3HTKC

Crystal structure of mms21 and smc5 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/replication/ligase
molecule keywords Structural maintenance of chromosomes protein 5
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 75
structure length 254
sequence length 254
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1010 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3htkC01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3htkC02
2I50A 2XB1A 2LQ6A 4MVTA 2ECVA 2MA6A 5LCWB 2L80A 1WEMA 3PHDA 2D8SA 5LKUA 2CSZA 5LKZA 4AP4A 3HCTA 4C9ZA 5AITA 2L43A 5TDRA 2KWNA 2IDAA 5EYAF 1JM7B 4GB0A 2YW8A 3HTKC 1VD4A 1VYXA 4QF3A 2CKLB 5FERA 3V43A 1WILA 1WFKA 1WEPA 5D1MB 2LGLA 3KNVA 2EODA 2L0BA 4B7YC 3ZPV1 1Z2QA 3ZTGA 5KH7A 2KREA 1WESA 2XEUA 1WEWA 3IHPA 3L1ZB 1E4UA 1WEEA 4LADB 3PURA 2MA5A 5C11A 1HYIA 2KU3A 3FL2A 2YSJA 2M1RA 3O36A 2KWOA 2EGPA 2NAAA 4WZ3B 4ZUXU 3VK6A 5B75A 5H1TA 3SOXA 5TRBA 3N9OA 2MIQA 3DPLR 3SHBA 4GNFA 2ECTA 4AUQB 4O64A 2YURA 4YBTA 1WENA 5FB0A 3N9PA 2L5UA 2JRJA 5B78A 5H1UA 4IC3A 4FJCA 3O35A 2LN0A 2K1JA 4Q6FA 5FEYA 2VJFA 4A4BA 3RPGB 2F6JA 2G6QA 2LDRA 2MT5A 2H0DA 2PNXA 2M85A 2JMDA 2ECGA 5TBNA 2ECIA 1XWHA 3L11A 2VJEA 3ZPVE 4F52B 1K2FA 4UP0A 1WE9A 2MNYA 2VPEA 1MM3A 2KIZA 5D1KB 4AYCA 3N9MA 1WIMA 4S3OC 4YATA 4P5OB 3SOUA 2KGIA 1MM2A 1JOCA 3U5PA 3MHHA 3KV5A 4A0CD 3MHSA 2YT5A 1WEUA 2YYRA 5LKXA 3LQJA 2Y1NA 1F62A 1LDJB 4QF2A 1G25A 2L75A 3RPGC 4PTBA 3QZVA 4WA6A 5DKAA 4BHWA 4I7BA 2H0DB 5D1LB 2MUMA 1RMDA 4UI9B 2RI7A 1Z6UA 2YREA 3HCSA 4LK9A 2VJEB 3M62A 3ZYQA 1Z60A 3ZVYA 1BORA 3GL6A 3U5NA 3LRQA 4WZ0A 2EA6A 2YQMA 4CCGX 2QIZA 1CHCA 4AYCB 1VFYA 2QICA 4AVXA 2F42A 4L58A 3N9NA 4GNEA 3C6WA 2KYUA 2MD7B 5KH3A 4FO9A 4S3OB 2LGKA 3EB6A 2OXQC 4V3LC 4TKPB 2MNZA 4R7EA 3U5MA 1FP0A 3ZVZB 2AN6A 4YC9A 1X4JA 5B79A 4GNDA 1N87A 2PUYA 4X3GA 3ZNIA 5H9MA 2HYED 4LJNA 4V3KC 1WEOA 2KGGA 4I7CA 2JMJA 4MSXA 4IC2A 1JM7A 4R2YA 5C13A 2KE1A 2MD8C 2JMIA 3GV4A 2KR4A 3O37A 2DX8A 2YSMA 1X4UA 3I2DA 2CT2A 3C5KA 3O7AA 3HCUA 2E6SA 5H1VA 2VPDA 2RSDA 3T6RA 1U6GB 2BAYA 5B8DA 2YUCA 5KH9A 5I3LA 5B77A 1DVPA 1FBVA 2C2LA 3KV6A 4FK5A 3SOWA 5G04B 2UZGA 3DQVR 2LXPC 2VP7A 2KWJA 3LQHA 1WGMA 2ECJA 4XI1A 1WEVA 5B76A 2VJFB 2LV9A 4WZ2A 2KFTA 4YBSA 5G05B 1X4IA 2VNFA 1LDKC 4CA1A 4B86C 4YBMA 2G45A 5LKTA 1IYMA 1T1HA 2FSAA 3NG2A 2HDPA 2LRIC 2YHOA 3LQIA 2K4DA 3M99A 4L7XA 2LGVA 2K17A 1WEQA 2YHNA 4A4CA 4W4UA 3O33A 4GNGA 3L1XA 2KWKA 3O34A 3RTRB 2C2VS 4LLBA 2Y43A 2FUUA 4ZQLA 2FUIA 4PPEA 3EB5A 2Y1MA 5JG6A 4I7DA 5DINA 2ECNA 2E6RA 4NN2A 1HYJA 4YABA 2ECWA 5AIUA 4A49A 2G43A 3ASLA 3KQIA 3M63A 4UP5A 2M6MA 3T7LA 3O70A 1ZBDB 4FIPA 4LKAA 4N4FA 3U5OA 2M3HA 2CSYA 5G0FA 2LGGA 1V87A 3N9QA 2YQLA 2VPGA 5TDWA 2VPBA 4YADA 2K16A 2CKLA 4N3WA 4R8PK 2QJ0A 2YU4A 4ZDTA 5FB1A 5TABA 2ZETC 4YAXA 2F6NA 3N9LA 2LXHC 5J3XA 4BBQA 3PUQA
chains in the Genus database with same CATH superfamily
3NYMA 4I1MA 3Q7GA 4PFPA 3ZWIA 2ECVA 3W2VA 3U8PA 2L80A 4Q5SF 3PLWA 2L7AA 2R7QA 3VM6A 5DS6A 2D8SA 3ZQYA 3LJUX 4J7TA 5AITA 4D4XA 1OR3A 5E3CA 3UMHA 2MKEA 1M2OA 3SXMA 2XXAB 2WZFA 5KYYA 2KWNA 3K1HA 2XM4A 2D4UA 2XLWA 4YK5A 3HTKC 1TFOB 2ZXWC 5F5FA 4I3MA 2W45A 1V74B 2OU6A 1O3UA 1Q0FA 2YL3A 2ZXOA 4MVZA 4DBQA 2XP0A 1KNYA 3M1CB 1CPQA 4EBJA 1WEPA 2EODA 2YLGA 4CSAC 4KNWA 2IYLD 5B3IA 1YDIA 5JLIA 1A41A 3T6JA 4PJMA 2QE9A 2EIJC 2KREA 3L1ZB 1OCCC 3OWTA 1WEEA 2ETSA 2KU3A 1M56C 3W4YA 1W2WA 1BR1A 2M1RA 2EILC 3Q7LA 3KDEC 4JE9A 1N1CA 2Z15A 4YL0A 3QMKA 1HW2A 5SVYA 1UFBA 4DBRA 2RR4A 1EI7A 4HE8D 3TULA 3MFNA 3ASNC 3FAPB 2ECTA 1ZW3A 4AUQB 4PFOA 3UNGC 4O64A 4YBTA 1E83A 1WATA 3W8HA 2JRJA 5B78A 2IXOA 3B0PA 1JPJA 2KK1A 3B9QA 2LN0A 3QVYA 2IOQA 4BG0A 3EGDA 1IZMA 2KKXA 4JW1A 1LVKA 2XL6A 1H7IA 2ZPAA 3LS1A 2LDRA 1LKXA 3JCUQ 3HJCA 2D5RB 2LD6A 3GM3A 3IQTA 2LSEA 4C7OB 4K7BA 4F52B 3FAJA 1K2FA 2DSMA 2MNYA 2VCCA 3LNMB 4XPYA 2VPEA 4N4WA 2FD4A 2YZSA 1PCXA 2PBEA 3LS0A 2FFWA 2EPNA 1Z63A 3MX3A 4XPWA 3I5PA 1Q0GA 1J8MF 5E3AA 4O79A 4A0CD 1V4AA 4YT8A 2XOZA 4MTFA 1ZU5A 2YT5A 4ER9A 2YL7A 4NY3A 4LERA 3UGPA 2EPMX 2W9YA 1NFNA 5HV9A 5DQTA 4YJWA 3V5YA 3QZVA 5DKAA 1ZHZA 4I7BA 2H0DB 4BHWA 3GEEA 1DOVA 4AK9A 2J46A 2RI7A 1T9KA 3WG7C 5B1AC 4XLNF 2F22A 5JSLA 4LK9A 2WVOA 3O10A 3I4UA 1Z60A 2XLMA 1BDJB 4WZ0A 2EA6A 4DVZA 1NZEA 3EGXA 3KPHA 2HJ3A 1NFOA 4AVXA 1LM3B 3AQCA 2R7WA 5KYYB 2WVNA 3LNRA 2KYUA 5KH3A 4FO9A 2OCCC 4LACB 3ABMC 1MMGA 2MHRA 2MNZA 4R7EA 4TKPB 1SR2A 2IM8A 3DE9A 3ZIBA 3ZVZB 2P61A 2JD3A 2Y3DA 3K66A 5B79A 4BJTA 3B71A 3ZNIA 1TQGA 4CX9A 2R03A 4XEFA 4WABA 1CGME 4IC2A 1GM5A 1LIHA 5A6KA 1VTMP 3U5SA 2KR4A 3E70C 4Z9HA 4OIOF 5TJ5E 4NTFA 2IXNA 2DX8A 4W8KA 1YARO 2YSMA 3I2DA 3C5KA 3E2DA 2AVKA 1U6HA 2MYSA 2PF4E 3T6RA 1ZHXA 2LP4A 3KYJA 3TK0A 5B77A 4I44A 4CDYA 2OEVA 1QQ3A 3GWNA 2KWJA 4IARA 1NU9C 3OA1A 4QI2A 4XI1A 1WEVA 1G5ZA 3EGDB 1JAFA 2AWYA 2A0BA 1EQ1A 2YQYA 2KGOA 2H7OA 3JYHA 2D8UA 2KFTA 2J7PD 5E33A 3CZ6A 1X4IA 2VNFA 4MVQA 2G45A 2MWQA 1IYMA 2FSAA 1JR8A 3JTLO 5F28E 2NPUA 2NSGA 3SP1A 3A11A 3C8GD 3M99A 4L7XA 2K17A 3DE8A 1WEQA 4JCHA 2YHNA 4W4UA 2VCAA 3L1XA 2BL2A 3RF3A 2YVRA 1M2VA 5A6BD 2DYSC 1I4ZA 2B0OE 2Y43A 2WZLA 5COMA 2Q00A 3N24A 3BRJA 2FUIA 2Y3GA 4NTAA 4I7DA 4U9EA 4ANJA 2NG1A 2ECNA 3VAYA 2FFHA 3S29A 4AL1A 4QDLA 5L0CA 3FOPA 3ASLA 3M63A 1RMVA 2M6MA 3T7LA 3O70A 1QVXA 3DM9B 4RD9A 2M3HA 2UUIA 4J7YA 5G0FA 4FESA 1PV3A 4MTGA 1E2XA 2LGGA 3SNHA 2YQLA 5TDWA 2VPBA 2CNWA 1MNDA 1SZIA 4XPXA 4N3WA 2QJ0A 1LE4A 2GA0A 3Q6NA 3EGXB 2OWAA 4IWBA 2F6NA 1H9GA 4BBQA 2L6GA 2EPLX 3NG1A 3FXHA 2R7RA 3U2MA 1C03A 2LQ6A 3KL4A 2DGJA 3ABLC 3PHDA 4MVOA 2L6HA 2IQJA 5LKUA 3HNJA 1Z7Qc 5LKZA 5KYXB 2L43A 2CSVA 4YL1A 3O39A 4YT4A 4YWQA 3H65A 1PD1A 2YLIA 2IDAA 3FEHA 1CPRA 4RDAA 2XLEA 1MMDA 3AG1C 3H2UA 1VYXA 1E84A 2RD9A 4JKVA 5FERA 1TFKB 2GDCA 4LDRA 3M79A 3NMIA 1RKCA 5D1MB 3KNVA 4MVSA 1K05A 2L0BA 4FWVA 3TD7A 2W4BA 3ZPV1 1NG1A 3C63A 2LIGA 3ZTGA 2VC9A 5KH7A 1WEWA 3IHPA 3V5XA 4IRUA 4KBLA 1E4UA 4LADB 3PURA 1UG7A 3EG9A 1HYIA 1S05A 3G4ZA 1U0BB 2XLDA 3O36A 4IAOA 1PD0A 2EGPA 2Q3TA 1KTMA 3QZCA 1VK5A 4H9DA 4ZUXU 3LVQE 3GWLA 5H1TA 3V7OA 3SOXA 3N9OA 5SVXA 3DPLR 3JRTA 4MW8A 3GM2A 2L5UA 1OKKA 1ORYA 4N6CA 1D0ZA 4PK4A 4Q6FA 5FEYA 3TOLA 1JMWA 1T5OA 2F6JA 2G6QA 2H0DA 2JMDA 1QSPA 5E2QA 3EHNA 1Q0DA 2ECIA 1BR2A 3UGOA 4UP0A 1WE9A 3PCVA 2HSQA 3U9MA 2A6HF 3WAQA 2PFDA 3AG4C 3RYLA 5KYNA 2Y69C 4S3OC 1FFHA 1OCOC 2TMVP 1A7VA 3NKEA 1ST6A 4LDKA 3MHHA 3KV5A 2AP3A 3T6GB 5JS5A 3HNIA 2WVQA 3NKDA 4DOZA 1L7CA 3DI5A 2BE5F 3GANA 2Y1NA 5T3WA 2PNOA 4OGCA 2R7SA 2L75A 4JZAA 5EGYA 2LFFA 1Z23A 5JVEA 4MW3A 2MUMA 3ITFA 3K6BA 1RMDA 3FMSA 5T3TA 1Z6UA 2YREA 3DWDA 3W2WA 3LEOA 3N2ZB 1B68A 4P9TA 3JZ0A 3LAYA 3C18A 4OIQF 4Z9IA 1BORA 4WGYA 1Y6DA 2JX0A 1FAPB 1HMDA 2Q9AA 2YQMA 4XEKA 3FDQA 4EBBA 2KQ9A 4E0IA 1OR2A 5EHHA 4QQ4A 4EBKA 4O7GA 1YAUO 1YLMA 5DS4A 3C6WA 1ZU4A 4ZLDA 3LVRE 1OCZC 5CI8A 4LLEA 4S3OB 4BEMJ 4C3DA 3U5MA 1WWPA 1VB5A 2XS1A 1EKYA 3CAXA 5T1DB 1FP0A 2AN6A 2R7TA 4YC9A 3RH3A 1X4JA 4PR9A 4GNDA 2HSBA 3EH2A 4O62A 5H9MA 2ZXRA 2HYED 4V3KC 3H7HA 1TR2A 4DJ9A 1XZPA 2M13A 5CIVA 5SVIB 2JMJA 4R2YA 2KE1A 2KKYA 2P7VA 3GV4A 5DVWA 2X51A 3DJNB 3EG9B 2L6FA 1X4UA 2H8AA 2HJMA 1NU7D 3O7AA 1C17M 2GAQA 3L8JA 3K7DA 2ZXPA 2VPDA 2PX0A 1OXBA 1NLXA 1ZVZA 2I8BA 4U5HA 3JT1A 5B8DA 4FX5A 1C02A 2XL8A 2YUCA 5KH9A 5I3LA 1Z3IX 1QKRA 2KNHA 3KV6A 3SOWA 3DQVR 2VP7A 2YHSA 3LQHA 1WGMA 2VB6A 3IQ6A 3AG3C 3DMDA 2CONA 2HKVA 2LV9A 4E17A 4U9DA 1XWJA 3B29A 1TWHA 4MVRA 3QW1A 5G05B 2EGMA 5A6AA 1HE1A 3L34A 1T1HA 3NG2A 1SF8A 2LRIC 5COGA 2YHOA 1T01A 3EJNA 5DS5A 3LQIA 5KYWA 3HKKA 2K4DA 1S7ZA 2L81A 2G3KA 5DLJA 1TWGA 4XEVA 5AC4A 3RTRB 4ULWA 2FUUA 4ZQLA 1OXKA 3EB5A 5DQZA 5AC5A 2Y1MA 1R4TA 3U0CA 2ECWA 4A49A 2YRFA 5JRAA 4UP5A 4G7OF 5KYXA 2RSEB 3N0TA 2XOYA 2UUHA 4LKAA 4N4FA 3U5OA 4FAPB 2HUJA 2YVKA 2A1DD 3QVZA 4K1OA 1A7EA 3JSZA 2VPGA 3DWWA 4EIYA 2QTVA 1LS1A 3PDMP 4G0HA 2XRHA 2C04A 4IB4A 4IGGA 3ASOC 2WB7A 4GYTA 3FM8C 1ORSC 2ZETC 3EHMA 5IY5C 5K0IA 1WTYA 5FZTA 1R5ID 3FOOA 2CCYA 2I50A 3R7CA 1O5HA 5JP7A 2XB1A 3J06A 2MA6A 4MVTA 3X2QC 4C3EA 1WEMA 4NQFA 3SEOA 4Q4ZF 3S27A 4JJGA 3UMIA 2YWAA 3LDYA 3CSKA 3HLZA 4JVSA 1AEPA 2Y39A 2W4MA 1ZZPA 2YW8A 4CS7A 1YVIA 2L7PA 4D4NA 1JRAA 4EHPA 1VD4A 1F1MA 3C7JA 2CKLB 1RKEB 4JTCB 5BQHA 5D92A 3ZG1A 1DOWA 1I5NA 1WFKA 2WL8A 2J8WA 3R2PA 4OIPF 4B7YC 1BZ4A 4E18A 1Z2QA 2XEUA 4O6YA 3S28A 1QPUA 1VMAA 3AQBA 1G8XA 2NSFA 2MA5A 5C11A 4OD5A 3H2VA 4BPMA 5BQIA 3FL2A 1OW8A 3AGUA 1A7DA 2KWOA 3V5ZA 2HZ8A 4WZ3B 2R9RB 2XOCA 3VK6A 2CW0F 1LI5A 1FMVA 5B75A 3US6A 3GM1A 3SYNA 2R7OA 2MIQA 2O9XA 3POVA 2CGEA 1VLSA 3FHDA 4GNFA 1WENA 5FB0A 3N9PA 2V26A 2M64A 3LESA 5H1UA 4IC3A 5A69A 4YN0B 3O35A 1H9TA 3PMRA 3SXYA 3LEVA 4E7SA 5KYWB 2K1JA 2OJED 2R7UA 2VJFA 4MS2A 3G50A 2FAPB 3RPGB 2QUPA 1VLTA 4E7ZA 5KYUA 2MT5A 1D0YA 2XLVA 4PJLA 2EINC 2ECGA 5TBNA 1E86A 2XS8A 1XWHA 3MBGA 4HFFB 4E0HA 4RBNA 3DJUB 4M63A 4U5CE 1MBMA 4O6MA 2IXMA 3MYFA 3Q6MA 1O87A 4CS8A 3L1MA 3UR3C 3HNLA 1MM3A 3E9VA 3AJMA 3ZSUA 1TWAA 3L8IA 4MVMA 2OOCA 3M4CA 4YATA 4YL3A 4P5OB 3SOUA 2QLAA 2KGIA 1T6QA 3U5PA 1FMWA 4MQ9F 1OW6A 1M6TA 2BC5A 3MHSA 1MMNA 3LUTB 2YYRA 3F46A 3LQJA 4GQHA 1LDJB 3IPMO 4QF2A 3U8VA 4WA6A 3FVYA 1J8YF 4IAQA 3U9JA 5SVIA 2KW3C 4YT5A 4AX2A 2EPKX 2WZGA 4P9FA 3DDTA 3HCSA 2VJEB 1WASA 3JYYA 4EWCA 4KNVA 2DI3A 4I1OB 3GL6A 3U5NA 1IW7F 2NUTB 4CDAA 4NC3A 1SMYF 2P0NA 2E87A 4CCGX 3F47A 4MTOA 4UDVA 4AYCB 2QICA 3RQFA 4KI2A 2F42A 1YA7O 4L58A 4OINF 4GEHA 1T6IA 2KC3A 2MD7B 4ZLCA 5L0IA 1VYIA 4JTDB 4DRJB 2LGKA 3EB6A 3LLKA 2XLOA 4WGZA 1K04A 2XLHA 1FNTc 2OQMA 4AE4A 4ONSA 2R7VA 3VYWA 3AOUA 3C8GA 2YL1A 4CDVA 2CDQA 4Z9JA 3O47A 1Y4CA 2PUYA 2L9JA 2R25A 5K3QA 5A6BA 2KGGA 1K40A 4MSXA 3Q1DA 1JM7A 3RFYA 3TOMA 2Q7RA 3DD7A 5CI9A 1D1CA 4CIHA 2DYRC 3UMKA 3ZTZA 1KU2A 2C03A 4CS8C 2Y3BA 1EA8A 3AGTA 3FJUB 1HW1A 2E6SA 5H1VA 5A6JA 3KH2A 3QW0A 3T9OA 1U6GB 2BAYA 4LDQA 1ORJA 3OEOA 3EH1A 3T6BA 3RW0A 5COFA 1DVPA 2C2LA 4FK5A 5G04B 4Z0RA 2R05A 2ECJA 1RXQA 1LS4A 5GPGB 3K1IA 2HMZA 2VJFB 3RIPA 2J9UA 5KYUB 2V3CC 4YBSA 1ZHTA 2J9WA 3DKAA 3EPVA 1Q0KA 4K0DA 4YBMA 1FFTC 4HFKB 5LKTA 2E61A 1JOGA 3ZTMA 2J0XA 2AWCA 2PP4A 4Z0OA 1YJGA 1FR0A 1GGQA 3IQCA 3NRHA 3O33A 5L3VA 3O34A 2J45A 3M15A 2JM3A 4OGEA 4LLBA 1LPEA 4JC7A 3JRMO 1DCQA 1AVOB 4PPEA 256BA 5BUOA 4QI0A 1CGOA 5DINA 2P57A 4G7HF 4U5DE 1HYJA 4YABA 2DB4A 3DM5A 4G7ZF 4N06A 4U5BE 3KQIA 3MYIA 2A0UA 1ZBDB 4FIPA 1LE2A 2KSFA 3TQOA 4CJOA 4JEBA 2LQGA 2KYHA 4BJ6A 2B0HA 3GODA 4BJ5A 1V87A 3PHF2 3KMIA 5B1BC 2K16A 3WODF 2CKLA 1RKEA 2YU4A 5FB1A 4XLPF 1T6UA 3ZDLA 3TJ5A 1YZAA 2OKUA 4CJGA 3N9LA 2LXHC 5J3XA 2FGYA 3IQ5A 2GFHA 2Q4FA 3EZIA 3DAFA 4ULVA 5EK0A 5LCWB 3DXJF 4AE4B 3K1IC 1WN0A 3C8GB 5FCLA 3ATPA 4JEAA 4JRZA 2J9VA 1U89A 1LI7A 2P6VA 2CSZA 4DRHB 4AP4A 3HCTA 4C9ZA 4OD4A 5TDRA 3GORA 3TJ6A 1D1BA 1SYQA 5EYAF 5L3QA 1JM7B 3VF0A 3T4RA 4GB0A 3KYIA 1QLEC 4QF3A 4YT2A 2HV6A 5D91A 3V43A 1WILA 3NYJA 4J30B 3NMKA 2LGLA 3LLIA 2KJGA 1BR4A 3EZHA 1ZYRF 1TWCA 1WESA 3B0UX 2I15A 1A0BA 5L0FA 1BBHA 3L0IA 2YSJA 1Q0MA 3K33A 4HEAJ 4U5EE 4P6IC 4CS9A 2CNWD 2M4EA 3KKBA 2NAAA 3JSEO 5L0JA 2LK4A 3S9OA 5L0HA 3EFOA 5TRBA 3U2LA 2OJQA 3U3BA 1D0XA 3AG2C 2HV7A 2EIMC 3M4BA 3GEHA 3SHBA 4BJ6C 4BJ5C 1MNEA 3O55A 3MDBC 2YURA 2YLDA 1M57C 4U5GA 2HMQA 2LCHA 4FJCA 2JPUA 4U5FE 4A4BA 2CRWA 1HMOA 3QTHA 2NUPA 2PNXA 2M85A 3U3FA 2XL4A 2OG2A 3X1OA 4B6IA 3I5QA 2A69F 2VJEA 3L11A 3ZPVE 3FAOA 1D1AA 3NDBB 1MQVA 3ZVRA 2NUTA 2EPOA 4EUKB 2ASRA 4JIOA 1RJ9A 4DXWA 2KIZA 5D1KB 1VOMA 4CIPA 4AYCA 3N9MA 1WIMA 3SZRA 4A2NB 3S90A 2DJAA 3IHUA 4NTBA 3VRCA 1MM2A 1JOCA 2LAUA 3M7KA 2LFDA 2EIKC 2CRRA 1WEUA 5LKXA 2XM0A 1F62A 3CEXA 4KC9A 1RCPA 4JURI 1G25A 3RPGC 4PTBA 5JT4A 2GWWA 4JJFA 5D1LB 2IBFA 4UI9B 4X0RA 4H4KC 1YYJA 3M62A 4CS9C 3ZYQA 3SUBA 3ZVYA 3FANA 3LRQA 4PACA 1OKKD 4DRIB 1ZW2A 4IJJA 1ZHWA 3C62A 2QIZA 1YZCA 2H7VC 1CHCA 1VFYA 3S0XA 4MVUA 2X0CA 1G4WR 3N9NA 4GNEA 3MLGA 1AUEA 1V55C 2VASA 4MNDA 4OIRF 1YYXA 3IEEA 2OXQC 4V3LC 2G3VA 3NYLA 2Q9CA 4PJNA 5F5HA 3WHNA 3EQLF 1VYKA 1N87A 4X3GA 2Y3HA 1GQAA 3BEHA 4F4BA 1Z5ZA 4LJNA 2VH3A 2XXAA 1WEOA 4I7CA 2ZD9A 3ZC4A 1YA9A 3GEIA 3SXZA 5C13A 3ZQVA 3ECSA 2JMIA 2MD8C 5L0GA 2VCBA 1L3PA 4J32B 3O37A 4L6RA 4F1PA 2CT2A 3HCUA 5HSWA 3O6XA 3CQZA 2IXPA 4XQ1A 3W8IA 2RSDA 3EFOB 3SXKA 2XSEA 5BQGA 2R7XA 2J0WA 3DAGA 4R32A 1OW7A 1FBVA 2B0JA 3RQGA 2UZGA 1H6GA 2G62A 2LXPC 4BJ1A 3NMJA 2QNLA 5B76A 3RKOF 1XZQA 2A68F 3LJBA 4WZ2A 1WOLA 1I4YA 2NUPB 1CGNA 1LDKC 4BEJA 1FTSA 4LLCA 4CA1A 2OEXA 4B86C 1HE9A 4H54A 5AGFA 3T9KA 4DVYP 4WJ0A 2HDPA 3DZAA 1JPNA 3ABKC 3A9CA 2CYDA 2QY9A 1V54C 5B3SC 2R02A 2LGVA 2EXUA 1RJ9B 1GS9A 4A4CA 4GNGA 2KWKA 4N6HA 2J7PA 2PX3A 4CSAA 1Z6AA 2ICWG 2C2VS 1APCA 1TKNA 5JUAA 1G4US 4C7OA 2J9BA 2P1AA 3JUEA 4XTKA 4C3BA 4W8PA 5JG6A 1OCRC 2JUNA 2A6EF 4Q7CA 4XWJA 1QZXA 2E6RA 4NN2A 1ZHYA 3B0VC 5AIUA 2G43A 2HFIA 1MMAA 1WGWA 2YEVA 3RVYA 3RVZA 1E85A 2H7BA 2YKZA 4NCQA 2YL0A 4PJJA 3HNKA 4EKWA 4JTAB 2CSYA 4AL0A 2Q9BA 3N9QA 4A4AA 3RQEA 4CBEA 4YADA 5L0DA 3S84A 1NBBA 4R8PK 4ZDTA 4JCZA 5TABA 1NSGB 2AU5A 3G4XA 4YAXA 1M2VB 3C8ZA 1OQCA 4O6NA 1HY5A 3PUQA 2HS5A 4G78A
chains in the Genus database with same CATH topology
2I50A 3DAFA 2R7RA 1O5HA 2XB1A 2LQ6A 4MVTA 3NYMA 4I1MA 3Q7GA 4PFPA 3X2QC 2ECVA 2MA6A 3W2VA 5LCWB 3DXJF 3KL4A 4AE4B 2L80A 4Q5SF 2DGJA 3ABLC 4C3EA 3K1IC 1WEMA 2R7QA 3PHDA 3SEOA 4Q4ZF 5FCLA 5DS6A 3S27A 2D8SA 4JJGA 3UMIA 2J9VA 2P6VA 5LKUA 2CSZA 5LKZA 4AP4A 3HCTA 4C9ZA 5KYXB 5AITA 3CSKA 2L43A 4OD4A 3HLZA 5E3CA 3O39A 3UMHA 4JVSA 5TDRA 1M2OA 4YT4A 2XXAB 4YWQA 1D1BA 2WZFA 2W4MA 2Y39A 3H65A 5KYYA 1PD1A 2KWNA 2IDAA 5EYAF 5L3QA 1JM7B 3K1HA 3T4RA 4GB0A 2YW8A 4RDAA 4CS7A 3HTKC 1QLEC 2ZXWC 1MMDA 3AG1C 1VD4A 5F5FA 4I3MA 1VYXA 4YT2A 4QF3A 2W45A 2HV6A 5D91A 2CKLB 5FERA 3V43A 2ZXOA 4DBQA 1WILA 3M1CB 5D92A 3NYJA 3ZG1A 4J30B 1WFKA 1WEPA 5D1MB 2LGLA 3KNVA 2EODA 2WL8A 3LLIA 2IYLD 4FWVA 4KNWA 4CSAC 3TD7A 4OIPF 2L0BA 2KJGA 2W4BA 4B7YC 3ZPV1 1NG1A 1BR4A 3EZHA 1ZYRF 3T6JA 1TWCA 4PJMA 1Z2QA 3ZTGA 2EIJC 5KH7A 2KREA 1WESA 2XEUA 4O6YA 3S28A 3B0UX 1WEWA 3IHPA 3L1ZB 1OCCC 1VMAA 3AQBA 1G8XA 3OWTA 4IRUA 4KBLA 1WEEA 4LADB 3PURA 1E4UA 2MA5A 3EG9A 5C11A 1HYIA 4OD5A 2KU3A 3L0IA 1M56C 3FL2A 1W2WA 2YSJA 3K33A 4HEAJ 4U5EE 1BR1A 2M1RA 2EILC 3Q7LA 4P6IC 4CS9A 2KWOA 3O36A 4IAOA 1PD0A 2CNWD 2EGPA 2Q3TA 2M4EA 3KKBA 1N1CA 2Z15A 3QZCA 1VK5A 3QMKA 2NAAA 4WZ3B 4ZUXU 3VK6A 4DBRA 2CW0F 5B75A 1FMVA 5H1TA 3EFOA 4HE8D 3V7OA 3SOXA 5TRBA 3N9OA 3SYNA 1D0XA 3AG2C 2HV7A 2R7OA 2EIMC 2MIQA 3ASNC 2O9XA 3DPLR 3SHBA 4BJ6C 3POVA 2CGEA 3FHDA 4GNFA 4BJ5C 1MNEA 2ECTA 4AUQB 3JRTA 4PFOA 3UNGC 4O64A 2YURA 4YBTA 1WENA 5FB0A 3N9PA 1M57C 2V26A 2L5UA 3W8HA 2JRJA 5B78A 1OKKA 4U5GA 3LESA 5H1UA 2IXOA 4IC3A 4FJCA 4YN0B 3O35A 3B0PA 1JPJA 3B9QA 4U5FE 2LN0A 3PMRA 1D0ZA 2IOQA 3LEVA 4E7SA 5KYWB 4PK4A 2K1JA 4BG0A 3EGDA 4Q6FA 5FEYA 2R7UA 2VJFA 1IZMA 4A4BA 4JW1A 1LVKA 2ZPAA 3RPGB 4E7ZA 5KYUA 3LS1A 2F6JA 2G6QA 2LDRA 2MT5A 2H0DA 2NUPA 2PNXA 2M85A 2JMDA 1D0YA 1LKXA 3JCUQ 4PJLA 3HJCA 2EINC 5E2QA 2XL4A 2D5RB 2OG2A 2ECGA 3X1OA 3EHNA 4B6IA 2LSEA 5TBNA 4C7OB 2ECIA 1BR2A 1XWHA 3I5QA 3UGOA 2A69F 2VJEA 3L11A 4K7BA 4HFFB 3ZPVE 4RBNA 3DJUB 4M63A 3FAJA 1D1AA 1K2FA 4UP0A 4U5CE 3NDBB 4F52B 1WE9A 4O6MA 2IXMA 2MNYA 3ZVRA 2NUTA 3Q6MA 1O87A 4CS8A 2A6HF 2VPEA 2PFDA 3AG4C 3UR3C 1RJ9A 1MM3A 2KIZA 2YZSA 3E9VA 3RYLA 1PCXA 5KYNA 5D1KB 3ZSUA 1VOMA 4AYCA 3N9MA 1TWAA 1WIMA 3SZRA 4A2NB 3LS0A 2Y69C 4S3OC 1FFHA 1Z63A 4YATA 1OCOC 3MX3A 4P5OB 3SOUA 3I5PA 2KGIA 1MM2A 1J8MF 1ST6A 3NKEA 5E3AA 1JOCA 1FMWA 3U5PA 3MHHA 4O79A 4MQ9F 3KV5A 4A0CD 4YT8A 2EIKC 3MHSA 1MMNA 1ZU5A 2YT5A 1WEUA 2YYRA 2WVQA 3NKDA 4NY3A 4DOZA 5LKXA 3F46A 4LERA 3LQJA 3UGPA 2BE5F 3GANA 2W9YA 2Y1NA 1F62A 1LDJB 5T3WA 4KC9A 4JURI 4QF2A 1G25A 5DQTA 2R7SA 2L75A 3RPGC 4PTBA 4YJWA 4JZAA 4JJFA 3QZVA 4WA6A 5EGYA 5DKAA 1ZHZA 3FVYA 2H0DB 1Z23A 4I7BA 5D1LB 4BHWA 1J8YF 2MUMA 3ITFA 3K6BA 1RMDA 4AK9A 2KW3C 2J46A 5T3TA 1Z6UA 2RI7A 4YT5A 3WG7C 2YREA 4X0RA 4UI9B 3W2WA 4H4KC 5B1AC 4XLNF 4AX2A 2WZGA 3N2ZB 3HCSA 4LK9A 2VJEB 3M62A 2WVOA 4EWCA 3LAYA 4KNVA 4CS9C 3ZYQA 4OIQF 3I4UA 1Z60A 3ZVYA 1BORA 4I1OB 3GL6A 3U5NA 3LRQA 1IW7F 2NUTB 2Q9AA 4WZ0A 1OKKD 2EA6A 4DVZA 2YQMA 4IJJA 3FDQA 1ZHWA 4EBBA 1NZEA 1SMYF 2E87A 4CCGX 3EGXA 2KQ9A 3F47A 2QIZA 2H7VC 1CHCA 4AYCB 1VFYA 2QICA 3S0XA 4KI2A 5EHHA 4AVXA 2F42A 4L58A 3AQCA 4O7GA 4OINF 4GEHA 2R7WA 3N9NA 5KYYB 2WVNA 3LNRA 5DS4A 4GNEA 3C6WA 2KYUA 3MLGA 2MD7B 1V55C 4ZLCA 1ZU4A 4ZLDA 1VYIA 2VASA 4MNDA 4OIRF 5KH3A 1OCZC 5CI8A 2OCCC 4LLEA 4FO9A 4LACB 2LGKA 3ABMC 4S3OB 1MMGA 3EB6A 3IEEA 2OXQC 3LLKA 4V3LC 4C3DA 2MNZA 4R7EA 4TKPB 3U5MA 2G3VA 3NYLA 2Q9CA 4PJNA 5T1DB 4AE4A 1FP0A 3ZIBA 2R7VA 3ZVZB 5F5HA 2AN6A 3VYWA 2JD3A 2R7TA 4YC9A 2Y3DA 3RH3A 3K66A 1X4JA 5B79A 4GNDA 3EQLF 2CDQA 3EH2A 4BJTA 1VYKA 1N87A 2PUYA 4X3GA 2Y3HA 3ZNIA 5H9MA 2ZXRA 2L9JA 2HYED 4F4BA 1Z5ZA 4LJNA 4V3KC 1TR2A 2VH3A 2XXAA 1WEOA 2KGGA 4I7CA 3ZC4A 2JMJA 4MSXA 4IC2A 1JM7A 3RFYA 4R2YA 5C13A 2KE1A 3DD7A 2P7VA 3ECSA 2JMIA 3GV4A 2MD8C 5CI9A 2KR4A 5DVWA 1D1CA 3E70C 2X51A 4CIHA 4OIOF 2DYRC 3DJNB 3UMKA 3EG9B 2IXNA 4J32B 3O37A 1KU2A 2DX8A 2C03A 4W8KA 4CS8C 2Y3BA 2YSMA 1X4UA 3I2DA 2CT2A 3C5KA 1NU7D 3O7AA 3HCUA 2E6SA 5HSWA 5H1VA 3O6XA 3CQZA 2IXPA 3K7DA 2ZXPA 3W8IA 3KH2A 2VPDA 2MYSA 2PX0A 2RSDA 2PF4E 3T6RA 3EFOB 1U6GB 2BAYA 2I8BA 1ZHXA 4U5HA 2XSEA 3JT1A 3OEOA 4FX5A 2R7XA 3EH1A 5B8DA 2J0WA 3T6BA 3DAGA 2YUCA 5KH9A 5I3LA 1Z3IX 5B77A 1DVPA 2KNHA 1FBVA 2C2LA 3KV6A 2B0JA 4FK5A 3SOWA 4I44A 5G04B 2UZGA 2G62A 3DQVR 2LXPC 2VP7A 2KWJA 1NU9C 3OA1A 2YHSA 3LQHA 4QI2A 1WGMA 4BJ1A 2ECJA 2VB6A 4XI1A 1WEVA 5B76A 3AG3C 3DMDA 3RKOF 3EGDB 2VJFB 2A68F 3RIPA 2J9UA 2LV9A 3LJBA 4WZ2A 5KYUB 2V3CC 2KGOA 2H7OA 1TWHA 3JYHA 2KFTA 4YBSA 2J7PD 5E33A 2NUPB 5G05B 1ZHTA 3CZ6A 1X4IA 2J9WA 3EPVA 2VNFA 1LDKC 4BEJA 1FTSA 4LLCA 4CA1A 4K0DA 4B86C 2G45A 4YBMA 1FFTC 4HFKB 2MWQA 5LKTA 3L34A 1T1HA 2FSAA 4DVYP 3NG2A 1IYMA 4WJ0A 2HDPA 2J0XA 1SF8A 3DZAA 2LRIC 1JPNA 2YHOA 3ABKC 2PP4A 3EJNA 5DS5A 3LQIA 3SP1A 2QY9A 5KYWA 2K4DA 1V54C 3M99A 4L7XA 5B3SC 1S7ZA 2L81A 2LGVA 1RJ9B 2K17A 1WEQA 4JCHA 2YHNA 4A4CA 4W4UA 3NRHA 3O33A 3L1XA 2G3KA 4GNGA 5L3VA 2KWKA 5DLJA 3O34A 1TWGA 2J7PA 1M2VA 2PX3A 3RTRB 4CSAA 1Z6AA 2J45A 2C2VS 2DYSC 4LLBA 4ULWA 2Y43A 1TKNA 2FUUA 2WZLA 3N24A 4ZQLA 2FUIA 2Y3GA 4C7OA 4PPEA 5BUOA 4XTKA 4C3BA 4QI0A 5DQZA 1OCRC 2Y1MA 3EB5A 4I7DA 5JG6A 4ANJA 5DINA 2A6EF 2NG1A 4Q7CA 4XWJA 2ECNA 1QZXA 4G7HF 3VAYA 4U5DE 2E6RA 2FFHA 4NN2A 1ZHYA 1HYJA 3S29A 2ECWA 4YABA 3DM5A 3B0VC 5AIUA 4A49A 2G43A 4QDLA 4G7ZF 4N06A 4U5BE 3ASLA 3KQIA 3M63A 4UP5A 4G7OF 5KYXA 2M6MA 1MMAA 3O70A 3T7LA 1WGWA 3N0TA 2YEVA 1ZBDB 4FIPA 2H7BA 4LKAA 4N4FA 4PJJA 3DM9B 3U5OA 4RD9A 2M3HA 2CSYA 5G0FA 4FESA 2A1DD 4BJ6A 2Q9BA 3GODA 4BJ5A 3SNHA 1V87A 2LGGA 3PHF2 3JSZA 2VPGA 2YQLA 3N9QA 5TDWA 4CBEA 2VPBA 3KMIA 2QTVA 2CNWA 4YADA 1MNDA 1LS1A 1SZIA 5B1BC 4G0HA 2K16A 3WODF 2CKLA 4N3WA 2XRHA 4R8PK 2QJ0A 2YU4A 2C04A 4ZDTA 5FB1A 3Q6NA 3ASOC 2WB7A 3EGXB 4GYTA 5TABA 4IWBA 4XLPF 2ZETC 3EHMA 4YAXA 2F6NA 1M2VB 5IY5C 3N9LA 2LXHC 5J3XA 4BBQA 2FGYA 4O6NA 2GFHA 3PUQA 3EZIA 3NG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I50 A;  2XB1 A;  2LQ6 A;  4MVT A;  2ECV A;  2MA6 A;  5LCW B;  2L80 A;  1WEM A;  3PHD A;  2D8S A;  5LKU A;  2CSZ A;  5LKZ A;  4AP4 A;  3HCT A;  4C9Z A;  5AIT A;  2L43 A;  5TDR A;  2KWN A;  2IDA A;  5EYA F;  1JM7 B;  4GB0 A;  2YW8 A;  3HTK C;  1VD4 A;  1VYX A;  4QF3 A;  2CKL B;  5FER A;  3V43 A;  1WIL A;  1WFK A;  1WEP A;  5D1M B;  2LGL A;  3KNV A;  2EOD A;  2L0B A;  4B7Y C;  3ZPV 1;  1Z2Q A;  3ZTG A;  5KH7 A;  2KRE A;  1WES A;  2XEU A;  1WEW A;  3IHP A;  3L1Z B;  1E4U A;  1WEE A;  4LAD B;  3PUR A;  2MA5 A;  5C11 A;  1HYI A;  2KU3 A;  3FL2 A;  2YSJ A;  2M1R A;  3O36 A;  2KWO A;  2EGP A;  2NAA A;  4WZ3 B;  4ZUX U;  3VK6 A;  5B75 A;  5H1T A;  3SOX A;  5TRB A;  3N9O A;  2MIQ A;  3DPL R;  3SHB A;  4GNF A;  2ECT A;  4AUQ B;  4O64 A;  2YUR A;  4YBT A;  1WEN A;  5FB0 A;  3N9P A;  2L5U A;  2JRJ A;  5B78 A;  5H1U A;  4IC3 A;  4FJC A;  3O35 A;  2LN0 A;  2K1J A;  4Q6F A;  5FEY A;  2VJF A;  4A4B A;  3RPG B;  2F6J A;  2G6Q A;  2LDR A;  2MT5 A;  2H0D A;  2PNX A;  2M85 A;  2JMD A;  2ECG A;  5TBN A;  2ECI A;  1XWH A;  3L11 A;  2VJE A;  3ZPV E;  4F52 B;  1K2F A;  4UP0 A;  1WE9 A;  2MNY A;  2VPE A;  1MM3 A;  2KIZ A;  5D1K B;  4AYC A;  3N9M A;  1WIM A;  4S3O C;  4YAT A;  4P5O B;  3SOU A;  2KGI A;  1MM2 A;  1JOC A;  3U5P A;  3MHH A;  3KV5 A;  4A0C D;  3MHS A;  2YT5 A;  1WEU A;  2YYR A;  5LKX A;  3LQJ A;  2Y1N A;  1F62 A;  1LDJ B;  4QF2 A;  1G25 A;  2L75 A;  3RPG C;  4PTB A;  3QZV A;  4WA6 A;  5DKA A;  4BHW A;  4I7B A;  2H0D B;  5D1L B;  2MUM A;  1RMD A;  4UI9 B;  2RI7 A;  1Z6U A;  2YRE A;  3HCS A;  4LK9 A;  2VJE B;  3M62 A;  3ZYQ A;  1Z60 A;  3ZVY A;  1BOR A;  3GL6 A;  3U5N A;  3LRQ A;  4WZ0 A;  2EA6 A;  2YQM A;  4CCG X;  2QIZ A;  1CHC A;  4AYC B;  1VFY A;  2QIC A;  4AVX A;  2F42 A;  4L58 A;  3N9N A;  4GNE A;  3C6W A;  2KYU A;  2MD7 B;  5KH3 A;  4FO9 A;  4S3O B;  2LGK A;  3EB6 A;  2OXQ C;  4V3L C;  4TKP B;  2MNZ A;  4R7E A;  3U5M A;  1FP0 A;  3ZVZ B;  2AN6 A;  4YC9 A;  1X4J A;  5B79 A;  4GND A;  1N87 A;  2PUY A;  4X3G A;  3ZNI A;  5H9M A;  2HYE D;  4LJN A;  4V3K C;  1WEO A;  2KGG A;  4I7C A;  2JMJ A;  4MSX A;  4IC2 A;  1JM7 A;  4R2Y A;  5C13 A;  2KE1 A;  2MD8 C;  2JMI A;  3GV4 A;  2KR4 A;  3O37 A;  2DX8 A;  2YSM A;  1X4U A;  3I2D A;  2CT2 A;  3C5K A;  3O7A A;  3HCU A;  2E6S A;  5H1V A;  2VPD A;  2RSD A;  3T6R A;  1U6G B;  2BAY A;  5B8D A;  2YUC A;  5KH9 A;  5I3L A;  5B77 A;  1DVP A;  1FBV A;  2C2L A;  3KV6 A;  4FK5 A;  3SOW A;  5G04 B;  2UZG A;  3DQV R;  2LXP C;  2VP7 A;  2KWJ A;  3LQH A;  1WGM A;  2ECJ A;  4XI1 A;  1WEV A;  5B76 A;  2VJF B;  2LV9 A;  4WZ2 A;  2KFT A;  4YBS A;  5G05 B;  1X4I A;  2VNF A;  1LDK C;  4CA1 A;  4B86 C;  4YBM A;  2G45 A;  5LKT A;  1IYM A;  1T1H A;  2FSA A;  3NG2 A;  2HDP A;  2LRI C;  2YHO A;  3LQI A;  2K4D A;  3M99 A;  4L7X A;  2LGV A;  2K17 A;  1WEQ A;  2YHN A;  4A4C A;  4W4U A;  3O33 A;  4GNG A;  3L1X A;  2KWK A;  3O34 A;  3RTR B;  2C2V S;  4LLB A;  2Y43 A;  2FUU A;  4ZQL A;  2FUI A;  4PPE A;  3EB5 A;  2Y1M A;  5JG6 A;  4I7D A;  5DIN A;  2ECN A;  2E6R A;  4NN2 A;  1HYJ A;  4YAB A;  2ECW A;  5AIU A;  4A49 A;  2G43 A;  3ASL A;  3KQI A;  3M63 A;  4UP5 A;  2M6M A;  3T7L A;  3O70 A;  1ZBD B;  4FIP A;  4LKA A;  4N4F A;  3U5O A;  2M3H A;  2CSY A;  5G0F A;  2LGG A;  1V87 A;  3N9Q A;  2YQL A;  2VPG A;  5TDW A;  2VPB A;  4YAD A;  2K16 A;  2CKL A;  4N3W A;  4R8P K;  2QJ0 A;  2YU4 A;  4ZDT A;  5FB1 A;  5TAB A;  2ZET C;  4YAX A;  2F6N A;  3N9L A;  2LXH C;  5J3X A;  4BBQ A;  3PUQ A; 
#chains in the Genus database with same CATH topology
 3NYM A;  4I1M A;  3Q7G A;  4PFP A;  3ZWI A;  2ECV A;  3W2V A;  3U8P A;  2L80 A;  4Q5S F;  3PLW A;  2L7A A;  2R7Q A;  3VM6 A;  5DS6 A;  2D8S A;  3ZQY A;  3LJU X;  4J7T A;  5AIT A;  4D4X A;  1OR3 A;  5E3C A;  3UMH A;  2MKE A;  1M2O A;  3SXM A;  2XXA B;  2WZF A;  5KYY A;  2KWN A;  3K1H A;  2XM4 A;  2D4U A;  2XLW A;  4YK5 A;  3HTK C;  1TFO B;  2ZXW C;  5F5F A;  4I3M A;  2W45 A;  1V74 B;  2OU6 A;  1O3U A;  1Q0F A;  2YL3 A;  2ZXO A;  4MVZ A;  4DBQ A;  2XP0 A;  1KNY A;  3M1C B;  1CPQ A;  4EBJ A;  1WEP A;  2EOD A;  2YLG A;  4CSA C;  4KNW A;  2IYL D;  5B3I A;  1YDI A;  5JLI A;  1A41 A;  3T6J A;  4PJM A;  2QE9 A;  2EIJ C;  2KRE A;  3L1Z B;  1OCC C;  3OWT A;  1WEE A;  2ETS A;  2KU3 A;  1M56 C;  3W4Y A;  1W2W A;  1BR1 A;  2M1R A;  2EIL C;  3Q7L A;  3KDE C;  4JE9 A;  1N1C A;  2Z15 A;  4YL0 A;  3QMK A;  1HW2 A;  5SVY A;  1UFB A;  4DBR A;  2RR4 A;  1EI7 A;  4HE8 D;  3TUL A;  3MFN A;  3ASN C;  3FAP B;  2ECT A;  1ZW3 A;  4AUQ B;  4PFO A;  3UNG C;  4O64 A;  4YBT A;  1E83 A;  1WAT A;  3W8H A;  2JRJ A;  5B78 A;  2IXO A;  3B0P A;  1JPJ A;  2KK1 A;  3B9Q A;  2LN0 A;  3QVY A;  2IOQ A;  4BG0 A;  3EGD A;  1IZM A;  2KKX A;  4JW1 A;  1LVK A;  2XL6 A;  1H7I A;  2ZPA A;  3LS1 A;  2LDR A;  1LKX A;  3JCU Q;  3HJC A;  2D5R B;  2LD6 A;  3GM3 A;  3IQT A;  2LSE A;  4C7O B;  4K7B A;  4F52 B;  3FAJ A;  1K2F A;  2DSM A;  2MNY A;  2VCC A;  3LNM B;  4XPY A;  2VPE A;  4N4W A;  2FD4 A;  2YZS A;  1PCX A;  2PBE A;  3LS0 A;  2FFW A;  2EPN A;  1Z63 A;  3MX3 A;  4XPW A;  3I5P A;  1Q0G A;  1J8M F;  5E3A A;  4O79 A;  4A0C D;  1V4A A;  4YT8 A;  2XOZ A;  4MTF A;  1ZU5 A;  2YT5 A;  4ER9 A;  2YL7 A;  4NY3 A;  4LER A;  3UGP A;  2EPM X;  2W9Y A;  1NFN A;  5HV9 A;  5DQT A;  4YJW A;  3V5Y A;  3QZV A;  5DKA A;  1ZHZ A;  4I7B A;  2H0D B;  4BHW A;  3GEE A;  1DOV A;  4AK9 A;  2J46 A;  2RI7 A;  1T9K A;  3WG7 C;  5B1A C;  4XLN F;  2F22 A;  5JSL A;  4LK9 A;  2WVO A;  3O10 A;  3I4U A;  1Z60 A;  2XLM A;  1BDJ B;  4WZ0 A;  2EA6 A;  4DVZ A;  1NZE A;  3EGX A;  3KPH A;  2HJ3 A;  1NFO A;  4AVX A;  1LM3 B;  3AQC A;  2R7W A;  5KYY B;  2WVN A;  3LNR A;  2KYU A;  5KH3 A;  4FO9 A;  2OCC C;  4LAC B;  3ABM C;  1MMG A;  2MHR A;  2MNZ A;  4R7E A;  4TKP B;  1SR2 A;  2IM8 A;  3DE9 A;  3ZIB A;  3ZVZ B;  2P61 A;  2JD3 A;  2Y3D A;  3K66 A;  5B79 A;  4BJT A;  3B71 A;  3ZNI A;  1TQG A;  4CX9 A;  2R03 A;  4XEF A;  4WAB A;  1CGM E;  4IC2 A;  1GM5 A;  1LIH A;  5A6K A;  1VTM P;  3U5S A;  2KR4 A;  3E70 C;  4Z9H A;  4OIO F;  5TJ5 E;  4NTF A;  2IXN A;  2DX8 A;  4W8K A;  1YAR O;  2YSM A;  3I2D A;  3C5K A;  3E2D A;  2AVK A;  1U6H A;  2MYS A;  2PF4 E;  3T6R A;  1ZHX A;  2LP4 A;  3KYJ A;  3TK0 A;  5B77 A;  4I44 A;  4CDY A;  2OEV A;  1QQ3 A;  3GWN A;  2KWJ A;  4IAR A;  1NU9 C;  3OA1 A;  4QI2 A;  4XI1 A;  1WEV A;  1G5Z A;  3EGD B;  1JAF A;  2AWY A;  2A0B A;  1EQ1 A;  2YQY A;  2KGO A;  2H7O A;  3JYH A;  2D8U A;  2KFT A;  2J7P D;  5E33 A;  3CZ6 A;  1X4I A;  2VNF A;  4MVQ A;  2G45 A;  2MWQ A;  1IYM A;  2FSA A;  1JR8 A;  3JTL O;  5F28 E;  2NPU A;  2NSG A;  3SP1 A;  3A11 A;  3C8G D;  3M99 A;  4L7X A;  2K17 A;  3DE8 A;  1WEQ A;  4JCH A;  2YHN A;  4W4U A;  2VCA A;  3L1X A;  2BL2 A;  3RF3 A;  2YVR A;  1M2V A;  5A6B D;  2DYS C;  1I4Z A;  2B0O E;  2Y43 A;  2WZL A;  5COM A;  2Q00 A;  3N24 A;  3BRJ A;  2FUI A;  2Y3G A;  4NTA A;  4I7D A;  4U9E A;  4ANJ A;  2NG1 A;  2ECN A;  3VAY A;  2FFH A;  3S29 A;  4AL1 A;  4QDL A;  5L0C A;  3FOP A;  3ASL A;  3M63 A;  1RMV A;  2M6M A;  3T7L A;  3O70 A;  1QVX A;  3DM9 B;  4RD9 A;  2M3H A;  2UUI A;  4J7Y A;  5G0F A;  4FES A;  1PV3 A;  4MTG A;  1E2X A;  2LGG A;  3SNH A;  2YQL A;  5TDW A;  2VPB A;  2CNW A;  1MND A;  1SZI A;  4XPX A;  4N3W A;  2QJ0 A;  1LE4 A;  2GA0 A;  3Q6N A;  3EGX B;  2OWA A;  4IWB A;  2F6N A;  1H9G A;  4BBQ A;  2L6G A;  2EPL X;  3NG1 A;  3FXH A;  2R7R A;  3U2M A;  1C03 A;  2LQ6 A;  3KL4 A;  2DGJ A;  3ABL C;  3PHD A;  4MVO A;  2L6H A;  2IQJ A;  5LKU A;  3HNJ A;  1Z7Q c;  5LKZ A;  5KYX B;  2L43 A;  2CSV A;  4YL1 A;  3O39 A;  4YT4 A;  4YWQ A;  3H65 A;  1PD1 A;  2YLI A;  2IDA A;  3FEH A;  1CPR A;  4RDA A;  2XLE A;  1MMD A;  3AG1 C;  3H2U A;  1VYX A;  1E84 A;  2RD9 A;  4JKV A;  5FER A;  1TFK B;  2GDC A;  4LDR A;  3M79 A;  3NMI A;  1RKC A;  5D1M B;  3KNV A;  4MVS A;  1K05 A;  2L0B A;  4FWV A;  3TD7 A;  2W4B A;  3ZPV 1;  1NG1 A;  3C63 A;  2LIG A;  3ZTG A;  2VC9 A;  5KH7 A;  1WEW A;  3IHP A;  3V5X A;  4IRU A;  4KBL A;  1E4U A;  4LAD B;  3PUR A;  1UG7 A;  3EG9 A;  1HYI A;  1S05 A;  3G4Z A;  1U0B B;  2XLD A;  3O36 A;  4IAO A;  1PD0 A;  2EGP A;  2Q3T A;  1KTM A;  3QZC A;  1VK5 A;  4H9D A;  4ZUX U;  3LVQ E;  3GWL A;  5H1T A;  3V7O A;  3SOX A;  3N9O A;  5SVX A;  3DPL R;  3JRT A;  4MW8 A;  3GM2 A;  2L5U A;  1OKK A;  1ORY A;  4N6C A;  1D0Z A;  4PK4 A;  4Q6F A;  5FEY A;  3TOL A;  1JMW A;  1T5O A;  2F6J A;  2G6Q A;  2H0D A;  2JMD A;  1QSP A;  5E2Q A;  3EHN A;  1Q0D A;  2ECI A;  1BR2 A;  3UGO A;  4UP0 A;  1WE9 A;  3PCV A;  2HSQ A;  3U9M A;  2A6H F;  3WAQ A;  2PFD A;  3AG4 C;  3RYL A;  5KYN A;  2Y69 C;  4S3O C;  1FFH A;  1OCO C;  2TMV P;  1A7V A;  3NKE A;  1ST6 A;  4LDK A;  3MHH A;  3KV5 A;  2AP3 A;  3T6G B;  5JS5 A;  3HNI A;  2WVQ A;  3NKD A;  4DOZ A;  1L7C A;  3DI5 A;  2BE5 F;  3GAN A;  2Y1N A;  5T3W A;  2PNO A;  4OGC A;  2R7S A;  2L75 A;  4JZA A;  5EGY A;  2LFF A;  1Z23 A;  5JVE A;  4MW3 A;  2MUM A;  3ITF A;  3K6B A;  1RMD A;  3FMS A;  5T3T A;  1Z6U A;  2YRE A;  3DWD A;  3W2W A;  3LEO A;  3N2Z B;  1B68 A;  4P9T A;  3JZ0 A;  3LAY A;  3C18 A;  4OIQ F;  4Z9I A;  1BOR A;  4WGY A;  1Y6D A;  2JX0 A;  1FAP B;  1HMD A;  2Q9A A;  2YQM A;  4XEK A;  3FDQ A;  4EBB A;  2KQ9 A;  4E0I A;  1OR2 A;  5EHH A;  4QQ4 A;  4EBK A;  4O7G A;  1YAU O;  1YLM A;  5DS4 A;  3C6W A;  1ZU4 A;  4ZLD A;  3LVR E;  1OCZ C;  5CI8 A;  4LLE A;  4S3O B;  4BEM J;  4C3D A;  3U5M A;  1WWP A;  1VB5 A;  2XS1 A;  1EKY A;  3CAX A;  5T1D B;  1FP0 A;  2AN6 A;  2R7T A;  4YC9 A;  3RH3 A;  1X4J A;  4PR9 A;  4GND A;  2HSB A;  3EH2 A;  4O62 A;  5H9M A;  2ZXR A;  2HYE D;  4V3K C;  3H7H A;  1TR2 A;  4DJ9 A;  1XZP A;  2M13 A;  5CIV A;  5SVI B;  2JMJ A;  4R2Y A;  2KE1 A;  2KKY A;  2P7V A;  3GV4 A;  5DVW A;  2X51 A;  3DJN B;  3EG9 B;  2L6F A;  1X4U A;  2H8A A;  2HJM A;  1NU7 D;  3O7A A;  1C17 M;  2GAQ A;  3L8J A;  3K7D A;  2ZXP A;  2VPD A;  2PX0 A;  1OXB A;  1NLX A;  1ZVZ A;  2I8B A;  4U5H A;  3JT1 A;  5B8D A;  4FX5 A;  1C02 A;  2XL8 A;  2YUC A;  5KH9 A;  5I3L A;  1Z3I X;  1QKR A;  2KNH A;  3KV6 A;  3SOW A;  3DQV R;  2VP7 A;  2YHS A;  3LQH A;  1WGM A;  2VB6 A;  3IQ6 A;  3AG3 C;  3DMD A;  2CON A;  2HKV A;  2LV9 A;  4E17 A;  4U9D A;  1XWJ A;  3B29 A;  1TWH A;  4MVR A;  3QW1 A;  5G05 B;  2EGM A;  5A6A A;  1HE1 A;  3L34 A;  1T1H A;  3NG2 A;  1SF8 A;  2LRI C;  5COG A;  2YHO A;  1T01 A;  3EJN A;  5DS5 A;  3LQI A;  5KYW A;  3HKK A;  2K4D A;  1S7Z A;  2L81 A;  2G3K A;  5DLJ A;  1TWG A;  4XEV A;  5AC4 A;  3RTR B;  4ULW A;  2FUU A;  4ZQL A;  1OXK A;  3EB5 A;  5DQZ A;  5AC5 A;  2Y1M A;  1R4T A;  3U0C A;  2ECW A;  4A49 A;  2YRF A;  5JRA A;  4UP5 A;  4G7O F;  5KYX A;  2RSE B;  3N0T A;  2XOY A;  2UUH A;  4LKA A;  4N4F A;  3U5O A;  4FAP B;  2HUJ A;  2YVK A;  2A1D D;  3QVZ A;  4K1O A;  1A7E A;  3JSZ A;  2VPG A;  3DWW A;  4EIY A;  2QTV A;  1LS1 A;  3PDM P;  4G0H A;  2XRH A;  2C04 A;  4IB4 A;  4IGG A;  3ASO C;  2WB7 A;  4GYT A;  3FM8 C;  1ORS C;  2ZET C;  3EHM A;  5IY5 C;  5K0I A;  1WTY A;  5FZT A;  1R5I D;  3FOO A;  2CCY A;  2I50 A;  3R7C A;  1O5H A;  5JP7 A;  2XB1 A;  3J06 A;  2MA6 A;  4MVT A;  3X2Q C;  4C3E A;  1WEM A;  4NQF A;  3SEO A;  4Q4Z F;  3S27 A;  4JJG A;  3UMI A;  2YWA A;  3LDY A;  3CSK A;  3HLZ A;  4JVS A;  1AEP A;  2Y39 A;  2W4M A;  1ZZP A;  2YW8 A;  4CS7 A;  1YVI A;  2L7P A;  4D4N A;  1JRA A;  4EHP A;  1VD4 A;  1F1M A;  3C7J A;  2CKL B;  1RKE B;  4JTC B;  5BQH A;  5D92 A;  3ZG1 A;  1DOW A;  1I5N A;  1WFK A;  2WL8 A;  2J8W A;  3R2P A;  4OIP F;  4B7Y C;  1BZ4 A;  4E18 A;  1Z2Q A;  2XEU A;  4O6Y A;  3S28 A;  1QPU A;  1VMA A;  3AQB A;  1G8X A;  2NSF A;  2MA5 A;  5C11 A;  4OD5 A;  3H2V A;  4BPM A;  5BQI A;  3FL2 A;  1OW8 A;  3AGU A;  1A7D A;  2KWO A;  3V5Z A;  2HZ8 A;  4WZ3 B;  2R9R B;  2XOC A;  3VK6 A;  2CW0 F;  1LI5 A;  1FMV A;  5B75 A;  3US6 A;  3GM1 A;  3SYN A;  2R7O A;  2MIQ A;  2O9X A;  3POV A;  2CGE A;  1VLS A;  3FHD A;  4GNF A;  1WEN A;  5FB0 A;  3N9P A;  2V26 A;  2M64 A;  3LES A;  5H1U A;  4IC3 A;  5A69 A;  4YN0 B;  3O35 A;  1H9T A;  3PMR A;  3SXY A;  3LEV A;  4E7S A;  5KYW B;  2K1J A;  2OJE D;  2R7U A;  2VJF A;  4MS2 A;  3G50 A;  2FAP B;  3RPG B;  2QUP A;  1VLT A;  4E7Z A;  5KYU A;  2MT5 A;  1D0Y A;  2XLV A;  4PJL A;  2EIN C;  2ECG A;  5TBN A;  1E86 A;  2XS8 A;  1XWH A;  3MBG A;  4HFF B;  4E0H A;  4RBN A;  3DJU B;  4M63 A;  4U5C E;  1MBM A;  4O6M A;  2IXM A;  3MYF A;  3Q6M A;  1O87 A;  4CS8 A;  3L1M A;  3UR3 C;  3HNL A;  1MM3 A;  3E9V A;  3AJM A;  3ZSU A;  1TWA A;  3L8I A;  4MVM A;  2OOC A;  3M4C A;  4YAT A;  4YL3 A;  4P5O B;  3SOU A;  2QLA A;  2KGI A;  1T6Q A;  3U5P A;  1FMW A;  4MQ9 F;  1OW6 A;  1M6T A;  2BC5 A;  3MHS A;  1MMN A;  3LUT B;  2YYR A;  3F46 A;  3LQJ A;  4GQH A;  1LDJ B;  3IPM O;  4QF2 A;  3U8V A;  4WA6 A;  3FVY A;  1J8Y F;  4IAQ A;  3U9J A;  5SVI A;  2KW3 C;  4YT5 A;  4AX2 A;  2EPK X;  2WZG A;  4P9F A;  3DDT A;  3HCS A;  2VJE B;  1WAS A;  3JYY A;  4EWC A;  4KNV A;  2DI3 A;  4I1O B;  3GL6 A;  3U5N A;  1IW7 F;  2NUT B;  4CDA A;  4NC3 A;  1SMY F;  2P0N A;  2E87 A;  4CCG X;  3F47 A;  4MTO A;  4UDV A;  4AYC B;  2QIC A;  3RQF A;  4KI2 A;  2F42 A;  1YA7 O;  4L58 A;  4OIN F;  4GEH A;  1T6I A;  2KC3 A;  2MD7 B;  4ZLC A;  5L0I A;  1VYI A;  4JTD B;  4DRJ B;  2LGK A;  3EB6 A;  3LLK A;  2XLO A;  4WGZ A;  1K04 A;  2XLH A;  1FNT c;  2OQM A;  4AE4 A;  4ONS A;  2R7V A;  3VYW A;  3AOU A;  3C8G A;  2YL1 A;  4CDV A;  2CDQ A;  4Z9J A;  3O47 A;  1Y4C A;  2PUY A;  2L9J A;  2R25 A;  5K3Q A;  5A6B A;  2KGG A;  1K40 A;  4MSX A;  3Q1D A;  1JM7 A;  3RFY A;  3TOM A;  2Q7R A;  3DD7 A;  5CI9 A;  1D1C A;  4CIH A;  2DYR C;  3UMK A;  3ZTZ A;  1KU2 A;  2C03 A;  4CS8 C;  2Y3B A;  1EA8 A;  3AGT A;  3FJU B;  1HW1 A;  2E6S A;  5H1V A;  5A6J A;  3KH2 A;  3QW0 A;  3T9O A;  1U6G B;  2BAY A;  4LDQ A;  1ORJ A;  3OEO A;  3EH1 A;  3T6B A;  3RW0 A;  5COF A;  1DVP A;  2C2L A;  4FK5 A;  5G04 B;  4Z0R A;  2R05 A;  2ECJ A;  1RXQ A;  1LS4 A;  5GPG B;  3K1I A;  2HMZ A;  2VJF B;  3RIP A;  2J9U A;  5KYU B;  2V3C C;  4YBS A;  1ZHT A;  2J9W A;  3DKA A;  3EPV A;  1Q0K A;  4K0D A;  4YBM A;  1FFT C;  4HFK B;  5LKT A;  2E61 A;  1JOG A;  3ZTM A;  2J0X A;  2AWC A;  2PP4 A;  4Z0O A;  1YJG A;  1FR0 A;  1GGQ A;  3IQC A;  3NRH A;  3O33 A;  5L3V A;  3O34 A;  2J45 A;  3M15 A;  2JM3 A;  4OGE A;  4LLB A;  1LPE A;  4JC7 A;  3JRM O;  1DCQ A;  1AVO B;  4PPE A;  256B A;  5BUO A;  4QI0 A;  1CGO A;  5DIN A;  2P57 A;  4G7H F;  4U5D E;  1HYJ A;  4YAB A;  2DB4 A;  3DM5 A;  4G7Z F;  4N06 A;  4U5B E;  3KQI A;  3MYI A;  2A0U A;  1ZBD B;  4FIP A;  1LE2 A;  2KSF A;  3TQO A;  4CJO A;  4JEB A;  2LQG A;  2KYH A;  4BJ6 A;  2B0H A;  3GOD A;  4BJ5 A;  1V87 A;  3PHF 2;  3KMI A;  5B1B C;  2K16 A;  3WOD F;  2CKL A;  1RKE A;  2YU4 A;  5FB1 A;  4XLP F;  1T6U A;  3ZDL A;  3TJ5 A;  1YZA A;  2OKU A;  4CJG A;  3N9L A;  2LXH C;  5J3X A;  2FGY A;  3IQ5 A;  2GFH A;  2Q4F A;  3EZI A;  3DAF A;  4ULV A;  5EK0 A;  5LCW B;  3DXJ F;  4AE4 B;  3K1I C;  1WN0 A;  3C8G B;  5FCL A;  3ATP A;  4JEA A;  4JRZ A;  2J9V A;  1U89 A;  1LI7 A;  2P6V A;  2CSZ A;  4DRH B;  4AP4 A;  3HCT A;  4C9Z A;  4OD4 A;  5TDR A;  3GOR A;  3TJ6 A;  1D1B A;  1SYQ A;  5EYA F;  5L3Q A;  1JM7 B;  3VF0 A;  3T4R A;  4GB0 A;  3KYI A;  1QLE C;  4QF3 A;  4YT2 A;  2HV6 A;  5D91 A;  3V43 A;  1WIL A;  3NYJ A;  4J30 B;  3NMK A;  2LGL A;  3LLI A;  2KJG A;  1BR4 A;  3EZH A;  1ZYR F;  1TWC A;  1WES A;  3B0U X;  2I15 A;  1A0B A;  5L0F A;  1BBH A;  3L0I A;  2YSJ A;  1Q0M A;  3K33 A;  4HEA J;  4U5E E;  4P6I C;  4CS9 A;  2CNW D;  2M4E A;  3KKB A;  2NAA A;  3JSE O;  5L0J A;  2LK4 A;  3S9O A;  5L0H A;  3EFO A;  5TRB A;  3U2L A;  2OJQ A;  3U3B A;  1D0X A;  3AG2 C;  2HV7 A;  2EIM C;  3M4B A;  3GEH A;  3SHB A;  4BJ6 C;  4BJ5 C;  1MNE A;  3O55 A;  3MDB C;  2YUR A;  2YLD A;  1M57 C;  4U5G A;  2HMQ A;  2LCH A;  4FJC A;  2JPU A;  4U5F E;  4A4B A;  2CRW A;  1HMO A;  3QTH A;  2NUP A;  2PNX A;  2M85 A;  3U3F A;  2XL4 A;  2OG2 A;  3X1O A;  4B6I A;  3I5Q A;  2A69 F;  2VJE A;  3L11 A;  3ZPV E;  3FAO A;  1D1A A;  3NDB B;  1MQV A;  3ZVR A;  2NUT A;  2EPO A;  4EUK B;  2ASR A;  4JIO A;  1RJ9 A;  4DXW A;  2KIZ A;  5D1K B;  1VOM A;  4CIP A;  4AYC A;  3N9M A;  1WIM A;  3SZR A;  4A2N B;  3S90 A;  2DJA A;  3IHU A;  4NTB A;  3VRC A;  1MM2 A;  1JOC A;  2LAU A;  3M7K A;  2LFD A;  2EIK C;  2CRR A;  1WEU A;  5LKX A;  2XM0 A;  1F62 A;  3CEX A;  4KC9 A;  1RCP A;  4JUR I;  1G25 A;  3RPG C;  4PTB A;  5JT4 A;  2GWW A;  4JJF A;  5D1L B;  2IBF A;  4UI9 B;  4X0R A;  4H4K C;  1YYJ A;  3M62 A;  4CS9 C;  3ZYQ A;  3SUB A;  3ZVY A;  3FAN A;  3LRQ A;  4PAC A;  1OKK D;  4DRI B;  1ZW2 A;  4IJJ A;  1ZHW A;  3C62 A;  2QIZ A;  1YZC A;  2H7V C;  1CHC A;  1VFY A;  3S0X A;  4MVU A;  2X0C A;  1G4W R;  3N9N A;  4GNE A;  3MLG A;  1AUE A;  1V55 C;  2VAS A;  4MND A;  4OIR F;  1YYX A;  3IEE A;  2OXQ C;  4V3L C;  2G3V A;  3NYL A;  2Q9C A;  4PJN A;  5F5H A;  3WHN A;  3EQL F;  1VYK A;  1N87 A;  4X3G A;  2Y3H A;  1GQA A;  3BEH A;  4F4B A;  1Z5Z A;  4LJN A;  2VH3 A;  2XXA A;  1WEO A;  4I7C A;  2ZD9 A;  3ZC4 A;  1YA9 A;  3GEI A;  3SXZ A;  5C13 A;  3ZQV A;  3ECS A;  2JMI A;  2MD8 C;  5L0G A;  2VCB A;  1L3P A;  4J32 B;  3O37 A;  4L6R A;  4F1P A;  2CT2 A;  3HCU A;  5HSW A;  3O6X A;  3CQZ A;  2IXP A;  4XQ1 A;  3W8I A;  2RSD A;  3EFO B;  3SXK A;  2XSE A;  5BQG A;  2R7X A;  2J0W A;  3DAG A;  4R32 A;  1OW7 A;  1FBV A;  2B0J A;  3RQG A;  2UZG A;  1H6G A;  2G62 A;  2LXP C;  4BJ1 A;  3NMJ A;  2QNL A;  5B76 A;  3RKO F;  1XZQ A;  2A68 F;  3LJB A;  4WZ2 A;  1WOL A;  1I4Y A;  2NUP B;  1CGN A;  1LDK C;  4BEJ A;  1FTS A;  4LLC A;  4CA1 A;  2OEX A;  4B86 C;  1HE9 A;  4H54 A;  5AGF A;  3T9K A;  4DVY P;  4WJ0 A;  2HDP A;  3DZA A;  1JPN A;  3ABK C;  3A9C A;  2CYD A;  2QY9 A;  1V54 C;  5B3S C;  2R02 A;  2LGV A;  2EXU A;  1RJ9 B;  1GS9 A;  4A4C A;  4GNG A;  2KWK A;  4N6H A;  2J7P A;  2PX3 A;  4CSA A;  1Z6A A;  2ICW G;  2C2V S;  1APC A;  1TKN A;  5JUA A;  1G4U S;  4C7O A;  2J9B A;  2P1A A;  3JUE A;  4XTK A;  4C3B A;  4W8P A;  5JG6 A;  1OCR C;  2JUN A;  2A6E F;  4Q7C A;  4XWJ A;  1QZX A;  2E6R A;  4NN2 A;  1ZHY A;  3B0V C;  5AIU A;  2G43 A;  2HFI A;  1MMA A;  1WGW A;  2YEV A;  3RVY A;  3RVZ A;  1E85 A;  2H7B A;  2YKZ A;  4NCQ A;  2YL0 A;  4PJJ A;  3HNK A;  4EKW A;  4JTA B;  2CSY A;  4AL0 A;  2Q9B A;  3N9Q A;  4A4A A;  3RQE A;  4CBE A;  4YAD A;  5L0D A;  3S84 A;  1NBB A;  4R8P K;  4ZDT A;  4JCZ A;  5TAB A;  1NSG B;  2AU5 A;  3G4X A;  4YAX A;  1M2V B;  3C8Z A;  1OQC A;  4O6N A;  1HY5 A;  3PUQ A;  2HS5 A;  4G78 A; 
#chains in the Genus database with same CATH homology
 2I50 A;  3DAF A;  2R7R A;  1O5H A;  2XB1 A;  2LQ6 A;  4MVT A;  3NYM A;  4I1M A;  3Q7G A;  4PFP A;  3X2Q C;  2ECV A;  2MA6 A;  3W2V A;  5LCW B;  3DXJ F;  3KL4 A;  4AE4 B;  2L80 A;  4Q5S F;  2DGJ A;  3ABL C;  4C3E A;  3K1I C;  1WEM A;  2R7Q A;  3PHD A;  3SEO A;  4Q4Z F;  5FCL A;  5DS6 A;  3S27 A;  2D8S A;  4JJG A;  3UMI A;  2J9V A;  2P6V A;  5LKU A;  2CSZ A;  5LKZ A;  4AP4 A;  3HCT A;  4C9Z A;  5KYX B;  5AIT A;  3CSK A;  2L43 A;  4OD4 A;  3HLZ A;  5E3C A;  3O39 A;  3UMH A;  4JVS A;  5TDR A;  1M2O A;  4YT4 A;  2XXA B;  4YWQ A;  1D1B A;  2WZF A;  2W4M A;  2Y39 A;  3H65 A;  5KYY A;  1PD1 A;  2KWN A;  2IDA A;  5EYA F;  5L3Q A;  1JM7 B;  3K1H A;  3T4R A;  4GB0 A;  2YW8 A;  4RDA A;  4CS7 A;  3HTK C;  1QLE C;  2ZXW C;  1MMD A;  3AG1 C;  1VD4 A;  5F5F A;  4I3M A;  1VYX A;  4YT2 A;  4QF3 A;  2W45 A;  2HV6 A;  5D91 A;  2CKL B;  5FER A;  3V43 A;  2ZXO A;  4DBQ A;  1WIL A;  3M1C B;  5D92 A;  3NYJ A;  3ZG1 A;  4J30 B;  1WFK A;  1WEP A;  5D1M B;  2LGL A;  3KNV A;  2EOD A;  2WL8 A;  3LLI A;  2IYL D;  4FWV A;  4KNW A;  4CSA C;  3TD7 A;  4OIP F;  2L0B A;  2KJG A;  2W4B A;  4B7Y C;  3ZPV 1;  1NG1 A;  1BR4 A;  3EZH A;  1ZYR F;  3T6J A;  1TWC A;  4PJM A;  1Z2Q A;  3ZTG A;  2EIJ C;  5KH7 A;  2KRE A;  1WES A;  2XEU A;  4O6Y A;  3S28 A;  3B0U X;  1WEW A;  3IHP A;  3L1Z B;  1OCC C;  1VMA A;  3AQB A;  1G8X A;  3OWT A;  4IRU A;  4KBL A;  1WEE A;  4LAD B;  3PUR A;  1E4U A;  2MA5 A;  3EG9 A;  5C11 A;  1HYI A;  4OD5 A;  2KU3 A;  3L0I A;  1M56 C;  3FL2 A;  1W2W A;  2YSJ A;  3K33 A;  4HEA J;  4U5E E;  1BR1 A;  2M1R A;  2EIL C;  3Q7L A;  4P6I C;  4CS9 A;  2KWO A;  3O36 A;  4IAO A;  1PD0 A;  2CNW D;  2EGP A;  2Q3T A;  2M4E A;  3KKB A;  1N1C A;  2Z15 A;  3QZC A;  1VK5 A;  3QMK A;  2NAA A;  4WZ3 B;  4ZUX U;  3VK6 A;  4DBR A;  2CW0 F;  5B75 A;  1FMV A;  5H1T A;  3EFO A;  4HE8 D;  3V7O A;  3SOX A;  5TRB A;  3N9O A;  3SYN A;  1D0X A;  3AG2 C;  2HV7 A;  2R7O A;  2EIM C;  2MIQ A;  3ASN C;  2O9X A;  3DPL R;  3SHB A;  4BJ6 C;  3POV A;  2CGE A;  3FHD A;  4GNF A;  4BJ5 C;  1MNE A;  2ECT A;  4AUQ B;  3JRT A;  4PFO A;  3UNG C;  4O64 A;  2YUR A;  4YBT A;  1WEN A;  5FB0 A;  3N9P A;  1M57 C;  2V26 A;  2L5U A;  3W8H A;  2JRJ A;  5B78 A;  1OKK A;  4U5G A;  3LES A;  5H1U A;  2IXO A;  4IC3 A;  4FJC A;  4YN0 B;  3O35 A;  3B0P A;  1JPJ A;  3B9Q A;  4U5F E;  2LN0 A;  3PMR A;  1D0Z A;  2IOQ A;  3LEV A;  4E7S A;  5KYW B;  4PK4 A;  2K1J A;  4BG0 A;  3EGD A;  4Q6F A;  5FEY A;  2R7U A;  2VJF A;  1IZM A;  4A4B A;  4JW1 A;  1LVK A;  2ZPA A;  3RPG B;  4E7Z A;  5KYU A;  3LS1 A;  2F6J A;  2G6Q A;  2LDR A;  2MT5 A;  2H0D A;  2NUP A;  2PNX A;  2M85 A;  2JMD A;  1D0Y A;  1LKX A;  3JCU Q;  4PJL A;  3HJC A;  2EIN C;  5E2Q A;  2XL4 A;  2D5R B;  2OG2 A;  2ECG A;  3X1O A;  3EHN A;  4B6I A;  2LSE A;  5TBN A;  4C7O B;  2ECI A;  1BR2 A;  1XWH A;  3I5Q A;  3UGO A;  2A69 F;  2VJE A;  3L11 A;  4K7B A;  4HFF B;  3ZPV E;  4RBN A;  3DJU B;  4M63 A;  3FAJ A;  1D1A A;  1K2F A;  4UP0 A;  4U5C E;  3NDB B;  4F52 B;  1WE9 A;  4O6M A;  2IXM A;  2MNY A;  3ZVR A;  2NUT A;  3Q6M A;  1O87 A;  4CS8 A;  2A6H F;  2VPE A;  2PFD A;  3AG4 C;  3UR3 C;  1RJ9 A;  1MM3 A;  2KIZ A;  2YZS A;  3E9V A;  3RYL A;  1PCX A;  5KYN A;  5D1K B;  3ZSU A;  1VOM A;  4AYC A;  3N9M A;  1TWA A;  1WIM A;  3SZR A;  4A2N B;  3LS0 A;  2Y69 C;  4S3O C;  1FFH A;  1Z63 A;  4YAT A;  1OCO C;  3MX3 A;  4P5O B;  3SOU A;  3I5P A;  2KGI A;  1MM2 A;  1J8M F;  1ST6 A;  3NKE A;  5E3A A;  1JOC A;  1FMW A;  3U5P A;  3MHH A;  4O79 A;  4MQ9 F;  3KV5 A;  4A0C D;  4YT8 A;  2EIK C;  3MHS A;  1MMN A;  1ZU5 A;  2YT5 A;  1WEU A;  2YYR A;  2WVQ A;  3NKD A;  4NY3 A;  4DOZ A;  5LKX A;  3F46 A;  4LER A;  3LQJ A;  3UGP A;  2BE5 F;  3GAN A;  2W9Y A;  2Y1N A;  1F62 A;  1LDJ B;  5T3W A;  4KC9 A;  4JUR I;  4QF2 A;  1G25 A;  5DQT A;  2R7S A;  2L75 A;  3RPG C;  4PTB A;  4YJW A;  4JZA A;  4JJF A;  3QZV A;  4WA6 A;  5EGY A;  5DKA A;  1ZHZ A;  3FVY A;  2H0D B;  1Z23 A;  4I7B A;  5D1L B;  4BHW A;  1J8Y F;  2MUM A;  3ITF A;  3K6B A;  1RMD A;  4AK9 A;  2KW3 C;  2J46 A;  5T3T A;  1Z6U A;  2RI7 A;  4YT5 A;  3WG7 C;  2YRE A;  4X0R A;  4UI9 B;  3W2W A;  4H4K C;  5B1A C;  4XLN F;  4AX2 A;  2WZG A;  3N2Z B;  3HCS A;  4LK9 A;  2VJE B;  3M62 A;  2WVO A;  4EWC A;  3LAY A;  4KNV A;  4CS9 C;  3ZYQ A;  4OIQ F;  3I4U A;  1Z60 A;  3ZVY A;  1BOR A;  4I1O B;  3GL6 A;  3U5N A;  3LRQ A;  1IW7 F;  2NUT B;  2Q9A A;  4WZ0 A;  1OKK D;  2EA6 A;  4DVZ A;  2YQM A;  4IJJ A;  3FDQ A;  1ZHW A;  4EBB A;  1NZE A;  1SMY F;  2E87 A;  4CCG X;  3EGX A;  2KQ9 A;  3F47 A;  2QIZ A;  2H7V C;  1CHC A;  4AYC B;  1VFY A;  2QIC A;  3S0X A;  4KI2 A;  5EHH A;  4AVX A;  2F42 A;  4L58 A;  3AQC A;  4O7G A;  4OIN F;  4GEH A;  2R7W A;  3N9N A;  5KYY B;  2WVN A;  3LNR A;  5DS4 A;  4GNE A;  3C6W A;  2KYU A;  3MLG A;  2MD7 B;  1V55 C;  4ZLC A;  1ZU4 A;  4ZLD A;  1VYI A;  2VAS A;  4MND A;  4OIR F;  5KH3 A;  1OCZ C;  5CI8 A;  2OCC C;  4LLE A;  4FO9 A;  4LAC B;  2LGK A;  3ABM C;  4S3O B;  1MMG A;  3EB6 A;  3IEE A;  2OXQ C;  3LLK A;  4V3L C;  4C3D A;  2MNZ A;  4R7E A;  4TKP B;  3U5M A;  2G3V A;  3NYL A;  2Q9C A;  4PJN A;  5T1D B;  4AE4 A;  1FP0 A;  3ZIB A;  2R7V A;  3ZVZ B;  5F5H A;  2AN6 A;  3VYW A;  2JD3 A;  2R7T A;  4YC9 A;  2Y3D A;  3RH3 A;  3K66 A;  1X4J A;  5B79 A;  4GND A;  3EQL F;  2CDQ A;  3EH2 A;  4BJT A;  1VYK A;  1N87 A;  2PUY A;  4X3G A;  2Y3H A;  3ZNI A;  5H9M A;  2ZXR A;  2L9J A;  2HYE D;  4F4B A;  1Z5Z A;  4LJN A;  4V3K C;  1TR2 A;  2VH3 A;  2XXA A;  1WEO A;  2KGG A;  4I7C A;  3ZC4 A;  2JMJ A;  4MSX A;  4IC2 A;  1JM7 A;  3RFY A;  4R2Y A;  5C13 A;  2KE1 A;  3DD7 A;  2P7V A;  3ECS A;  2JMI A;  3GV4 A;  2MD8 C;  5CI9 A;  2KR4 A;  5DVW A;  1D1C A;  3E70 C;  2X51 A;  4CIH A;  4OIO F;  2DYR C;  3DJN B;  3UMK A;  3EG9 B;  2IXN A;  4J32 B;  3O37 A;  1KU2 A;  2DX8 A;  2C03 A;  4W8K A;  4CS8 C;  2Y3B A;  2YSM A;  1X4U A;  3I2D A;  2CT2 A;  3C5K A;  1NU7 D;  3O7A A;  3HCU A;  2E6S A;  5HSW A;  5H1V A;  3O6X A;  3CQZ A;  2IXP A;  3K7D A;  2ZXP A;  3W8I A;  3KH2 A;  2VPD A;  2MYS A;  2PX0 A;  2RSD A;  2PF4 E;  3T6R A;  3EFO B;  1U6G B;  2BAY A;  2I8B A;  1ZHX A;  4U5H A;  2XSE A;  3JT1 A;  3OEO A;  4FX5 A;  2R7X A;  3EH1 A;  5B8D A;  2J0W A;  3T6B A;  3DAG A;  2YUC A;  5KH9 A;  5I3L A;  1Z3I X;  5B77 A;  1DVP A;  2KNH A;  1FBV A;  2C2L A;  3KV6 A;  2B0J A;  4FK5 A;  3SOW A;  4I44 A;  5G04 B;  2UZG A;  2G62 A;  3DQV R;  2LXP C;  2VP7 A;  2KWJ A;  1NU9 C;  3OA1 A;  2YHS A;  3LQH A;  4QI2 A;  1WGM A;  4BJ1 A;  2ECJ A;  2VB6 A;  4XI1 A;  1WEV A;  5B76 A;  3AG3 C;  3DMD A;  3RKO F;  3EGD B;  2VJF B;  2A68 F;  3RIP A;  2J9U A;  2LV9 A;  3LJB A;  4WZ2 A;  5KYU B;  2V3C C;  2KGO A;  2H7O A;  1TWH A;  3JYH A;  2KFT A;  4YBS A;  2J7P D;  5E33 A;  2NUP B;  5G05 B;  1ZHT A;  3CZ6 A;  1X4I A;  2J9W A;  3EPV A;  2VNF A;  1LDK C;  4BEJ A;  1FTS A;  4LLC A;  4CA1 A;  4K0D A;  4B86 C;  2G45 A;  4YBM A;  1FFT C;  4HFK B;  2MWQ A;  5LKT A;  3L34 A;  1T1H A;  2FSA A;  4DVY P;  3NG2 A;  1IYM A;  4WJ0 A;  2HDP A;  2J0X A;  1SF8 A;  3DZA A;  2LRI C;  1JPN A;  2YHO A;  3ABK C;  2PP4 A;  3EJN A;  5DS5 A;  3LQI A;  3SP1 A;  2QY9 A;  5KYW A;  2K4D A;  1V54 C;  3M99 A;  4L7X A;  5B3S C;  1S7Z A;  2L81 A;  2LGV A;  1RJ9 B;  2K17 A;  1WEQ A;  4JCH A;  2YHN A;  4A4C A;  4W4U A;  3NRH A;  3O33 A;  3L1X A;  2G3K A;  4GNG A;  5L3V A;  2KWK A;  5DLJ A;  3O34 A;  1TWG A;  2J7P A;  1M2V A;  2PX3 A;  3RTR B;  4CSA A;  1Z6A A;  2J45 A;  2C2V S;  2DYS C;  4LLB A;  4ULW A;  2Y43 A;  1TKN A;  2FUU A;  2WZL A;  3N24 A;  4ZQL A;  2FUI A;  2Y3G A;  4C7O A;  4PPE A;  5BUO A;  4XTK A;  4C3B A;  4QI0 A;  5DQZ A;  1OCR C;  2Y1M A;  3EB5 A;  4I7D A;  5JG6 A;  4ANJ A;  5DIN A;  2A6E F;  2NG1 A;  4Q7C A;  4XWJ A;  2ECN A;  1QZX A;  4G7H F;  3VAY A;  4U5D E;  2E6R A;  2FFH A;  4NN2 A;  1ZHY A;  1HYJ A;  3S29 A;  2ECW A;  4YAB A;  3DM5 A;  3B0V C;  5AIU A;  4A49 A;  2G43 A;  4QDL A;  4G7Z F;  4N06 A;  4U5B E;  3ASL A;  3KQI A;  3M63 A;  4UP5 A;  4G7O F;  5KYX A;  2M6M A;  1MMA A;  3O70 A;  3T7L A;  1WGW A;  3N0T A;  2YEV A;  1ZBD B;  4FIP A;  2H7B A;  4LKA A;  4N4F A;  4PJJ A;  3DM9 B;  3U5O A;  4RD9 A;  2M3H A;  2CSY A;  5G0F A;  4FES A;  2A1D D;  4BJ6 A;  2Q9B A;  3GOD A;  4BJ5 A;  3SNH A;  1V87 A;  2LGG A;  3PHF 2;  3JSZ A;  2VPG A;  2YQL A;  3N9Q A;  5TDW A;  4CBE A;  2VPB A;  3KMI A;  2QTV A;  2CNW A;  4YAD A;  1MND A;  1LS1 A;  1SZI A;  5B1B C;  4G0H A;  2K16 A;  3WOD F;  2CKL A;  4N3W A;  2XRH A;  4R8P K;  2QJ0 A;  2YU4 A;  2C04 A;  4ZDT A;  5FB1 A;  3Q6N A;  3ASO C;  2WB7 A;  3EGX B;  4GYT A;  5TAB A;  4IWB A;  4XLP F;  2ZET C;  3EHM A;  4YAX A;  2F6N A;  1M2V B;  5IY5 C;  3N9L A;  2LXH C;  5J3X A;  4BBQ A;  2FGY A;  4O6N A;  2GFH A;  3PUQ A;  3EZI A;  3NG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...