HA 2KWJA 1JOCA 1CHCA 5TDWA 4FIPA 2MNYA 2D8SA 2LN0A 3N9PA 3MHHA 3KQIA 2RSDA 2EODA 3LQIA 3M99A 2K1JA 4UP0A 3SOUA 4I7CA 4UI9B 4AUQB 2VPEA 3HCTA 3GV4A 3I2DA 3U5PA 2MA5A 4W4UA 4YBTA 5B75A 3ZPVE 3RPGB 2YU4A 4WZ0A 1WEVA 1VD4A 3QZVA 1JM7A 2KFTA 2MA6A 2KGGA 4V3LC 3L1XA 2FSAA 4R2YA 4WA6A 4F52B 1F62A 4QF2A 4YBMA 3M63A 3EB5A 1JM7B 2KE1A 4FJCA 2OXQC 3L11A 5H1VA 2CSYA 2Y1NA 2RI7A 4FK5A 1WESA 4NN2A 2Y1MA 4B7YC 4S3OB 3RTRB 5LKZA 5H1TA 2KREA 1WEOA 2L0BA 2MIQA 4WZ3B 5LKTA 4AVXA 2LXHC 3N9LA 4IC3A 3KNVA 2IDAA 4GNDA 1X4IA 4IC2A 3LRQA 3O37A 5G0FA 4BHWA 2F6JA 4A4BA 4LLBA 1VFYA 2HDPA 1BORA 2VPBA 2G43A 3SOWA 2VPGA 2CKLB 2YURA 3O70A 4C9ZA 2LXPC 2Y43A 2LRIC 2BAYA 2PUYA 3N9NA 4CCGX 4WZ2A
chains in the Genus database with same CATH superfamily
1MMGA 4MSXA 2L5UA 4EKWA 5TBNA 1LI5A 3C63A 1E84A 5TJ5E 1GQAA 3U9MA 3HKKA 2YHOA 2EA6A 3O10A 2XB1A 2YYRA 4A0CD 1T5OA 1QVXA 1YARO 3T6JA 2P61A 2CGEA 1OKKD 4C3EA 5KYYA 2Y3HA 4ZLCA 3QW0A 3DE9A 5T3TA 1WEUA 5D92A 1R4TA 2LV9A 5DKAA 3JTLO 2OCCC 3RVZA 2VPDA 5KYUB 3NG2A 1ZHWA 4DBQA 2HZ8A 3POVA 4DVZA 1XWJA 3U5NA 4ZDTA 3DD7A 3S90A 1QQ3A 5B1BC 2HV7A 4I44A 2LFDA 1LDJB 3DM5A 2KYHA 3LESA 4NTFA 3NMJA 1YA9A 2E6SA 1ORSC 4MQ9F 4U5GA 4YL0A 4DRJB 4RBNA 3EGXA 1TR2A 2YT5A 4PK4A 4I7BA 2G45A 2I8BA 4LK9A 4GQHA 2LD6A 2ECGA 5A69A 2YLDA 2WB7A 4GEHA 2YL3A 1C17M 2J0WA 2ASRA 1YZAA 1LIHA 3L1MA 2OG2A 3EZHA 4ULWA 4HEAJ 2A0UA 2C04A 3QVZA 1D0ZA 4J30B 3E9VA 1WGWA 5FZTA 1KU2A 5E3CA 4PFPA 3L8JA 2CNWD 5JLIA 4XQ1A 4YATA 2FD4A 3T6BA 4IWBA 5I3LA 2HJ3A 2KYUA 2NUTB 1LKXA 3DZAA 5A6BA 4JRZA 5B76A 3EH1A 2EILC 3O6XA 2XP0A 3W8IA 2VCBA 1WASA 2KKXA 1WTYA 4HFKB 3QZCA 2R02A 1XZQA 1X4UA 2R7SA 2WL8A 2YKZA 3LQJA 2HYED 4QF3A 2IBFA 2WZFA 5SVYA 5H9MA 2EPLX 4LLEA 1H6GA 4N4FA 3NMKA 2MUMA 1QSPA 4K0DA 3PMRA 5L0CA 4AE4B 2XL4A 3AGTA 1IYMA 5LKUA 1VOMA 3SOXA 3TJ6A 5SVXA 2L6HA 3HTKC 2LGGA 3EFOA 4YN0B 2QY9A 4A4AA 5G04B 3SYNA 1E86A 2ECIA 3ABLC 1Z3IX 5F5HA 4XLNF 2VC9A 2V26A 2YSJA 4E7SA 3QW1A 2NAAA 1VB5A 4FO9A 2XLEA 1MM2A 3M62A 3VAYA 3E2DA 2ECVA 4Z0RA 4EWCA 2KK1A 4DRHB 1T6UA 3RF3A 4X3GA 4JIOA 3K33A 1JOGA 4O62A 2LDRA 3O7AA 2YVKA 1CGME 3LVQE 2Y69C 4YT8A 1X4JA 1OCOC 2A6HF 4OGCA 4B86C 1FFTC 3KYJA 2UZGA 5T3WA 1MM3A 3EGDB 3DDTA 3UMKA 2C2VS 1WGMA 4R7EA 3DI5A 4B6IA 2RSEB 2PF4E 2GFHA 3U5OA 2LGKA 2D4UA 1Z2QA 3VRCA 2AP3A 2FUIA 5FB1A 4JZAA 3AG2C 1RCPA 4KBLA 3ASLA 4KC9A 2KWJA 1LI7A 1JOCA 2P57A 4XEKA 2QE9A 1JRAA 1NG1A 5TDWA 1Q0GA 2LN0A 4OINF 5K3QA 4BEJA 3MDBC 3KPHA 1TWCA 2R7QA 4RD9A 4DVYP 4K7BA 1FMVA 3JCUQ 2WZLA 3C62A 3CZ6A 3GEHA 3KMIA 4BJ5A 4CDVA 2Y3BA 1F1MA 5JSLA 4UI9B 5JP7A 3GV4A 3I2DA 2EIMC 5L0DA 3T9KA 4LLCA 1UFBA 1T6QA 2YU4A 4WZ0A 1VD4A 1JM7A 1VMAA 3IQ5A 3OA1A 2KGGA 3LAYA 3L1XA 4JVSA 4YWQA 3B9QA 1E2XA 1VK5A 4ONSA 4DJ9A 4AK9A 4JTCB 5HV9A 3VF0A 2EGMA 4NC3A 2OXQC 2XS1A 3L11A 2CSYA 4JEAA 2AU5A 5DS6A 4NN2A 2LCHA 4FWVA 1G4US 1WEOA 2YEVA 1RJ9B 5LKTA 2XLWA 3M79A 3E70C 1TQGA 3EHMA 4IC3A 4O6NA 3EGDA 2FFWA 2IOQA 3C8ZA 4U9EA 5G0FA 5GPGB 2OU6A 1OKKA 3H7HA 2WVQA 3UMIA 5T1DB 4J32B 3W2VA 2VPBA 3UNGC 1RKEB 1JAFA 2LXPC 4DBRA 3C8GD 3MBGA 5CI9A 4U5BE 1G8XA 3LQHA 1ZU5A 1L3PA 1TFKB 3O33A 3V5YA 2DJAA 4PFOA 4YBSA 5J3XA 2A0BA 4YK5A 2YUCA 5D91A 2W45A 1BBHA 3LJBA 2L81A 2P1AA 5L0HA 2YLIA 2G6QA 2ECJA 4AL0A 3ZNIA 3X1OA 2BL2A 4QDLA 3C18A 2JPUA 4Z9HA 4MNDA 2KGIA 2L7PA 3VM6A 1G25A 1CPQA 5KYYB 1LPEA 2JMJA 4JC7A 1ZZPA 3EQLF 5EYAF 1ZYRF 2CSZA 4P6IC 2NSGA 4GB0A 3ABKC 3O55A 4CS7A 3LS1A 2R25A 5L0IA 2VB6A 3AQBA 3GODA 3RPGC 1K04A 4BJ5C 4U5DE 1YYJA 2LP4A 1AUEA 1O87A 4MVMA 2YREA 4CS9A 5COMA 5B79A 4OD5A 4MW8A 3HNLA 4W8KA 4YC9A 3C5KA 4AYCA 3JYHA 2MYSA 4BJ6C 1MNDA 4YADA 3NKDA 3Q7GA 4MTOA 3ZC4A 3HNJA 3O34A 2L7AA 2YZSA 2Q3TA 4WJ0A 4OIOF 3PURA 4KNVA 4H4KC 2L75A 3T7LA 3EGXB 3U3BA 4N3WA 4P5OB 3AG1C 2H7BA 3RH3A 2KR4A 2LFFA 1WFKA 3V7OA 3HCUA 4MVRA 1D1AA 2B0HA 2PX0A 2HMQA 3N2ZB 3PDMP 1FAPB 1H9TA 2ECNA 3K1IA 4IJJA 4G7OF 2Q7RA 4UP5A 1TKNA 3CQZA 3N9OA 4CBEA 2PX3A 5KYWA 5DLJA 2YHNA 2ZPAA 3WODF 4R8PK 1XWHA 3JT1A 3AG3C 1Z60A 4X0RA 1L7CA 2Z15A 2VH3A 2YHSA 4G78A 1ZHTA 5B8DA 2J9UA 1WEPA 4KNWA 4ULVA 1FBVA 4R32A 2EXUA 3FOOA 5AITA 2IXMA 4LJNA 1D1CA 4N4WA 3GWNA 3EZIA 1S7ZA 2BC5A 3DPLR 2R7UA 1IW7F 5A6KA 3N9MA 4A4CA 3ZVYA 4E0IA 4DXWA 4J7TA 5B1AC 1MMDA 2VJFA 4F1PA 4FESA 1VTMP 3SEOA 3U0CA 3SXMA 1K2FA 3EH2A 1NFOA 1ZVZA 3ZDLA 1HW1A 2HV6A 4H54A 5LKXA 3M4CA 1SF8A 3AOUA 3NYLA 4JCHA 1N1CA 1OCRC 1OQCA 2B0JA 1U6HA 1D1BA 2MD7B 5KH3A 2HSQA 3GORA 3T6RA 3ITFA 2EPKX 4ANJA 2ICWG 2MD8C 3IHPA 2G62A 5AGFA 2KQ9A 1PD1A 1K40A 2DYRC 3EFOB 4IRUA 3IEEA 4EBBA 5SVIA 5AC4A 5JUAA 2JRJA 3I4UA 1AEPA 2KGOA 1U89A 1LE4A 3JYYA 3WAQA 2EGPA 3SHBA 1KNYA 4PJLA 4BEMJ 4CS9C 4YT5A 4BBQA 2MHRA 3TD7A 1SZIA 4CS8A 2XOCA 1SYQA 2K16A 2FFHA 4XI1A 1ORJA 4WGZA 5G05B 4Z9IA 4YT2A 3WG7C 4BG0A 3UGPA 2A6EF 3ZTGA 2C2LA 1EI7A 1VLTA 4O7GA 3L8IA 4MVZA 4QI0A 2AN6A 1BR4A 2M4EA 3T9OA 1DOVA 2E6RA 5A6JA 3G4ZA 2IXNA 4MVOA 5TABA 4D4XA 3US6A 4CSAA 4IB4A 2MT5A 2R7RA 4NQFA 3TOMA 3GWLA 3K1IC 3RQFA 1U0BB 1BR1A 2Q4FA 4P9TA 3I5PA 3NMIA 2MNZA 3DWDA 5E3AA 5D1MB 5TRBA 3DAFA 4U5CE 5L3QA 1WEQA 2M3HA 5BQIA 1D0XA 4U5EE 1D0YA 3V5ZA 5KYXA 2IXPA 2WZGA 3U8VA 4FIPA 5JT4A 2KSFA 1OXKA 1QPUA 3DJNB 3KQIA 1Z7Qc 4W8PA 3M99A 3Q1DA 2XL6A 4NY3A 2K1JA 3W4YA 3SOUA 4I7CA 5CI8A 3ZTZA 2FGYA 4LDQA 4AUQB 2VPEA 3HCTA 1MMAA 3SP1A 3FAPB 5BUOA 3U5PA 1OCZC 3K66A 2MA5A 5EK0A 3ZPVE 3RPGB 2B0OE 3G50A 1I4ZA 2KFTA 3B0UX 2MA6A 1QZXA 3TJ5A 2YWAA 1RMVA 3EJNA 2FSAA 3FXHA 3NDBB 3CEXA 1V55C 4WA6A 3M63A 3EB5A 4Q7CA 1JM7B 3RYLA 3C8GA 3H65A 1WESA 2Y1MA 4XWJA 3RTRB 2E61A 5LKZA 1MMNA 1EA8A 3M4BA 3ZSUA 2KREA 3S28A 1GM5A 3ATPA 3GM3A 2L0BA 2X51A 5CIVA 4LERA 4XPXA 2LXHC 3N9LA 1JPNA 2LQGA 2H7VC 3L34A 4CDYA 2PFDA 2XL8A 4GNDA 3KDEC 2GDCA 1O5HA 4IC2A 3JRTA 1YZCA 2LIGA 3B71A 2HDPA 1LM3B 1BORA 2OEVA 2VPGA 3SOWA 2CKLB 2YURA 3O70A 4C9ZA 1LS1A 2UUHA 2J8WA 4E18A 4WZ2A 2K4DA 4JEBA 1H9GA 3BRJA 2D8UA 2FUUA 2J0XA 3FM8C 3W2WA 1DCQA 3FHDA 1BR2A 4CJOA 2OJED 1FFHA 4F4BA 1NLXA 2MKEA 1AVOB 2K17A 2EINC 4JJFA 2YRFA 2ZXPA 4U9DA 2YQYA 3CAXA 4O6MA 3KYIA 4YL1A 3KKBA 3DQVR 5L0GA 3SXKA 3ZG1A 2DX8A 5JG6A 1KTMA 1VLSA 4FX5A 3IQTA 4YJWA 1EKYA 4LADB 3F46A 4MVQA 4FAPB 2JMIA 1VYIA 2XLOA 3BEHA 3U5MA 2J9BA 5DINA 3LLKA 3A9CA 4PPEA 5L0JA 1JR8A 4GNGA 5FB0A 2R7OA 4RDAA 2CT2A 2M85A 2C03A 3MHSA 2OQMA 5AC5A 2OJQA 2DI3A 4YT4A 1CGOA 3NRHA 4YAXA 4ZUXU 1T9KA 2CONA 2PP4A 1S05A 2AVKA 2XLHA 2P0NA 4PR9A 3TQOA 1WEEA 1HYJA 5FCLA 3SUBA 4A49A 2H0DA 3S27A 2VCAA 1E83A 3DJUB 2R7XA 3U2MA 1HY5A 1NBBA 4AYCB 2RR4A 2HJMA 2YQMA 1OR3A 4JKVA 4CDAA 4P9FA 1T01A 2LK4A 2CKLA 3TULA 4DOZA 3U9JA 2CCYA 1ORYA 3Q7LA 1RMDA 2YLGA 1C03A 1CPRA 4MVTA 3B0PA 1MQVA 3GM1A 1U6GB 2GAQA 3U8PA 4Q6FA 4I1OB 2DB4A 3ASOC 2J46A 3DWWA 3RQEA 3FAJA 2ECWA 3TK0A 4LKAA 2ZXWC 1H7IA 5BQHA 4N06A 3SZRA 2QICA 4G0HA 5KYWB 2YW8A 2VJEA 2W4BA 2R05A 4AP4A 3HNIA 1NZEA 1OCCC 2Y3GA 1YA7O 1OW7A 3F47A 3LDYA 1WILA 3FOPA 1A0BA 1J8YF 4D4NA 2KU3A 1WENA 3SNHA 2KWOA 2G3KA 4JW1A 3GEIA 2XOYA 3UGOA 2JUNA 1LDKC 4XPWA 2KWNA 1WN0A 2R03A 2UUIA 2LAUA 2F6NA 1M2VB 2A68F 1FP0A 3FAOA 4HFFB 1XZPA 4OD4A 2W9YA 1JPJA 3G4XA 3B0VC 2J7PD 3PLWA 5KYNA 2VJFB 1BZ4A 4MS2A 4EUKB 1NSGB 2Y3DA 3CSKA 5E33A 4NTBA 3T4RA 4XTKA 1YLMA 4J7YA 3V43A 2QNLA 3U2LA 2KIZA 3LS0A 3H2UA 4K1OA 1JMWA 1ZBDB 4JTAB 4C7OA 2GWWA 3JUEA 2L80A 3DE8A 2FAPB 3NKEA 5KH7A 1V87A 1Q0FA 2A1DD 3R7CA 1Y4CA 5SVIB 4O79A 3MYIA 2P6VA 2JD3A 1TWAA 2RD9A 3JZ0A 4CIHA 4JE9A 4I1MA 2IQJA 3Q6MA 3O47A 1E4UA 3SXYA 2EPOA 3DXJF 5C11A 1YJGA 3U5SA 2LGVA 2IYLD 4I3MA 4XPYA 1LS4A 2IXOA 4CA1A 4I7DA 1YDIA 3B29A 2XEUA 4GNFA 2CRRA 2OWAA 1RXQA 2QLAA 2QJ0A 2D5RB 1C02A 3HLZA 2PBEA 5F28E 2ECTA 1M2VA 3FEHA 2HMZA 1CHCA 1QLEC 1A7DA 2MNYA 2XM0A 2D8SA 3MHHA 3OWTA 2RSDA 2EODA 5JS5A 5KYXB 2NSFA 3EHNA 1HE1A 1A7VA 3MYFA 2EPNA 1Q0DA 4PJNA 4W4UA 1TWGA 1WATA 3LVRE 3QZVA 5L0FA 1OW6A 1Q0MA 2Q9BA 4V3LC 3ZVRA 1GS9A 2HUJA 3IHUA 4BPMA 4QF2A 1OW8A 4Z9JA 2NPUA 2KE1A 4FJCA 1I4YA 4JTDB 1NFNA 4OIRF 3PCVA 2I15A 1APCA 4S3OB 3TOLA 5H1TA 1M57C 3RIPA 3ABMC 2XOZA 2XLVA 1I5NA 1FMWA 3S0XA 2XLMA 2M64A 3C8GB 1HMOA 4QI2A 4MVSA 4AVXA 2VASA 3S29A 3KNVA 4LACB 1MBMA 3GANA 3EG9A 1V4AA 3LRQA 4BJ1A 3RW0A 2CW0F 4PJJA 2IM8A 2R7WA 4LLBA 4KI2A 1ZHZA 1HW2A 3JSZA 2OKUA 3ZQVA 2Q9AA 2R7TA 2Y43A 3FMSA 4U5FE 3ZTMA 3NG1A 2XM4A 4YABA 1DOWA 2EIJC 4O64A 256BA 3LUTB 1Z5ZA 3DM9B 4OGEA 2KJGA 3NYJA 4MTFA 4EBKA 1O3UA 1V54C 2PNXA 2L6FA 4OIPF 3GL6A 4G7HF 2YL7A 3LLIA 3RQGA 3K7DA 4JCZA 2QUPA 2M6MA 5KYUA 2G3VA 3K6BA 4A2NB 3PHDA 3A11A 3QVYA 1RKCA 2ETSA 4ZLDA 2CYDA 2Q9CA 3WHNA 3GM2A 2DYSC 3X2QC 5D1KB 3HCSA 3O36A 3JRMO 5K0IA 4XLPF 2AWCA 5FEYA 2O9XA 2R7VA 5EHHA 1CGNA 2EPMX 4MW3A 2JMDA 2CSVA 4LDKA 1YVIA 2XXAB 3FJUB 3S9OA 5B77A 1WE9A 2M1RA 2F42A 4E17A 2HSBA 2BE5F 2VP7A 3PHF2 3N9QA 2MWQA 2YQLA 3KL4A 4N6HA 1LE2A 4CX9A 2EIKC 4QQ4A 1N87A 1Z23A 4IAOA 4Q4ZF 3M1CB 5FERA 2HKVA 1DVPA 3O35A 2F22A 2J45A 4C3DA 4CJGA 3KV5A 1VYXA 4JJGA 4PACA 1HMDA 2XRHA 4NTAA 1WEWA 2H0DB 5COFA 2H8AA 3L0IA 3L1ZB 5IY5C 3U3FA 2QIZA 1SR2A 1M6TA 3AJMA 2NUPB 4H9DA 1HYIA 3HJCA 2VCCA 4XEFA 2XSEA 4CS8C 5C13A 5H1UA 3N0TA 2NUTA 2WVNA 3V5XA 2L43A 1SMYF 2I50A 5JRAA 4WABA 2YSMA 4M63A 5L3VA 3ZVZB 1G4WR 5EGYA 1MNEA 3LJUX 3ZWIA 1WIMA 1K05A 4XEVA 3ASNC 4YL3A 2GA0A 3DMDA 3KV6A 3N24A 5D1LB 2J7PA 5HSWA 3FANA 3K1HA 1FR0A 3R2PA 2L9JA 5B3SC 4L58A 2VJEB 3VK6A 4CSAC 5E2QA 3QMKA 1W2WA 3ZPV1 1Z6UA 2AWYA 2CRWA 2HS5A 3I5QA 2XXAA 1ZHYA 3ZIBA 4EIYA 5KH9A 3RFYA 1E85A 1OR2A 4LDRA 4ZQLA 3DKAA 4ER9A 1PCXA 5TDRA 4AE4A 1G5ZA 1ZU4A 4TKPB 3C6WA 3W8HA 2QTVA 4AL1A 5DS4A 5F5FA 3AQCA 1ZW3A 1UG7A 2NG1A 1ST6A 4JURI 3VYWA 3Q6NA 4E0HA 3MX3A 2P7VA 5A6BD 4MVUA 4BJ6A 3AGUA 2KWKA 1FNTc 2YL0A 2L6GA 5B78A 4GNEA 1YAUO 3IQ6A 1M56C 1FTSA 4O6YA 4G7ZF 2A69F 5AIUA 4EHPA 1ZW2A 1QKRA 1BDJB 5JVEA 1WOLA 3ZYQA 1TWHA 3T6GB 1WEMA 4E7ZA 3PUQA 4C3BA 3ECSA 4S3OC 4WGYA 3M7KA 2NUPA 5DVWA 5LCWB 1M2OA 2VNFA 2ZXRA 3JSEO 3HNKA 1ZHXA 2JX0A 2YVRA 4L6RA 3LEVA 1NU9C 1T6IA 4C7OB 3C7JA 4PTBA 2KKYA 1IZMA 2KW3C 4BJTA 3OEOA 4L7XA 3RKOF 2W4MA 5DQZA 3AG4C 4IGGA 2LQ6A 3EB6A 3H2VA 2H7OA 3FDQA 2ZETC 1T1HA 1YYXA 5DS5A 4DRIB 3IQCA 4N6CA 1A41A 2HFIA 2X0CA 4NCQA 3FL2A 1Y6DA 4V3KC 1Z6AA 4OIQF 3M15A 2LGLA 2LSEA 3MLGA 2E87A 2Y39A 2TMVP 5B3IA 1PD0A 3N9PA 1V74B 2KNHA 2OOCA 3RVYA 3LQIA 3O39A 4GYTA 4MTGA 4UP0A 2WVOA 1WWPA 2XLDA 3LEOA 3LNMB 3UR3C 1R5ID 4U5HA 2CDQA 3UMHA 4YBTA 5B75A 1GGQA 1WEVA 2JM3A 2J9WA 2ZXOA 4IAQA 3IPMO 5DQTA 4HE8D 4R2YA 5BQGA 3DAGA 5A6AA 3S84A 4F52B 1F62A 1PV3A 1A7EA 2OEXA 4YBMA 3QTHA 3FVYA 3GEEA 1RJ9A 1LVKA 4UDVA 5H1VA 3MFNA 1TFOB 2Y1NA 2RI7A 4FK5A 4B7YC 4PJMA 2ZD9A 2CNWA 3J06A 2MIQA 1J8MF 4Z0OA 4WZ3B 1Q0KA 1EQ1A 2KC3A 1B68A 1NU7D 3SXZA 2DSMA 2IDAA 1X4IA 1RKEA 4AX2A 1OXBA 3O37A 2J9VA 5COGA 2YL1A 4BHWA 3NYMA 2F6JA 3ZQYA 4EBJA 2M13A 4A4BA 4Q5SF 1HE9A 1VYKA 3KH2A 3EPVA 1VFYA 2R9RB 4CIPA 2V3CC 3LNRA 2G43A 3EG9B 2DGJA 2XS8A 2PNOA 2LRIC 2BAYA 4IARA 2PUYA 1Z63A 3N9NA 4CCGX 2Q00A
chains in the Genus database with same CATH topology
3LQHA 4YABA 2K4DA 1MMGA 1ZU5A 4MSXA 2EIJC 4O64A 2FUUA 1Z5ZA 2J0XA 3DM9B 3W2WA 2L5UA 5TBNA 3O33A 2KJGA 3NYJA 4PFOA 4YBSA 5J3XA 3FHDA 1BR2A 1V54C 2PNXA 4OIPF 2YHOA 1FFHA 3GL6A 2EA6A 4F4BA 2YUCA 4G7HF 5D91A 2W45A 2K17A 3LLIA 2EINC 3LJBA 2XB1A 4JJFA 3K7DA 2YYRA 4A0CD 2ZXPA 4O6MA 2M6MA 5KYUA 3KKBA 2G3VA 3K6BA 3DQVR 4A2NB 2L81A 3T6JA 3PHDA 2CGEA 1OKKD 2G6QA 4C3EA 2ECJA 5KYYA 3ZG1A 4ZLDA 3ZNIA 3X1OA 2Q9CA 2Y3HA 2DX8A 5JG6A 4ZLCA 4QDLA 5T3TA 1WEUA 5D92A 2LV9A 5DKAA 2DYSC 2OCCC 3X2QC 5D1KB 3HCSA 4MNDA 2VPDA 5KYUB 3O36A 4XLPF 3NG2A 1ZHWA 4FX5A 5FEYA 4DBQA 4YJWA 2KGIA 3POVA 2O9XA 1G25A 4DVZA 2R7VA 5KYYB 5EHHA 3F46A 4LADB 3U5NA 4ZDTA 2JMIA 3DD7A 2JMJA 1VYIA 2JMDA 3EQLF 3U5MA 5B1BC 5DINA 5EYAF 2HV7A 1ZYRF 2CSZA 4I44A 4P6IC 3LLKA 4PPEA 1LDJB 3DM5A 4GNGA 2XXAB 5FB0A 4GB0A 2R7OA 3ABKC 3LESA 5B77A 4RDAA 4CS7A 3LS1A 1WE9A 2CT2A 2M1RA 2F42A 2M85A 2C03A 2E6SA 2VB6A 3AQBA 3GODA 2BE5F 3RPGC 4MQ9F 4U5GA 4BJ5C 3MHSA 4U5DE 2VP7A 3PHF2 1O87A 2YREA 3N9QA 4CS9A 2MWQA 2YQLA 4YT4A 4RBNA 3KL4A 5B79A 4OD5A 2EIKC 4W8KA 3NRHA 1N87A 3EGXA 4YAXA 4ZUXU 1TR2A 4YC9A 1Z23A 3C5KA 4AYCA 2PP4A 2MYSA 3JYHA 4BJ6C 1MNDA 4YADA 4IAOA 3NKDA 3Q7GA 4PK4A 1WEEA 2YT5A 3ZC4A 4I7BA 3O34A 1HYJA 2YZSA 5FCLA 2G45A 4Q4ZF 3M1CB 4A49A 5FERA 2H0DA 2I8BA 2Q3TA 4WJ0A 1DVPA 4OIOF 3S27A 3PURA 4KNVA 3O35A 3DJUB 4H4KC 2L75A 4LK9A 3T7LA 2R7XA 2J45A 3EGXB 4N3WA 4C3DA 4AYCB 2YQMA 3KV5A 1VYXA 4JJGA 2ECGA 2XRHA 2WB7A 4GEHA 4P5OB 2CKLA 3AG1C 2H7BA 3RH3A 2J0WA 2KR4A 1WEWA 2H0DB 4DOZA 1WFKA 3Q7LA 3V7OA 1D1AA 2PX0A 2OG2A 1RMDA 3HCUA 3EZHA 3N2ZB 3B0PA 4MVTA 3L0IA 3L1ZB 5IY5C 4ULWA 4HEAJ 2QIZA 2C04A 1U6GB 2ECNA 4IJJA 4G7OF 1D0ZA 2NUPB 4J30B 3E9VA 4UP5A 1TKNA 3CQZA 3N9OA 4CBEA 1WGWA 1HYIA 2PX3A 3HJCA 1KU2A 5E3CA 5KYWA 4PFPA 5DLJA 4Q6FA 2YHNA 4I1OB 2XSEA 2ZPAA 3ASOC 4CS8C 5C13A 5H1UA 3N0TA 2NUTA 2J46A 2WVNA 3WODF 2L43A 4R8PK 3FAJA 2CNWD 1XWHA 2ECWA 1SMYF 2I50A 4YATA 3JT1A 3AG3C 4LKAA 1Z60A 4X0RA 2ZXWC 3T6BA 4IWBA 2Z15A 4M63A 2YSMA 4N06A 2VH3A 3SZRA 5L3VA 2YHSA 4G0HA 5KYWB 5EGYA 2QICA 2YW8A 3ZVZB 1MNEA 2VJEA 5I3LA 1ZHTA 1WIMA 5B8DA 2W4BA 2J9UA 2NUTB 3ASNC 1WEPA 2KYUA 4AP4A 1LKXA 3DMDA 1NZEA 3KV6A 3DZAA 1OCCC 3N24A 2Y3GA 4KNWA 5D1LB 5B76A 2J7PA 1FBVA 5HSWA 3F47A 3EH1A 5AITA 3K1HA 1WILA 2EILC 2IXMA 3O6XA 4LJNA 2L9JA 5B3SC 1J8YF 1D1CA 4L58A 2VJEB 2KU3A 3W8IA 3VK6A 4CSAC 5E2QA 3QMKA 3EZIA 1WENA 1S7ZA 1W2WA 3SNHA 3DPLR 2KWOA 3ZPV1 2R7UA 1Z6UA 2G3KA 4JW1A 1IW7F 4HFKB 3QZCA 3UGOA 3N9MA 1X4UA 2R7SA 2WL8A 4A4CA 1LDKC 3ZVYA 3I5QA 2XXAA 3LQJA 1ZHYA 2HYED 2KWNA 3ZIBA 4QF3A 2WZFA 5KH9A 3RFYA 4ZQLA 1PCXA 5TDRA 4AE4A 1ZU4A 4TKPB 3C6WA 3W8HA 5B1AC 5H9MA 1MMDA 4LLEA 2QTVA 2VJFA 2F6NA 1M2VB 2A68F 5DS4A 5F5FA 1FP0A 4FESA 3AQCA 4HFFB 3SEOA 4N4FA 2NG1A 1ST6A 4JURI 2MUMA 4K0DA 3VYWA 1K2FA 3Q6NA 3EH2A 3MX3A 2P7VA 3PMRA 4OD4A 2W9YA 1JPJA 4AE4B 3B0VC 2XL4A 4BJ6A 2J7PD 1IYMA 5LKUA 1VOMA 2HV6A 3SOXA 2KWKA 5LKXA 5KYNA 2VJFB 1SF8A 3NYLA 4JCHA 5B78A 3HTKC 1N1CA 1OCRC 2LGGA 4GNEA 2Y3DA 2B0JA 3CSKA 3EFOA 4YN0B 5E33A 1D1BA 2QY9A 2MD7B 5G04B 5KH3A 3T4RA 1M56C 4XTKA 3SYNA 1FTSA 4O6YA 2ECIA 3ABLC 3T6RA 3ITFA 1Z3IX 4ANJA 3V43A 2MD8C 4G7ZF 2A69F 5AIUA 5F5HA 4XLNF 3IHPA 2G62A 2KQ9A 2KIZA 1PD1A 3LS0A 2DYRC 3EFOB 4IRUA 2V26A 3IEEA 4EBBA 3ZYQA 1TWHA 2JRJA 2YSJA 4E7SA 1ZBDB 3I4UA 1WEMA 4C7OA 4E7ZA 2NAAA 2L80A 3PUQA 4C3BA 3ECSA 4S3OC 3NKEA 4FO9A 2KGOA 2NUPA 1MM2A 5DVWA 3M62A 5LCWB 1M2OA 2VNFA 2EGPA 5KH7A 3SHBA 2ZXRA 1V87A 2A1DD 4PJLA 3VAYA 1ZHXA 4CS9C 3LEVA 2ECVA 4YT5A 4BBQA 3TD7A 1SZIA 1NU9C 4O79A 4CS8A 4EWCA 4C7OB 2P6VA 2FFHA 2K16A 2JD3A 1TWAA 4XI1A 4PTBA 5G05B 4YT2A 4X3GA 1IZMA 3WG7C 4BG0A 3UGPA 2A6EF 3ZTGA 2C2LA 3K33A 2KW3C 2LDRA 4BJTA 3O7AA 3OEOA 4L7XA 4CIHA 4O7GA 4QI0A 3RKOF 2AN6A 1BR4A 2W4MA 2Y69C 2M4EA 4YT8A 5DQZA 4I1MA 1X4JA 2E6RA 3AG4C 3Q6MA 1OCOC 2A6HF 4B86C 1E4UA 1FFTC 2UZGA 2LQ6A 5T3WA 3EB6A 3DXJF 1MM3A 3EGDB 5C11A 2IXNA 3UMKA 2LGVA 2IYLD 4I3MA 5TABA 2H7OA 3FDQA 2C2VS 4CSAA 2MT5A 2R7RA 2ZETC 1T1HA 5DS5A 1WGMA 4R7EA 3K1IC 2IXOA 4CA1A 4B6IA 1BR1A 4I7DA 2PF4E 2GFHA 3I5PA 3U5OA 2XEUA 2MNZA 2LGKA 3FL2A 4V3KC 1Z6AA 5E3AA 1Z2QA 4GNFA 5D1MB 5TRBA 5FB1A 3DAFA 4OIQF 2FUIA 4JZAA 3AG2C 2QJ0A 2LGLA 2D5RB 4KBLA 3HLZA 2LSEA 3MLGA 3ASLA 2E87A 4U5CE 4KC9A 5L3QA 1WEQA 2Y39A 1M2VA 2ECTA 2M3HA 1D0XA 2KWJA 4U5EE 1D0YA 5KYXA 1JOCA 1CHCA 2IXPA 1QLEC 1NG1A 2WZGA 5TDWA 4FIPA 2MNYA 2D8SA 1PD0A 2LN0A 4OINF 3N9PA 4BEJA 3MHHA 3OWTA 2KNHA 3DJNB 3KQIA 1TWCA 2R7QA 4RD9A 4DVYP 4K7BA 2RSDA 1FMVA 2EODA 3JCUQ 2WZLA 3O39A 3LQIA 3M99A 3CZ6A 4GYTA 3KMIA 4NY3A 4BJ5A 2K1JA 4UP0A 2WVOA 3SOUA 2Y3BA 5KYXB 3UR3C 4I7CA 5CI8A 4UI9B 2FGYA 3EHNA 4AUQB 2VPEA 3HCTA 3GV4A 1MMAA 4U5HA 2CDQA 3SP1A 3I2DA 2EIMC 5BUOA 3U5PA 4PJNA 1OCZC 3K66A 3UMHA 2MA5A 4W4UA 4YBTA 5B75A 4LLCA 1TWGA 3ZPVE 3RPGB 2YU4A 4WZ0A 1WEVA 2J9WA 1VD4A 2ZXOA 3QZVA 1JM7A 1VMAA 2KFTA 2Q9BA 3OA1A 3B0UX 2MA6A 1QZXA 2KGGA 4V3LC 3LAYA 3ZVRA 3L1XA 3EJNA 2FSAA 4JVSA 4YWQA 3NDBB 3B9QA 1VK5A 1V55C 5DQTA 4HE8D 4R2YA 4WA6A 3DAGA 4F52B 1F62A 4QF2A 4YBMA 3M63A 4AK9A 3EB5A 4Q7CA 3FVYA 2KE1A 1JM7B 4FJCA 3RYLA 1RJ9A 2OXQC 1LVKA 3L11A 4OIRF 5H1VA 2CSYA 2Y1NA 2RI7A 3H65A 5DS6A 4FK5A 1WESA 4NN2A 2Y1MA 4XWJA 4B7YC 4PJMA 4S3OB 3RTRB 4FWVA 5LKZA 5H1TA 2CNWA 1MMNA 1M57C 3ZSUA 3RIPA 3ABMC 2KREA 3S28A 1WEOA 2L0BA 3S0XA 1FMWA 2MIQA 1J8MF 2X51A 2YEVA 4WZ3B 1RJ9B 4LERA 5LKTA 3E70C 4QI2A 4AVXA 2VASA 2LXHC 3S29A 3N9LA 3EHMA 1JPNA 4IC3A 3KNVA 4LACB 4O6NA 2H7VC 3L34A 2PFDA 3EGDA 1NU7D 2IDAA 4GNDA 1O5HA 1X4IA 2IOQA 3EG9A 3GANA 4AX2A 4BJ1A 3LRQA 3O37A 4IC2A 2CW0F 2J9VA 3JRTA 4PJJA 5G0FA 4BHWA 3NYMA 2F6JA 2R7WA 4A4BA 4Q5SF 1VYKA 1OKKA 3KH2A 4LLBA 3EPVA 2WVQA 1VFYA 3UMIA 4KI2A 2HDPA 5T1DB 4J32B 1BORA 2V3CC 3W2VA 1ZHZA 3UNGC 2VPBA 3JSZA 3LNRA 2G43A 2VPGA 2Q9AA 2R7TA 3EG9B 2CKLB 2YURA 3O70A 3SOWA 2DGJA 4C9ZA 2LXPC 1LS1A 4DBRA 2LRIC 2Y43A 2BAYA 2PUYA 4U5FE 1Z63A 3N9NA 3NG1A 5CI9A 4U5BE 4CCGX 1G8XA 4WZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQH A;  4YAB A;  2K4D A;  4MSX A;  4O64 A;  2FUU A;  2L5U A;  5TBN A;  3O33 A;  4YBS A;  5J3X A;  2PNX A;  2YHO A;  3GL6 A;  2EA6 A;  2YUC A;  2K17 A;  2XB1 A;  2YYR A;  4A0C D;  2M6M A;  3DQV R;  3PHD A;  2G6Q A;  2ECJ A;  3ZNI A;  2DX8 A;  5JG6 A;  1WEU A;  2LV9 A;  5DKA A;  5D1K B;  3HCS A;  2VPD A;  3O36 A;  3NG2 A;  5FEY A;  2KGI A;  1G25 A;  4LAD B;  3U5N A;  4ZDT A;  2JMI A;  2JMJ A;  2JMD A;  3U5M A;  5DIN A;  5EYA F;  2CSZ A;  4PPE A;  1LDJ B;  4GNG A;  5FB0 A;  4GB0 A;  5B77 A;  2CT2 A;  1WE9 A;  2M1R A;  2M85 A;  2F42 A;  2E6S A;  3RPG C;  3MHS A;  2VP7 A;  2YRE A;  3N9Q A;  2YQL A;  5B79 A;  4YAX A;  1N87 A;  4ZUX U;  4YC9 A;  3C5K A;  4AYC A;  4YAD A;  2YT5 A;  1WEE A;  4I7B A;  3O34 A;  1HYJ A;  2G45 A;  4A49 A;  5FER A;  2H0D A;  1DVP A;  3PUR A;  3O35 A;  4LK9 A;  2L75 A;  3T7L A;  4N3W A;  4AYC B;  2YQM A;  3KV5 A;  1VYX A;  2ECG A;  4P5O B;  2CKL A;  2KR4 A;  1WEW A;  2H0D B;  1WFK A;  1RMD A;  3HCU A;  4MVT A;  3L1Z B;  2QIZ A;  1U6G B;  2ECN A;  4UP5 A;  1HYI A;  3N9O A;  4Q6F A;  2YHN A;  5C13 A;  5H1U A;  2L43 A;  4R8P K;  2ECW A;  1XWH A;  2I50 A;  4YAT A;  4LKA A;  1Z60 A;  2YSM A;  2QIC A;  3ZVZ B;  2YW8 A;  2VJE A;  5I3L A;  1WIM A;  5B8D A;  2KYU A;  1WEP A;  4AP4 A;  3KV6 A;  5D1L B;  5B76 A;  1FBV A;  5AIT A;  1WIL A;  4LJN A;  4L58 A;  2VJE B;  2KU3 A;  3VK6 A;  1WEN A;  3DPL R;  2KWO A;  3ZPV 1;  1Z6U A;  3N9M A;  1X4U A;  4A4C A;  1LDK C;  3ZVY A;  3LQJ A;  2HYE D;  2KWN A;  4QF3 A;  5KH9 A;  4ZQL A;  5TDR A;  4TKP B;  3C6W A;  5H9M A;  2VJF A;  2F6N A;  1FP0 A;  4N4F A;  2MUM A;  1K2F A;  1IYM A;  5LKU A;  3SOX A;  2KWK A;  5LKX A;  2VJF B;  5B78 A;  3HTK C;  2LGG A;  4GNE A;  2MD7 B;  5G04 B;  5KH3 A;  2ECI A;  3T6R A;  3V43 A;  2MD8 C;  5AIU A;  3IHP A;  2KIZ A;  3ZYQ A;  2JRJ A;  2YSJ A;  1ZBD B;  1WEM A;  2NAA A;  2L80 A;  3PUQ A;  4S3O C;  4FO9 A;  1MM2 A;  3M62 A;  5LCW B;  2VNF A;  5KH7 A;  2EGP A;  3SHB A;  1V87 A;  2ECV A;  4BBQ A;  2K16 A;  4XI1 A;  4PTB A;  5G05 B;  4X3G A;  3ZTG A;  2C2L A;  2LDR A;  3O7A A;  4L7X A;  2AN6 A;  1X4J A;  2E6R A;  4B86 C;  1E4U A;  2UZG A;  2LQ6 A;  3EB6 A;  1MM3 A;  5C11 A;  2LGV A;  5TAB A;  2C2V S;  2MT5 A;  2ZET C;  1T1H A;  1WGM A;  4R7E A;  4CA1 A;  4I7D A;  3U5O A;  2XEU A;  2MNZ A;  2LGK A;  3FL2 A;  4V3K C;  5TRB A;  1Z2Q A;  4GNF A;  5D1M B;  5FB1 A;  2FUI A;  2QJ0 A;  2LGL A;  3ASL A;  1WEQ A;  2ECT A;  2M3H A;  2KWJ A;  1JOC A;  1CHC A;  5TDW A;  4FIP A;  2MNY A;  2D8S A;  2LN0 A;  3N9P A;  3MHH A;  3KQI A;  2RSD A;  2EOD A;  3LQI A;  3M99 A;  2K1J A;  4UP0 A;  3SOU A;  4I7C A;  4UI9 B;  4AUQ B;  2VPE A;  3HCT A;  3GV4 A;  3I2D A;  3U5P A;  2MA5 A;  4W4U A;  4YBT A;  5B75 A;  3ZPV E;  3RPG B;  2YU4 A;  4WZ0 A;  1WEV A;  1VD4 A;  3QZV A;  1JM7 A;  2KFT A;  2MA6 A;  2KGG A;  4V3L C;  3L1X A;  2FSA A;  4R2Y A;  4WA6 A;  4F52 B;  1F62 A;  4QF2 A;  4YBM A;  3M63 A;  3EB5 A;  1JM7 B;  2KE1 A;  4FJC A;  2OXQ C;  3L11 A;  5H1V A;  2CSY A;  2Y1N A;  2RI7 A;  4FK5 A;  1WES A;  4NN2 A;  2Y1M A;  4B7Y C;  4S3O B;  3RTR B;  5LKZ A;  5H1T A;  2KRE A;  1WEO A;  2L0B A;  2MIQ A;  4WZ3 B;  5LKT A;  4AVX A;  2LXH C;  3N9L A;  4IC3 A;  3KNV A;  2IDA A;  4GND A;  1X4I A;  4IC2 A;  3LRQ A;  3O37 A;  5G0F A;  4BHW A;  2F6J A;  4A4B A;  4LLB A;  1VFY A;  2HDP A;  1BOR A;  2VPB A;  2G43 A;  3SOW A;  2VPG A;  2CKL B;  2YUR A;  3O70 A;  4C9Z A;  2LXP C;  2Y43 A;  2LRI C;  2BAY A;  2PUY A;  3N9N A;  4CCG X;  4WZ2 A; 
#chains in the Genus database with same CATH topology
 1MMG A;  4MSX A;  2L5U A;  4EKW A;  5TBN A;  1LI5 A;  3C63 A;  1E84 A;  5TJ5 E;  1GQA A;  3U9M A;  3HKK A;  2YHO A;  2EA6 A;  3O10 A;  2XB1 A;  2YYR A;  4A0C D;  1T5O A;  1QVX A;  1YAR O;  3T6J A;  2P61 A;  2CGE A;  1OKK D;  4C3E A;  5KYY A;  2Y3H A;  4ZLC A;  3QW0 A;  3DE9 A;  5T3T A;  1WEU A;  5D92 A;  1R4T A;  2LV9 A;  5DKA A;  3JTL O;  2OCC C;  3RVZ A;  2VPD A;  5KYU B;  3NG2 A;  1ZHW A;  4DBQ A;  2HZ8 A;  3POV A;  4DVZ A;  1XWJ A;  3U5N A;  4ZDT A;  3DD7 A;  3S90 A;  1QQ3 A;  5B1B C;  2HV7 A;  4I44 A;  2LFD A;  1LDJ B;  3DM5 A;  2KYH A;  3LES A;  4NTF A;  3NMJ A;  1YA9 A;  2E6S A;  1ORS C;  4MQ9 F;  4U5G A;  4YL0 A;  4DRJ B;  4RBN A;  3EGX A;  1TR2 A;  2YT5 A;  4PK4 A;  4I7B A;  2G45 A;  2I8B A;  4LK9 A;  4GQH A;  2LD6 A;  2ECG A;  5A69 A;  2YLD A;  2WB7 A;  4GEH A;  2YL3 A;  1C17 M;  2J0W A;  2ASR A;  1YZA A;  1LIH A;  3L1M A;  2OG2 A;  3EZH A;  4ULW A;  4HEA J;  2A0U A;  2C04 A;  3QVZ A;  1D0Z A;  4J30 B;  3E9V A;  1WGW A;  5FZT A;  1KU2 A;  5E3C A;  4PFP A;  3L8J A;  2CNW D;  5JLI A;  4XQ1 A;  4YAT A;  2FD4 A;  3T6B A;  4IWB A;  5I3L A;  2HJ3 A;  2KYU A;  2NUT B;  1LKX A;  3DZA A;  5A6B A;  4JRZ A;  5B76 A;  3EH1 A;  2EIL C;  3O6X A;  2XP0 A;  3W8I A;  2VCB A;  1WAS A;  2KKX A;  1WTY A;  4HFK B;  3QZC A;  2R02 A;  1XZQ A;  1X4U A;  2R7S A;  2WL8 A;  2YKZ A;  3LQJ A;  2HYE D;  4QF3 A;  2IBF A;  2WZF A;  5SVY A;  5H9M A;  2EPL X;  4LLE A;  1H6G A;  4N4F A;  3NMK A;  2MUM A;  1QSP A;  4K0D A;  3PMR A;  5L0C A;  4AE4 B;  2XL4 A;  3AGT A;  1IYM A;  5LKU A;  1VOM A;  3SOX A;  3TJ6 A;  5SVX A;  2L6H A;  3HTK C;  2LGG A;  3EFO A;  4YN0 B;  2QY9 A;  4A4A A;  5G04 B;  3SYN A;  1E86 A;  2ECI A;  3ABL C;  1Z3I X;  5F5H A;  4XLN F;  2VC9 A;  2V26 A;  2YSJ A;  4E7S A;  3QW1 A;  2NAA A;  1VB5 A;  4FO9 A;  2XLE A;  1MM2 A;  3M62 A;  3VAY A;  3E2D A;  2ECV A;  4Z0R A;  4EWC A;  2KK1 A;  4DRH B;  1T6U A;  3RF3 A;  4X3G A;  4JIO A;  3K33 A;  1JOG A;  4O62 A;  2LDR A;  3O7A A;  2YVK A;  1CGM E;  3LVQ E;  2Y69 C;  4YT8 A;  1X4J A;  1OCO C;  2A6H F;  4OGC A;  4B86 C;  1FFT C;  3KYJ A;  2UZG A;  5T3W A;  1MM3 A;  3EGD B;  3DDT A;  3UMK A;  2C2V S;  1WGM A;  4R7E A;  3DI5 A;  4B6I A;  2RSE B;  2PF4 E;  2GFH A;  3U5O A;  2LGK A;  2D4U A;  1Z2Q A;  3VRC A;  2AP3 A;  2FUI A;  5FB1 A;  4JZA A;  3AG2 C;  1RCP A;  4KBL A;  3ASL A;  4KC9 A;  2KWJ A;  1LI7 A;  1JOC A;  2P57 A;  4XEK A;  2QE9 A;  1JRA A;  1NG1 A;  5TDW A;  1Q0G A;  2LN0 A;  4OIN F;  5K3Q A;  4BEJ A;  3MDB C;  3KPH A;  1TWC A;  2R7Q A;  4RD9 A;  4DVY P;  4K7B A;  1FMV A;  3JCU Q;  2WZL A;  3C62 A;  3CZ6 A;  3GEH A;  3KMI A;  4BJ5 A;  4CDV A;  2Y3B A;  1F1M A;  5JSL A;  4UI9 B;  5JP7 A;  3GV4 A;  3I2D A;  2EIM C;  5L0D A;  3T9K A;  4LLC A;  1UFB A;  1T6Q A;  2YU4 A;  4WZ0 A;  1VD4 A;  1JM7 A;  1VMA A;  3IQ5 A;  3OA1 A;  2KGG A;  3LAY A;  3L1X A;  4JVS A;  4YWQ A;  3B9Q A;  1E2X A;  1VK5 A;  4ONS A;  4DJ9 A;  4AK9 A;  4JTC B;  5HV9 A;  3VF0 A;  2EGM A;  4NC3 A;  2OXQ C;  2XS1 A;  3L11 A;  2CSY A;  4JEA A;  2AU5 A;  5DS6 A;  4NN2 A;  2LCH A;  4FWV A;  1G4U S;  1WEO A;  2YEV A;  1RJ9 B;  5LKT A;  2XLW A;  3M79 A;  3E70 C;  1TQG A;  3EHM A;  4IC3 A;  4O6N A;  3EGD A;  2FFW A;  2IOQ A;  3C8Z A;  4U9E A;  5G0F A;  5GPG B;  2OU6 A;  1OKK A;  3H7H A;  2WVQ A;  3UMI A;  5T1D B;  4J32 B;  3W2V A;  2VPB A;  3UNG C;  1RKE B;  1JAF A;  2LXP C;  4DBR A;  3C8G D;  3MBG A;  5CI9 A;  4U5B E;  1G8X A;  3LQH A;  1ZU5 A;  1L3P A;  1TFK B;  3O33 A;  3V5Y A;  2DJA A;  4PFO A;  4YBS A;  5J3X A;  2A0B A;  4YK5 A;  2YUC A;  5D91 A;  2W45 A;  1BBH A;  3LJB A;  2L81 A;  2P1A A;  5L0H A;  2YLI A;  2G6Q A;  2ECJ A;  4AL0 A;  3ZNI A;  3X1O A;  2BL2 A;  4QDL A;  3C18 A;  2JPU A;  4Z9H A;  4MND A;  2KGI A;  2L7P A;  3VM6 A;  1G25 A;  1CPQ A;  5KYY B;  1LPE A;  2JMJ A;  4JC7 A;  1ZZP A;  3EQL F;  5EYA F;  1ZYR F;  2CSZ A;  4P6I C;  2NSG A;  4GB0 A;  3ABK C;  3O55 A;  4CS7 A;  3LS1 A;  2R25 A;  5L0I A;  2VB6 A;  3AQB A;  3GOD A;  3RPG C;  1K04 A;  4BJ5 C;  4U5D E;  1YYJ A;  2LP4 A;  1AUE A;  1O87 A;  4MVM A;  2YRE A;  4CS9 A;  5COM A;  5B79 A;  4OD5 A;  4MW8 A;  3HNL A;  4W8K A;  4YC9 A;  3C5K A;  4AYC A;  3JYH A;  2MYS A;  4BJ6 C;  1MND A;  4YAD A;  3NKD A;  3Q7G A;  4MTO A;  3ZC4 A;  3HNJ A;  3O34 A;  2L7A A;  2YZS A;  2Q3T A;  4WJ0 A;  4OIO F;  3PUR A;  4KNV A;  4H4K C;  2L75 A;  3T7L A;  3EGX B;  3U3B A;  4N3W A;  4P5O B;  3AG1 C;  2H7B A;  3RH3 A;  2KR4 A;  2LFF A;  1WFK A;  3V7O A;  3HCU A;  4MVR A;  1D1A A;  2B0H A;  2PX0 A;  2HMQ A;  3N2Z B;  3PDM P;  1FAP B;  1H9T A;  2ECN A;  3K1I A;  4IJJ A;  4G7O F;  2Q7R A;  4UP5 A;  1TKN A;  3CQZ A;  3N9O A;  4CBE A;  2PX3 A;  5KYW A;  5DLJ A;  2YHN A;  2ZPA A;  3WOD F;  4R8P K;  1XWH A;  3JT1 A;  3AG3 C;  1Z60 A;  4X0R A;  1L7C A;  2Z15 A;  2VH3 A;  2YHS A;  4G78 A;  1ZHT A;  5B8D A;  2J9U A;  1WEP A;  4KNW A;  4ULV A;  1FBV A;  4R32 A;  2EXU A;  3FOO A;  5AIT A;  2IXM A;  4LJN A;  1D1C A;  4N4W A;  3GWN A;  3EZI A;  1S7Z A;  2BC5 A;  3DPL R;  2R7U A;  1IW7 F;  5A6K A;  3N9M A;  4A4C A;  3ZVY A;  4E0I A;  4DXW A;  4J7T A;  5B1A C;  1MMD A;  2VJF A;  4F1P A;  4FES A;  1VTM P;  3SEO A;  3U0C A;  3SXM A;  1K2F A;  3EH2 A;  1NFO A;  1ZVZ A;  3ZDL A;  1HW1 A;  2HV6 A;  4H54 A;  5LKX A;  3M4C A;  1SF8 A;  3AOU A;  3NYL A;  4JCH A;  1N1C A;  1OCR C;  1OQC A;  2B0J A;  1U6H A;  1D1B A;  2MD7 B;  5KH3 A;  2HSQ A;  3GOR A;  3T6R A;  3ITF A;  2EPK X;  4ANJ A;  2ICW G;  2MD8 C;  3IHP A;  2G62 A;  5AGF A;  2KQ9 A;  1PD1 A;  1K40 A;  2DYR C;  3EFO B;  4IRU A;  3IEE A;  4EBB A;  5SVI A;  5AC4 A;  5JUA A;  2JRJ A;  3I4U A;  1AEP A;  2KGO A;  1U89 A;  1LE4 A;  3JYY A;  3WAQ A;  2EGP A;  3SHB A;  1KNY A;  4PJL A;  4BEM J;  4CS9 C;  4YT5 A;  4BBQ A;  2MHR A;  3TD7 A;  1SZI A;  4CS8 A;  2XOC A;  1SYQ A;  2K16 A;  2FFH A;  4XI1 A;  1ORJ A;  4WGZ A;  5G05 B;  4Z9I A;  4YT2 A;  3WG7 C;  4BG0 A;  3UGP A;  2A6E F;  3ZTG A;  2C2L A;  1EI7 A;  1VLT A;  4O7G A;  3L8I A;  4MVZ A;  4QI0 A;  2AN6 A;  1BR4 A;  2M4E A;  3T9O A;  1DOV A;  2E6R A;  5A6J A;  3G4Z A;  2IXN A;  4MVO A;  5TAB A;  4D4X A;  3US6 A;  4CSA A;  4IB4 A;  2MT5 A;  2R7R A;  4NQF A;  3TOM A;  3GWL A;  3K1I C;  3RQF A;  1U0B B;  1BR1 A;  2Q4F A;  4P9T A;  3I5P A;  3NMI A;  2MNZ A;  3DWD A;  5E3A A;  5D1M B;  5TRB A;  3DAF A;  4U5C E;  5L3Q A;  1WEQ A;  2M3H A;  5BQI A;  1D0X A;  4U5E E;  1D0Y A;  3V5Z A;  5KYX A;  2IXP A;  2WZG A;  3U8V A;  4FIP A;  5JT4 A;  2KSF A;  1OXK A;  1QPU A;  3DJN B;  3KQI A;  1Z7Q c;  4W8P A;  3M99 A;  3Q1D A;  2XL6 A;  4NY3 A;  2K1J A;  3W4Y A;  3SOU A;  4I7C A;  5CI8 A;  3ZTZ A;  2FGY A;  4LDQ A;  4AUQ B;  2VPE A;  3HCT A;  1MMA A;  3SP1 A;  3FAP B;  5BUO A;  3U5P A;  1OCZ C;  3K66 A;  2MA5 A;  5EK0 A;  3ZPV E;  3RPG B;  2B0O E;  3G50 A;  1I4Z A;  2KFT A;  3B0U X;  2MA6 A;  1QZX A;  3TJ5 A;  2YWA A;  1RMV A;  3EJN A;  2FSA A;  3FXH A;  3NDB B;  3CEX A;  1V55 C;  4WA6 A;  3M63 A;  3EB5 A;  4Q7C A;  1JM7 B;  3RYL A;  3C8G A;  3H65 A;  1WES A;  2Y1M A;  4XWJ A;  3RTR B;  2E61 A;  5LKZ A;  1MMN A;  1EA8 A;  3M4B A;  3ZSU A;  2KRE A;  3S28 A;  1GM5 A;  3ATP A;  3GM3 A;  2L0B A;  2X51 A;  5CIV A;  4LER A;  4XPX A;  2LXH C;  3N9L A;  1JPN A;  2LQG A;  2H7V C;  3L34 A;  4CDY A;  2PFD A;  2XL8 A;  4GND A;  3KDE C;  2GDC A;  1O5H A;  4IC2 A;  3JRT A;  1YZC A;  2LIG A;  3B71 A;  2HDP A;  1LM3 B;  1BOR A;  2OEV A;  2VPG A;  3SOW A;  2CKL B;  2YUR A;  3O70 A;  4C9Z A;  1LS1 A;  2UUH A;  2J8W A;  4E18 A;  4WZ2 A;  2K4D A;  4JEB A;  1H9G A;  3BRJ A;  2D8U A;  2FUU A;  2J0X A;  3FM8 C;  3W2W A;  1DCQ A;  3FHD A;  1BR2 A;  4CJO A;  2OJE D;  1FFH A;  4F4B A;  1NLX A;  2MKE A;  1AVO B;  2K17 A;  2EIN C;  4JJF A;  2YRF A;  2ZXP A;  4U9D A;  2YQY A;  3CAX A;  4O6M A;  3KYI A;  4YL1 A;  3KKB A;  3DQV R;  5L0G A;  3SXK A;  3ZG1 A;  2DX8 A;  5JG6 A;  1KTM A;  1VLS A;  4FX5 A;  3IQT A;  4YJW A;  1EKY A;  4LAD B;  3F46 A;  4MVQ A;  4FAP B;  2JMI A;  1VYI A;  2XLO A;  3BEH A;  3U5M A;  2J9B A;  5DIN A;  3LLK A;  3A9C A;  4PPE A;  5L0J A;  1JR8 A;  4GNG A;  5FB0 A;  2R7O A;  4RDA A;  2CT2 A;  2M85 A;  2C03 A;  3MHS A;  2OQM A;  5AC5 A;  2OJQ A;  2DI3 A;  4YT4 A;  1CGO A;  3NRH A;  4YAX A;  4ZUX U;  1T9K A;  2CON A;  2PP4 A;  1S05 A;  2AVK A;  2XLH A;  2P0N A;  4PR9 A;  3TQO A;  1WEE A;  1HYJ A;  5FCL A;  3SUB A;  4A49 A;  2H0D A;  3S27 A;  2VCA A;  1E83 A;  3DJU B;  2R7X A;  3U2M A;  1HY5 A;  1NBB A;  4AYC B;  2RR4 A;  2HJM A;  2YQM A;  1OR3 A;  4JKV A;  4CDA A;  4P9F A;  1T01 A;  2LK4 A;  2CKL A;  3TUL A;  4DOZ A;  3U9J A;  2CCY A;  1ORY A;  3Q7L A;  1RMD A;  2YLG A;  1C03 A;  1CPR A;  4MVT A;  3B0P A;  1MQV A;  3GM1 A;  1U6G B;  2GAQ A;  3U8P A;  4Q6F A;  4I1O B;  2DB4 A;  3ASO C;  2J46 A;  3DWW A;  3RQE A;  3FAJ A;  2ECW A;  3TK0 A;  4LKA A;  2ZXW C;  1H7I A;  5BQH A;  4N06 A;  3SZR A;  2QIC A;  4G0H A;  5KYW B;  2YW8 A;  2VJE A;  2W4B A;  2R05 A;  4AP4 A;  3HNI A;  1NZE A;  1OCC C;  2Y3G A;  1YA7 O;  1OW7 A;  3F47 A;  3LDY A;  1WIL A;  3FOP A;  1A0B A;  1J8Y F;  4D4N A;  2KU3 A;  1WEN A;  3SNH A;  2KWO A;  2G3K A;  4JW1 A;  3GEI A;  2XOY A;  3UGO A;  2JUN A;  1LDK C;  4XPW A;  2KWN A;  1WN0 A;  2R03 A;  2UUI A;  2LAU A;  2F6N A;  1M2V B;  2A68 F;  1FP0 A;  3FAO A;  4HFF B;  1XZP A;  4OD4 A;  2W9Y A;  1JPJ A;  3G4X A;  3B0V C;  2J7P D;  3PLW A;  5KYN A;  2VJF B;  1BZ4 A;  4MS2 A;  4EUK B;  1NSG B;  2Y3D A;  3CSK A;  5E33 A;  4NTB A;  3T4R A;  4XTK A;  1YLM A;  4J7Y A;  3V43 A;  2QNL A;  3U2L A;  2KIZ A;  3LS0 A;  3H2U A;  4K1O A;  1JMW A;  1ZBD B;  4JTA B;  4C7O A;  2GWW A;  3JUE A;  2L80 A;  3DE8 A;  2FAP B;  3NKE A;  5KH7 A;  1V87 A;  1Q0F A;  2A1D D;  3R7C A;  1Y4C A;  5SVI B;  4O79 A;  3MYI A;  2P6V A;  2JD3 A;  1TWA A;  2RD9 A;  3JZ0 A;  4CIH A;  4JE9 A;  4I1M A;  2IQJ A;  3Q6M A;  3O47 A;  1E4U A;  3SXY A;  2EPO A;  3DXJ F;  5C11 A;  1YJG A;  3U5S A;  2LGV A;  2IYL D;  4I3M A;  4XPY A;  1LS4 A;  2IXO A;  4CA1 A;  4I7D A;  1YDI A;  3B29 A;  2XEU A;  4GNF A;  2CRR A;  2OWA A;  1RXQ A;  2QLA A;  2QJ0 A;  2D5R B;  1C02 A;  3HLZ A;  2PBE A;  5F28 E;  2ECT A;  1M2V A;  3FEH A;  2HMZ A;  1CHC A;  1QLE C;  1A7D A;  2MNY A;  2XM0 A;  2D8S A;  3MHH A;  3OWT A;  2RSD A;  2EOD A;  5JS5 A;  5KYX B;  2NSF A;  3EHN A;  1HE1 A;  1A7V A;  3MYF A;  2EPN A;  1Q0D A;  4PJN A;  4W4U A;  1TWG A;  1WAT A;  3LVR E;  3QZV A;  5L0F A;  1OW6 A;  1Q0M A;  2Q9B A;  4V3L C;  3ZVR A;  1GS9 A;  2HUJ A;  3IHU A;  4BPM A;  4QF2 A;  1OW8 A;  4Z9J A;  2NPU A;  2KE1 A;  4FJC A;  1I4Y A;  4JTD B;  1NFN A;  4OIR F;  3PCV A;  2I15 A;  1APC A;  4S3O B;  3TOL A;  5H1T A;  1M57 C;  3RIP A;  3ABM C;  2XOZ A;  2XLV A;  1I5N A;  1FMW A;  3S0X A;  2XLM A;  2M64 A;  3C8G B;  1HMO A;  4QI2 A;  4MVS A;  4AVX A;  2VAS A;  3S29 A;  3KNV A;  4LAC B;  1MBM A;  3GAN A;  3EG9 A;  1V4A A;  3LRQ A;  4BJ1 A;  3RW0 A;  2CW0 F;  4PJJ A;  2IM8 A;  2R7W A;  4LLB A;  4KI2 A;  1ZHZ A;  1HW2 A;  3JSZ A;  2OKU A;  3ZQV A;  2Q9A A;  2R7T A;  2Y43 A;  3FMS A;  4U5F E;  3ZTM A;  3NG1 A;  2XM4 A;  4YAB A;  1DOW A;  2EIJ C;  4O64 A;  256B A;  3LUT B;  1Z5Z A;  3DM9 B;  4OGE A;  2KJG A;  3NYJ A;  4MTF A;  4EBK A;  1O3U A;  1V54 C;  2PNX A;  2L6F A;  4OIP F;  3GL6 A;  4G7H F;  2YL7 A;  3LLI A;  3RQG A;  3K7D A;  4JCZ A;  2QUP A;  2M6M A;  5KYU A;  2G3V A;  3K6B A;  4A2N B;  3PHD A;  3A11 A;  3QVY A;  1RKC A;  2ETS A;  4ZLD A;  2CYD A;  2Q9C A;  3WHN A;  3GM2 A;  2DYS C;  3X2Q C;  5D1K B;  3HCS A;  3O36 A;  3JRM O;  5K0I A;  4XLP F;  2AWC A;  5FEY A;  2O9X A;  2R7V A;  5EHH A;  1CGN A;  2EPM X;  4MW3 A;  2JMD A;  2CSV A;  4LDK A;  1YVI A;  2XXA B;  3FJU B;  3S9O A;  5B77 A;  1WE9 A;  2M1R A;  2F42 A;  4E17 A;  2HSB A;  2BE5 F;  2VP7 A;  3PHF 2;  3N9Q A;  2MWQ A;  2YQL A;  3KL4 A;  4N6H A;  1LE2 A;  4CX9 A;  2EIK C;  4QQ4 A;  1N87 A;  1Z23 A;  4IAO A;  4Q4Z F;  3M1C B;  5FER A;  2HKV A;  1DVP A;  3O35 A;  2F22 A;  2J45 A;  4C3D A;  4CJG A;  3KV5 A;  1VYX A;  4JJG A;  4PAC A;  1HMD A;  2XRH A;  4NTA A;  1WEW A;  2H0D B;  5COF A;  2H8A A;  3L0I A;  3L1Z B;  5IY5 C;  3U3F A;  2QIZ A;  1SR2 A;  1M6T A;  3AJM A;  2NUP B;  4H9D A;  1HYI A;  3HJC A;  2VCC A;  4XEF A;  2XSE A;  4CS8 C;  5C13 A;  5H1U A;  3N0T A;  2NUT A;  2WVN A;  3V5X A;  2L43 A;  1SMY F;  2I50 A;  5JRA A;  4WAB A;  2YSM A;  4M63 A;  5L3V A;  3ZVZ B;  1G4W R;  5EGY A;  1MNE A;  3LJU X;  3ZWI A;  1WIM A;  1K05 A;  4XEV A;  3ASN C;  4YL3 A;  2GA0 A;  3DMD A;  3KV6 A;  3N24 A;  5D1L B;  2J7P A;  5HSW A;  3FAN A;  3K1H A;  1FR0 A;  3R2P A;  2L9J A;  5B3S C;  4L58 A;  2VJE B;  3VK6 A;  4CSA C;  5E2Q A;  3QMK A;  1W2W A;  3ZPV 1;  1Z6U A;  2AWY A;  2CRW A;  2HS5 A;  3I5Q A;  2XXA A;  1ZHY A;  3ZIB A;  4EIY A;  5KH9 A;  3RFY A;  1E85 A;  1OR2 A;  4LDR A;  4ZQL A;  3DKA A;  4ER9 A;  1PCX A;  5TDR A;  4AE4 A;  1G5Z A;  1ZU4 A;  4TKP B;  3C6W A;  3W8H A;  2QTV A;  4AL1 A;  5DS4 A;  5F5F A;  3AQC A;  1ZW3 A;  1UG7 A;  2NG1 A;  1ST6 A;  4JUR I;  3VYW A;  3Q6N A;  4E0H A;  3MX3 A;  2P7V A;  5A6B D;  4MVU A;  4BJ6 A;  3AGU A;  2KWK A;  1FNT c;  2YL0 A;  2L6G A;  5B78 A;  4GNE A;  1YAU O;  3IQ6 A;  1M56 C;  1FTS A;  4O6Y A;  4G7Z F;  2A69 F;  5AIU A;  4EHP A;  1ZW2 A;  1QKR A;  1BDJ B;  5JVE A;  1WOL A;  3ZYQ A;  1TWH A;  3T6G B;  1WEM A;  4E7Z A;  3PUQ A;  4C3B A;  3ECS A;  4S3O C;  4WGY A;  3M7K A;  2NUP A;  5DVW A;  5LCW B;  1M2O A;  2VNF A;  2ZXR A;  3JSE O;  3HNK A;  1ZHX A;  2JX0 A;  2YVR A;  4L6R A;  3LEV A;  1NU9 C;  1T6I A;  4C7O B;  3C7J A;  4PTB A;  2KKY A;  1IZM A;  2KW3 C;  4BJT A;  3OEO A;  4L7X A;  3RKO F;  2W4M A;  5DQZ A;  3AG4 C;  4IGG A;  2LQ6 A;  3EB6 A;  3H2V A;  2H7O A;  3FDQ A;  2ZET C;  1T1H A;  1YYX A;  5DS5 A;  4DRI B;  3IQC A;  4N6C A;  1A41 A;  2HFI A;  2X0C A;  4NCQ A;  3FL2 A;  1Y6D A;  4V3K C;  1Z6A A;  4OIQ F;  3M15 A;  2LGL A;  2LSE A;  3MLG A;  2E87 A;  2Y39 A;  2TMV P;  5B3I A;  1PD0 A;  3N9P A;  1V74 B;  2KNH A;  2OOC A;  3RVY A;  3LQI A;  3O39 A;  4GYT A;  4MTG A;  4UP0 A;  2WVO A;  1WWP A;  2XLD A;  3LEO A;  3LNM B;  3UR3 C;  1R5I D;  4U5H A;  2CDQ A;  3UMH A;  4YBT A;  5B75 A;  1GGQ A;  1WEV A;  2JM3 A;  2J9W A;  2ZXO A;  4IAQ A;  3IPM O;  5DQT A;  4HE8 D;  4R2Y A;  5BQG A;  3DAG A;  5A6A A;  3S84 A;  4F52 B;  1F62 A;  1PV3 A;  1A7E A;  2OEX A;  4YBM A;  3QTH A;  3FVY A;  3GEE A;  1RJ9 A;  1LVK A;  4UDV A;  5H1V A;  3MFN A;  1TFO B;  2Y1N A;  2RI7 A;  4FK5 A;  4B7Y C;  4PJM A;  2ZD9 A;  2CNW A;  3J06 A;  2MIQ A;  1J8M F;  4Z0O A;  4WZ3 B;  1Q0K A;  1EQ1 A;  2KC3 A;  1B68 A;  1NU7 D;  3SXZ A;  2DSM A;  2IDA A;  1X4I A;  1RKE A;  4AX2 A;  1OXB A;  3O37 A;  2J9V A;  5COG A;  2YL1 A;  4BHW A;  3NYM A;  2F6J A;  3ZQY A;  4EBJ A;  2M13 A;  4A4B A;  4Q5S F;  1HE9 A;  1VYK A;  3KH2 A;  3EPV A;  1VFY A;  2R9R B;  4CIP A;  2V3C C;  3LNR A;  2G43 A;  3EG9 B;  2DGJ A;  2XS8 A;  2PNO A;  2LRI C;  2BAY A;  4IAR A;  2PUY A;  1Z63 A;  3N9N A;  4CCG X;  2Q00 A; 
#chains in the Genus database with same CATH homology
 3LQH A;  4YAB A;  2K4D A;  1MMG A;  1ZU5 A;  4MSX A;  2EIJ C;  4O64 A;  2FUU A;  1Z5Z A;  2J0X A;  3DM9 B;  3W2W A;  2L5U A;  5TBN A;  3O33 A;  2KJG A;  3NYJ A;  4PFO A;  4YBS A;  5J3X A;  3FHD A;  1BR2 A;  1V54 C;  2PNX A;  4OIP F;  2YHO A;  1FFH A;  3GL6 A;  2EA6 A;  4F4B A;  2YUC A;  4G7H F;  5D91 A;  2W45 A;  2K17 A;  3LLI A;  2EIN C;  3LJB A;  2XB1 A;  4JJF A;  3K7D A;  2YYR A;  4A0C D;  2ZXP A;  4O6M A;  2M6M A;  5KYU A;  3KKB A;  2G3V A;  3K6B A;  3DQV R;  4A2N B;  2L81 A;  3T6J A;  3PHD A;  2CGE A;  1OKK D;  2G6Q A;  4C3E A;  2ECJ A;  5KYY A;  3ZG1 A;  4ZLD A;  3ZNI A;  3X1O A;  2Q9C A;  2Y3H A;  2DX8 A;  5JG6 A;  4ZLC A;  4QDL A;  5T3T A;  1WEU A;  5D92 A;  2LV9 A;  5DKA A;  2DYS C;  2OCC C;  3X2Q C;  5D1K B;  3HCS A;  4MND A;  2VPD A;  5KYU B;  3O36 A;  4XLP F;  3NG2 A;  1ZHW A;  4FX5 A;  5FEY A;  4DBQ A;  4YJW A;  2KGI A;  3POV A;  2O9X A;  1G25 A;  4DVZ A;  2R7V A;  5KYY B;  5EHH A;  3F46 A;  4LAD B;  3U5N A;  4ZDT A;  2JMI A;  3DD7 A;  2JMJ A;  1VYI A;  2JMD A;  3EQL F;  3U5M A;  5B1B C;  5DIN A;  5EYA F;  2HV7 A;  1ZYR F;  2CSZ A;  4I44 A;  4P6I C;  3LLK A;  4PPE A;  1LDJ B;  3DM5 A;  4GNG A;  2XXA B;  5FB0 A;  4GB0 A;  2R7O A;  3ABK C;  3LES A;  5B77 A;  4RDA A;  4CS7 A;  3LS1 A;  1WE9 A;  2CT2 A;  2M1R A;  2F42 A;  2M85 A;  2C03 A;  2E6S A;  2VB6 A;  3AQB A;  3GOD A;  2BE5 F;  3RPG C;  4MQ9 F;  4U5G A;  4BJ5 C;  3MHS A;  4U5D E;  2VP7 A;  3PHF 2;  1O87 A;  2YRE A;  3N9Q A;  4CS9 A;  2MWQ A;  2YQL A;  4YT4 A;  4RBN A;  3KL4 A;  5B79 A;  4OD5 A;  2EIK C;  4W8K A;  3NRH A;  1N87 A;  3EGX A;  4YAX A;  4ZUX U;  1TR2 A;  4YC9 A;  1Z23 A;  3C5K A;  4AYC A;  2PP4 A;  2MYS A;  3JYH A;  4BJ6 C;  1MND A;  4YAD A;  4IAO A;  3NKD A;  3Q7G A;  4PK4 A;  1WEE A;  2YT5 A;  3ZC4 A;  4I7B A;  3O34 A;  1HYJ A;  2YZS A;  5FCL A;  2G45 A;  4Q4Z F;  3M1C B;  4A49 A;  5FER A;  2H0D A;  2I8B A;  2Q3T A;  4WJ0 A;  1DVP A;  4OIO F;  3S27 A;  3PUR A;  4KNV A;  3O35 A;  3DJU B;  4H4K C;  2L75 A;  4LK9 A;  3T7L A;  2R7X A;  2J45 A;  3EGX B;  4N3W A;  4C3D A;  4AYC B;  2YQM A;  3KV5 A;  1VYX A;  4JJG A;  2ECG A;  2XRH A;  2WB7 A;  4GEH A;  4P5O B;  2CKL A;  3AG1 C;  2H7B A;  3RH3 A;  2J0W A;  2KR4 A;  1WEW A;  2H0D B;  4DOZ A;  1WFK A;  3Q7L A;  3V7O A;  1D1A A;  2PX0 A;  2OG2 A;  1RMD A;  3HCU A;  3EZH A;  3N2Z B;  3B0P A;  4MVT A;  3L0I A;  3L1Z B;  5IY5 C;  4ULW A;  4HEA J;  2QIZ A;  2C04 A;  1U6G B;  2ECN A;  4IJJ A;  4G7O F;  1D0Z A;  2NUP B;  4J30 B;  3E9V A;  4UP5 A;  1TKN A;  3CQZ A;  3N9O A;  4CBE A;  1WGW A;  1HYI A;  2PX3 A;  3HJC A;  1KU2 A;  5E3C A;  5KYW A;  4PFP A;  5DLJ A;  4Q6F A;  2YHN A;  4I1O B;  2XSE A;  2ZPA A;  3ASO C;  4CS8 C;  5C13 A;  5H1U A;  3N0T A;  2NUT A;  2J46 A;  2WVN A;  3WOD F;  2L43 A;  4R8P K;  3FAJ A;  2CNW D;  1XWH A;  2ECW A;  1SMY F;  2I50 A;  4YAT A;  3JT1 A;  3AG3 C;  4LKA A;  1Z60 A;  4X0R A;  2ZXW C;  3T6B A;  4IWB A;  2Z15 A;  4M63 A;  2YSM A;  4N06 A;  2VH3 A;  3SZR A;  5L3V A;  2YHS A;  4G0H A;  5KYW B;  5EGY A;  2QIC A;  2YW8 A;  3ZVZ B;  1MNE A;  2VJE A;  5I3L A;  1ZHT A;  1WIM A;  5B8D A;  2W4B A;  2J9U A;  2NUT B;  3ASN C;  1WEP A;  2KYU A;  4AP4 A;  1LKX A;  3DMD A;  1NZE A;  3KV6 A;  3DZA A;  1OCC C;  3N24 A;  2Y3G A;  4KNW A;  5D1L B;  5B76 A;  2J7P A;  1FBV A;  5HSW A;  3F47 A;  3EH1 A;  5AIT A;  3K1H A;  1WIL A;  2EIL C;  2IXM A;  3O6X A;  4LJN A;  2L9J A;  5B3S C;  1J8Y F;  1D1C A;  4L58 A;  2VJE B;  2KU3 A;  3W8I A;  3VK6 A;  4CSA C;  5E2Q A;  3QMK A;  3EZI A;  1WEN A;  1S7Z A;  1W2W A;  3SNH A;  3DPL R;  2KWO A;  3ZPV 1;  2R7U A;  1Z6U A;  2G3K A;  4JW1 A;  1IW7 F;  4HFK B;  3QZC A;  3UGO A;  3N9M A;  1X4U A;  2R7S A;  2WL8 A;  4A4C A;  1LDK C;  3ZVY A;  3I5Q A;  2XXA A;  3LQJ A;  1ZHY A;  2HYE D;  2KWN A;  3ZIB A;  4QF3 A;  2WZF A;  5KH9 A;  3RFY A;  4ZQL A;  1PCX A;  5TDR A;  4AE4 A;  1ZU4 A;  4TKP B;  3C6W A;  3W8H A;  5B1A C;  5H9M A;  1MMD A;  4LLE A;  2QTV A;  2VJF A;  2F6N A;  1M2V B;  2A68 F;  5DS4 A;  5F5F A;  1FP0 A;  4FES A;  3AQC A;  4HFF B;  3SEO A;  4N4F A;  2NG1 A;  1ST6 A;  4JUR I;  2MUM A;  4K0D A;  3VYW A;  1K2F A;  3Q6N A;  3EH2 A;  3MX3 A;  2P7V A;  3PMR A;  4OD4 A;  2W9Y A;  1JPJ A;  4AE4 B;  3B0V C;  2XL4 A;  4BJ6 A;  2J7P D;  1IYM A;  5LKU A;  1VOM A;  2HV6 A;  3SOX A;  2KWK A;  5LKX A;  5KYN A;  2VJF B;  1SF8 A;  3NYL A;  4JCH A;  5B78 A;  3HTK C;  1N1C A;  1OCR C;  2LGG A;  4GNE A;  2Y3D A;  2B0J A;  3CSK A;  3EFO A;  4YN0 B;  5E33 A;  1D1B A;  2QY9 A;  2MD7 B;  5G04 B;  5KH3 A;  3T4R A;  1M56 C;  4XTK A;  3SYN A;  1FTS A;  4O6Y A;  2ECI A;  3ABL C;  3T6R A;  3ITF A;  1Z3I X;  4ANJ A;  3V43 A;  2MD8 C;  4G7Z F;  2A69 F;  5AIU A;  5F5H A;  4XLN F;  3IHP A;  2G62 A;  2KQ9 A;  2KIZ A;  1PD1 A;  3LS0 A;  2DYR C;  3EFO B;  4IRU A;  2V26 A;  3IEE A;  4EBB A;  3ZYQ A;  1TWH A;  2JRJ A;  2YSJ A;  4E7S A;  1ZBD B;  3I4U A;  1WEM A;  4C7O A;  4E7Z A;  2NAA A;  2L80 A;  3PUQ A;  4C3B A;  3ECS A;  4S3O C;  3NKE A;  4FO9 A;  2KGO A;  2NUP A;  1MM2 A;  5DVW A;  3M62 A;  5LCW B;  1M2O A;  2VNF A;  2EGP A;  5KH7 A;  3SHB A;  2ZXR A;  1V87 A;  2A1D D;  4PJL A;  3VAY A;  1ZHX A;  4CS9 C;  3LEV A;  2ECV A;  4YT5 A;  4BBQ A;  3TD7 A;  1SZI A;  1NU9 C;  4O79 A;  4CS8 A;  4EWC A;  4C7O B;  2P6V A;  2FFH A;  2K16 A;  2JD3 A;  1TWA A;  4XI1 A;  4PTB A;  5G05 B;  4YT2 A;  4X3G A;  1IZM A;  3WG7 C;  4BG0 A;  3UGP A;  2A6E F;  3ZTG A;  2C2L A;  3K33 A;  2KW3 C;  2LDR A;  4BJT A;  3O7A A;  3OEO A;  4L7X A;  4CIH A;  4O7G A;  4QI0 A;  3RKO F;  2AN6 A;  1BR4 A;  2W4M A;  2Y69 C;  2M4E A;  4YT8 A;  5DQZ A;  4I1M A;  1X4J A;  2E6R A;  3AG4 C;  3Q6M A;  1OCO C;  2A6H F;  4B86 C;  1E4U A;  1FFT C;  2UZG A;  2LQ6 A;  5T3W A;  3EB6 A;  3DXJ F;  1MM3 A;  3EGD B;  5C11 A;  2IXN A;  3UMK A;  2LGV A;  2IYL D;  4I3M A;  5TAB A;  2H7O A;  3FDQ A;  2C2V S;  4CSA A;  2MT5 A;  2R7R A;  2ZET C;  1T1H A;  5DS5 A;  1WGM A;  4R7E A;  3K1I C;  2IXO A;  4CA1 A;  4B6I A;  1BR1 A;  4I7D A;  2PF4 E;  2GFH A;  3I5P A;  3U5O A;  2XEU A;  2MNZ A;  2LGK A;  3FL2 A;  4V3K C;  1Z6A A;  5E3A A;  1Z2Q A;  4GNF A;  5D1M B;  5TRB A;  5FB1 A;  3DAF A;  4OIQ F;  2FUI A;  4JZA A;  3AG2 C;  2QJ0 A;  2LGL A;  2D5R B;  4KBL A;  3HLZ A;  2LSE A;  3MLG A;  3ASL A;  2E87 A;  4U5C E;  4KC9 A;  5L3Q A;  1WEQ A;  2Y39 A;  1M2V A;  2ECT A;  2M3H A;  1D0X A;  2KWJ A;  4U5E E;  1D0Y A;  5KYX A;  1JOC A;  1CHC A;  2IXP A;  1QLE C;  1NG1 A;  2WZG A;  5TDW A;  4FIP A;  2MNY A;  2D8S A;  1PD0 A;  2LN0 A;  4OIN F;  3N9P A;  4BEJ A;  3MHH A;  3OWT A;  2KNH A;  3DJN B;  3KQI A;  1TWC A;  2R7Q A;  4RD9 A;  4DVY P;  4K7B A;  2RSD A;  1FMV A;  2EOD A;  3JCU Q;  2WZL A;  3O39 A;  3LQI A;  3M99 A;  3CZ6 A;  4GYT A;  3KMI A;  4NY3 A;  4BJ5 A;  2K1J A;  4UP0 A;  2WVO A;  3SOU A;  2Y3B A;  5KYX B;  3UR3 C;  4I7C A;  5CI8 A;  4UI9 B;  2FGY A;  3EHN A;  4AUQ B;  2VPE A;  3HCT A;  3GV4 A;  1MMA A;  4U5H A;  2CDQ A;  3SP1 A;  3I2D A;  2EIM C;  5BUO A;  3U5P A;  4PJN A;  1OCZ C;  3K66 A;  3UMH A;  2MA5 A;  4W4U A;  4YBT A;  5B75 A;  4LLC A;  1TWG A;  3ZPV E;  3RPG B;  2YU4 A;  4WZ0 A;  1WEV A;  2J9W A;  1VD4 A;  2ZXO A;  3QZV A;  1JM7 A;  1VMA A;  2KFT A;  2Q9B A;  3OA1 A;  3B0U X;  2MA6 A;  1QZX A;  2KGG A;  4V3L C;  3LAY A;  3ZVR A;  3L1X A;  3EJN A;  2FSA A;  4JVS A;  4YWQ A;  3NDB B;  3B9Q A;  1VK5 A;  1V55 C;  5DQT A;  4HE8 D;  4R2Y A;  4WA6 A;  3DAG A;  4F52 B;  1F62 A;  4QF2 A;  4YBM A;  3M63 A;  4AK9 A;  3EB5 A;  4Q7C A;  3FVY A;  2KE1 A;  1JM7 B;  4FJC A;  3RYL A;  1RJ9 A;  2OXQ C;  1LVK A;  3L11 A;  4OIR F;  5H1V A;  2CSY A;  2Y1N A;  2RI7 A;  3H65 A;  5DS6 A;  4FK5 A;  1WES A;  4NN2 A;  2Y1M A;  4XWJ A;  4B7Y C;  4PJM A;  4S3O B;  3RTR B;  4FWV A;  5LKZ A;  5H1T A;  2CNW A;  1MMN A;  1M57 C;  3ZSU A;  3RIP A;  3ABM C;  2KRE A;  3S28 A;  1WEO A;  2L0B A;  3S0X A;  1FMW A;  2MIQ A;  1J8M F;  2X51 A;  2YEV A;  4WZ3 B;  1RJ9 B;  4LER A;  5LKT A;  3E70 C;  4QI2 A;  4AVX A;  2VAS A;  2LXH C;  3S29 A;  3N9L A;  3EHM A;  1JPN A;  4IC3 A;  3KNV A;  4LAC B;  4O6N A;  2H7V C;  3L34 A;  2PFD A;  3EGD A;  1NU7 D;  2IDA A;  4GND A;  1O5H A;  1X4I A;  2IOQ A;  3EG9 A;  3GAN A;  4AX2 A;  4BJ1 A;  3LRQ A;  3O37 A;  4IC2 A;  2CW0 F;  2J9V A;  3JRT A;  4PJJ A;  5G0F A;  4BHW A;  3NYM A;  2F6J A;  2R7W A;  4A4B A;  4Q5S F;  1VYK A;  1OKK A;  3KH2 A;  4LLB A;  3EPV A;  2WVQ A;  1VFY A;  3UMI A;  4KI2 A;  2HDP A;  5T1D B;  4J32 B;  1BOR A;  2V3C C;  3W2V A;  1ZHZ A;  3UNG C;  2VPB A;  3JSZ A;  3LNR A;  2G43 A;  2VPG A;  2Q9A A;  2R7T A;  3EG9 B;  2CKL B;  2YUR A;  3O70 A;  3SOW A;  2DGJ A;  4C9Z A;  2LXP C;  1LS1 A;  4DBR A;  2LRI C;  2Y43 A;  2BAY A;  2PUY A;  4U5F E;  1Z63 A;  3N9N A;  3NG1 A;  5CI9 A;  4U5B E;  4CCG X;  1G8X A;  4WZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...