1WGMA

Solution structure of the u-box in human ubiquitin conjugation factor e4a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'GSSGSSGLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin conjugation factor E4A
publication title Solution structure of the U-box in human ubiquitin conjugation factor E4A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wgmA01
4P5OB 4F52B 2VJEA 4L7XA 4YATA 2VJFB 3ZTGA 2MD7B 4AP4A 2NAAA 2XB1A 2L5UA 2YHNA 2UZGA 2VNFA 2CKLA 2IDAA 3M63A 2MT5A 2JMIA 1Z2QA 4GNDA 4MSXA 3VK6A 2QIZA 3MHSA 5DKAA 2YU4A 2VPBA 4CCGX 5C11A 1WILA 3SOXA 1LDKC 1HYIA 3IHPA 1X4IA 2YSMA 2C2LA 2LXPC 5G05B 2H0DA 4GNEA 5D1LB 1X4UA 2MA6A 2LN0A 2CSYA 2OXQC 3N9MA 1Z6UA 2CKLB 2Y43A 4O64A 2QICA 3KQIA 3C6WA 1MM2A 2HDPA 4UP0A 3DQVR 4YADA 2M6MA 4B7YC 3U5NA 2JRJA 2YHOA 5TDRA 1VFYA 2H0DB 3L1ZB 4V3KC 3L1XA 4ZDTA 2MIQA 4MVTA 4YBSA 4WZ0A 2KIZA 2KGIA 2Y1MA 2ECTA 5B78A 4WA6A 2I50A 4QF2A 3HCSA 3FL2A 4FJCA 2ECGA 5H1UA 3HTKC 4IC3A 5KH9A 4AVXA 1VYXA 3V43A 4WZ3B 2E6RA 3RPGC 3M99A 1V87A 2KGGA 1F62A 2M3HA 5I3LA 2XEUA 4FIPA 2FSAA 3KNVA 3MHHA 2KU3A 3L11A 2YQLA 2YT5A 2K4DA 2LGLA 1WEMA 4AYCA 3U5PA 2AN6A 2K17A 2KWJA 2JMDA 5FB0A 1U6GB 2MNZA 1X4JA 1FBVA 3N9NA 5G04B 1N87A 5C13A 2VJEB 2F42A 2JMJA 2YREA 1HYJA 3LRQA 2VPEA 4GNFA 2LV9A 2YW8A 3ZVYA 2M85A 5H1TA 2FUUA 1WEPA 4AYCB 1WESA 2L43A 4L58A 3ASLA 4LLBA 2F6JA 5D1KB 4ZQLA 3HCUA 4R7EA 4CA1A 1WEOA 1BORA 4IC2A 4AUQB 3PUQA 2KWKA 5FEYA 2ECNA 4ZUXU 2C2VS 1WFKA 5JG6A 2LGKA 3KV6A 5B75A 2KR4A 2KWOA 5D1MB 4GB0A 3T7LA 3O70A 5LKUA 2KWNA 1WGMA 4YABA 3O33A 2VPGA 3U5MA 4LJNA 3O34A 4A4BA 2L0BA 4R2YA 1G25A 2HYED 2G6QA 3N9LA 4S3OB 2LGGA 2MUMA 2RI7A 3ZYQA 5FB1A 3LQHA 3PHDA 1RMDA 3RTRB 1DVPA 2G45A 5KH7A 2FUIA 1WIMA 1FP0A 2VJFA 1JM7A 3O35A 2LQ6A 4A4CA 4C9ZA 1WENA 2L80A 4X3GA 3N9PA 1WEVA 5H1VA 3ZPVE 2QJ0A 5B79A 2YSJA 2ECVA 4LKAA 5LKXA 3KV5A 2BAYA 2KE1A 3DPLR 2CT2A 3HCTA 1WEWA 2YURA 5TABA 4YBMA 1JM7B 4PPEA 2ECJA 5J3XA 3NG2A 1LDJB 1JOCA 4NN2A 3O37A 5AITA 5B8DA 1CHCA 3EB5A 3T6RA 3ZPV1 3O7AA 2Y1NA 3QZVA 3PURA 5H9MA 1IYMA 4V3LC 3SOWA 1Z60A 3C5KA 3LQIA 4N3WA 2MD8C 4YAXA 2LXHC 2MA5A 1WEQA 1E4UA 4PTBA 2F6NA 2YUCA 4I7CA 2M1RA 3N9QA 2G43A 4XI1A 4BHWA 5AIUA 5LCWB 1ZBDB 2EODA 1WEEA 3GL6A 2KREA 5KH3A 4I7DA 2PNXA 1WEUA 3SHBA 2ECWA 2CSZA 4WZ2A 5B77A 2LGVA 5DINA 3ZVZB 1XWHA 2RSDA 2DX8A 3GV4A 5TBNA 5LKTA 4LADB 5EYAF 2KYUA 2L75A 1K2FA 5FERA 3LQJA 1T1HA 3EB6A 2K1JA 2YQMA 5B76A 4QF3A 4UP5A 2EGPA 1MM3A 3RPGB 4R8PK 4BBQA 4I7BA 2E6SA 4W4UA 2MNYA 2ZETC 4YBTA 3N9OA 2K16A 4A49A 4N4FA 1VD4A 2VPDA 4FK5A 2D8SA 2PUYA 4UI9B 2LDRA 5TRBA 4Q6FA 5LKZA 3I2DA 2ECIA 4A0CD 1WE9A 2LRIC 4FO9A 5G0FA 3U5OA 3O36A 3ZNIA 4GNGA 2YYRA 2VP7A 4B86C 3M62A 4YC9A 5TDWA 2EA6A 2KFTA 4LK9A 4S3OC 4TKPB 3SOUA
chains in the Genus database with same CATH superfamily
4P5OB 4F52B 2VJEA 4L7XA 4YATA 2VJFB 3ZTGA 2MD7B 2CONA 4AP4A 2NAAA 2XB1A 3SUBA 5SVIA 2L5UA 4OGCA 2YHNA 2UZGA 2VNFA 2CKLA 2IDAA 3M63A 2MT5A 2JMIA 1Z2QA 4GNDA 4MSXA 3VK6A 2QIZA 3MHSA 5DKAA 2YU4A 2VPBA 4CCGX 5C11A 1DCQA 1WILA 2DSMA 2JM3A 2RR4A 3SOXA 1LDKC 1HYIA 3IHPA 1X4IA 2YSMA 2C2LA 5SVYA 2OWAA 2LXPC 5G05B 2H0DA 4GNEA 5D1LB 2MKEA 1X4UA 2MA6A 2LN0A 5SVIB 2CSYA 2OXQC 3N9MA 1Z6UA 3O47A 2CKLB 2Y43A 2EGMA 4O64A 2QICA 3KQIA 3C6WA 1MM2A 2HDPA 3JUEA 4UP0A 3DQVR 4YADA 2M6MA 4B7YC 3U5NA 2JRJA 2YHOA 5TDRA 2FFWA 1VFYA 2H0DB 3L1ZB 4V3KC 2IQJA 3L1XA 4ZDTA 2MIQA 4MVTA 4YBSA 4WZ0A 2KIZA 3DWDA 2E61A 2KGIA 2Y1MA 2ECTA 4Z0RA 5B78A 4WA6A 2I50A 4QF2A 4H9DA 3HCSA 3FL2A 3FEHA 4FJCA 2ECGA 5H1UA 3HTKC 2B0OE 4IC3A 5KH9A 4AVXA 1VYXA 3V43A 4WZ3B 2E6RA 3RPGC 4F1PA 3M99A 1V87A 2KGGA 1F62A 2M3HA 5I3LA 2XEUA 4FIPA 2FSAA 2L7PA 3H7HA 3KNVA 3FAOA 3MHHA 2LAUA 2KU3A 3L11A 2YQLA 2YT5A 2K4DA 2LGLA 1WEMA 4Z0OA 4AYCA 3U5PA 2KKXA 2AN6A 2K17A 2KWJA 2XOCA 2JMDA 5FB0A 3E2DA 1U6GB 2MNZA 1X4JA 2P57A 4QQ4A 1FBVA 3N9NA 3LJUX 5G04B 1N87A 5C13A 2VJEB 3LDYA 2F42A 2JMJA 2YREA 1HYJA 3LRQA 2VPEA 4GNFA 2LV9A 2YW8A 3ZVYA 2M85A 5H1TA 2FUUA 1WEPA 3LVQE 4AYCB 2M13A 1WESA 2L43A 4L58A 3ASLA 4LLBA 3LVRE 2F6JA 4O62A 5D1KB 4ZQLA 3HCUA 4R7EA 4CA1A 1WEOA 1BORA 4IC2A 4AUQB 3PUQA 2CSVA 2KWKA 5FEYA 2ECNA 4ZUXU 2C2VS 1WFKA 5JG6A 2LGKA 3KV6A 4OGEA 5B75A 5K3QA 2KR4A 2KWOA 5D1MB 3MDBC 4GB0A 3T7LA 3O70A 5LKUA 2KWNA 1WGMA 2YVRA 4YABA 3O33A 2VPGA 3U5MA 4LJNA 3O34A 4A4BA 2L0BA 4R2YA 1G25A 2HYED 3M7KA 2XP0A 2G6QA 3N9LA 4S3OB 5SVXA 2LGGA 2MUMA 2RI7A 3FM8C 3ZYQA 5FB1A 3LQHA 3PHDA 1RMDA 3RTRB 1DVPA 2G45A 5KH7A 2FUIA 1WIMA 1FP0A 2VJFA 1JM7A 3O35A 3FJUB 2LQ6A 4A4CA 4C9ZA 1WENA 2L80A 4X3GA 3N9PA 1WEVA 5H1VA 3ZPVE 2QJ0A 5B79A 2YSJA 2ECVA 3Q1DA 4LKAA 5LKXA 3KV5A 2BAYA 1MBMA 2XOZA 2KE1A 2FD4A 3DPLR 2CT2A 3HCTA 1WEWA 2YURA 5TABA 4YBMA 1JM7B 4PPEA 2ECJA 5J3XA 3NG2A 1LDJB 1JOCA 4NN2A 3O37A 5AITA 5B8DA 1CHCA 3EB5A 3T6RA 3ZPV1 3O7AA 2Y1NA 3QZVA 3PURA 5H9MA 1IYMA 2DJAA 4V3LC 3KDEC 3SOWA 3DDTA 1Z60A 3C5KA 3LQIA 4N3WA 2MD8C 4YAXA 2LXHC 2XOYA 2MA5A 1WEQA 1E4UA 4PTBA 2F6NA 2YUCA 4I7CA 2M1RA 3N9QA 2G43A 4XI1A 4BHWA 5AIUA 5LCWB 1ZBDB 2D8UA 2EODA 1WEEA 3GL6A 2KREA 5KH3A 4I7DA 2PNXA 1WEUA 3SHBA 2ECWA 2CSZA 4WZ2A 5B77A 2LGVA 5DINA 3ZVZB 1XWHA 2RSDA 2DX8A 3GV4A 5TBNA 5LKTA 4LADB 5EYAF 2KYUA 2L75A 1K2FA 5FERA 3PLWA 3LQJA 1T1HA 3EB6A 2KKYA 2K1JA 2YQMA 2JUNA 5B76A 4QF3A 4UP5A 2EGPA 1MM3A 3RPGB 3FANA 4R8PK 4BBQA 4I7BA 2E6SA 4W4UA 2MNYA 2ZETC 4YBTA 3N9OA 2K16A 4A49A 2CRWA 1VD4A 4N4FA 3T9KA 2VPDA 4FK5A 2D8SA 2EXUA 2PUYA 4UI9B 2LDRA 5TRBA 4Q6FA 5LKZA 3I2DA 2ECIA 4A0CD 1WE9A 2CRRA 2LRIC 4FO9A 5G0FA 3U5OA 3O36A 3ZNIA 4GNGA 2YYRA 2VP7A 4B86C 3M62A 4YC9A 5TDWA 2EA6A 2KFTA 4LK9A 4S3OC 4TKPB 3SOUA
chains in the Genus database with same CATH topology
4P5OB 4F52B 2VJEA 4L7XA 4YATA 2VJFB 3ZTGA 2MD7B 4AP4A 2NAAA 2XB1A 2L5UA 2YHNA 2UZGA 2VNFA 2CKLA 2IDAA 3M63A 2MT5A 2JMIA 1Z2QA 4GNDA 4MSXA 3VK6A 2QIZA 3MHSA 5DKAA 2YU4A 2VPBA 4CCGX 5C11A 1WILA 3SOXA 1LDKC 1HYIA 3IHPA 1X4IA 2YSMA 2C2LA 2LXPC 5G05B 2H0DA 4GNEA 5D1LB 1X4UA 2MA6A 2LN0A 2CSYA 2OXQC 3N9MA 1Z6UA 2CKLB 2Y43A 4O64A 2QICA 3KQIA 3C6WA 1MM2A 2HDPA 4UP0A 3DQVR 4YADA 2M6MA 4B7YC 3U5NA 2JRJA 2YHOA 5TDRA 1VFYA 2H0DB 3L1ZB 4V3KC 3L1XA 4ZDTA 2MIQA 4MVTA 4YBSA 4WZ0A 2KIZA 2KGIA 2Y1MA 2ECTA 5B78A 4WA6A 2I50A 4QF2A 3HCSA 3FL2A 4FJCA 2ECGA 5H1UA 3HTKC 4IC3A 5KH9A 4AVXA 1VYXA 3V43A 4WZ3B 2E6RA 3RPGC 3M99A 1V87A 2KGGA 1F62A 2M3HA 5I3LA 2XEUA 4FIPA 2FSAA 3KNVA 3MHHA 2KU3A 3L11A 2YQLA 2YT5A 2K4DA 2LGLA 1WEMA 4AYCA 3U5PA 2AN6A 2K17A 2KWJA 2JMDA 5FB0A 1U6GB 2MNZA 1X4JA 1FBVA 3N9NA 5G04B 1N87A 5C13A 2VJEB 2F42A 2JMJA 2YREA 1HYJA 3LRQA 2VPEA 4GNFA 2LV9A 2YW8A 3ZVYA 2M85A 5H1TA 2FUUA 1WEPA 4AYCB 1WESA 2L43A 4L58A 3ASLA 4LLBA 2F6JA 5D1KB 4ZQLA 3HCUA 4R7EA 4CA1A 1WEOA 1BORA 4IC2A 4AUQB 3PUQA 2KWKA 5FEYA 2ECNA 4ZUXU 2C2VS 1WFKA 5JG6A 2LGKA 3KV6A 5B75A 2KR4A 2KWOA 5D1MB 4GB0A 3T7LA 3O70A 5LKUA 2KWNA 1WGMA 4YABA 3O33A 2VPGA 3U5MA 4LJNA 3O34A 4A4BA 2L0BA 4R2YA 1G25A 2HYED 2G6QA 3N9LA 4S3OB 2LGGA 2MUMA 2RI7A 3ZYQA 5FB1A 3LQHA 3PHDA 1RMDA 3RTRB 1DVPA 2G45A 5KH7A 2FUIA 1WIMA 1FP0A 2VJFA 1JM7A 3O35A 2LQ6A 4A4CA 4C9ZA 1WENA 2L80A 4X3GA 3N9PA 1WEVA 5H1VA 3ZPVE 2QJ0A 5B79A 2YSJA 2ECVA 4LKAA 5LKXA 3KV5A 2BAYA 2KE1A 3DPLR 2CT2A 3HCTA 1WEWA 2YURA 5TABA 4YBMA 1JM7B 4PPEA 2ECJA 5J3XA 3NG2A 1LDJB 1JOCA 4NN2A 3O37A 5AITA 5B8DA 1CHCA 3EB5A 3T6RA 3ZPV1 3O7AA 2Y1NA 3QZVA 3PURA 5H9MA 1IYMA 4V3LC 3SOWA 1Z60A 3C5KA 3LQIA 4N3WA 2MD8C 4YAXA 2LXHC 2MA5A 1WEQA 1E4UA 4PTBA 2F6NA 2YUCA 4I7CA 2M1RA 3N9QA 2G43A 4XI1A 4BHWA 5AIUA 5LCWB 1ZBDB 2EODA 1WEEA 3GL6A 2KREA 5KH3A 4I7DA 2PNXA 1WEUA 3SHBA 2ECWA 2CSZA 4WZ2A 5B77A 2LGVA 5DINA 3ZVZB 1XWHA 2RSDA 2DX8A 3GV4A 5TBNA 5LKTA 4LADB 5EYAF 2KYUA 2L75A 1K2FA 5FERA 3LQJA 1T1HA 3EB6A 2K1JA 2YQMA 5B76A 4QF3A 4UP5A 2EGPA 1MM3A 3RPGB 4R8PK 4BBQA 4I7BA 2E6SA 4W4UA 2MNYA 2ZETC 4YBTA 3N9OA 2K16A 4A49A 4N4FA 1VD4A 2VPDA 4FK5A 2D8SA 2PUYA 4UI9B 2LDRA 5TRBA 4Q6FA 5LKZA 3I2DA 2ECIA 4A0CD 1WE9A 2LRIC 4FO9A 5G0FA 3U5OA 3O36A 3ZNIA 4GNGA 2YYRA 2VP7A 4B86C 3M62A 4YC9A 5TDWA 2EA6A 2KFTA 4LK9A 4S3OC 4TKPB 3SOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O B;  4F52 B;  2VJE A;  4L7X A;  4YAT A;  2VJF B;  3ZTG A;  2MD7 B;  4AP4 A;  2NAA A;  2XB1 A;  2L5U A;  2YHN A;  2UZG A;  2VNF A;  2CKL A;  2IDA A;  3M63 A;  2MT5 A;  2JMI A;  1Z2Q A;  4GND A;  4MSX A;  3VK6 A;  2QIZ A;  3MHS A;  5DKA A;  2YU4 A;  2VPB A;  4CCG X;  5C11 A;  1WIL A;  3SOX A;  1LDK C;  1HYI A;  3IHP A;  1X4I A;  2YSM A;  2C2L A;  2LXP C;  5G05 B;  2H0D A;  4GNE A;  5D1L B;  1X4U A;  2MA6 A;  2LN0 A;  2CSY A;  2OXQ C;  3N9M A;  1Z6U A;  2CKL B;  2Y43 A;  4O64 A;  2QIC A;  3KQI A;  3C6W A;  1MM2 A;  2HDP A;  4UP0 A;  3DQV R;  4YAD A;  2M6M A;  4B7Y C;  3U5N A;  2JRJ A;  2YHO A;  5TDR A;  1VFY A;  2H0D B;  3L1Z B;  4V3K C;  3L1X A;  4ZDT A;  2MIQ A;  4MVT A;  4YBS A;  4WZ0 A;  2KIZ A;  2KGI A;  2Y1M A;  2ECT A;  5B78 A;  4WA6 A;  2I50 A;  4QF2 A;  3HCS A;  3FL2 A;  4FJC A;  2ECG A;  5H1U A;  3HTK C;  4IC3 A;  5KH9 A;  4AVX A;  1VYX A;  3V43 A;  4WZ3 B;  2E6R A;  3RPG C;  3M99 A;  1V87 A;  2KGG A;  1F62 A;  2M3H A;  5I3L A;  2XEU A;  4FIP A;  2FSA A;  3KNV A;  3MHH A;  2KU3 A;  3L11 A;  2YQL A;  2YT5 A;  2K4D A;  2LGL A;  1WEM A;  4AYC A;  3U5P A;  2AN6 A;  2K17 A;  2KWJ A;  2JMD A;  5FB0 A;  1U6G B;  2MNZ A;  1X4J A;  1FBV A;  3N9N A;  5G04 B;  1N87 A;  5C13 A;  2VJE B;  2F42 A;  2JMJ A;  2YRE A;  1HYJ A;  3LRQ A;  2VPE A;  4GNF A;  2LV9 A;  2YW8 A;  3ZVY A;  2M85 A;  5H1T A;  2FUU A;  1WEP A;  4AYC B;  1WES A;  2L43 A;  4L58 A;  3ASL A;  4LLB A;  2F6J A;  5D1K B;  4ZQL A;  3HCU A;  4R7E A;  4CA1 A;  1WEO A;  1BOR A;  4IC2 A;  4AUQ B;  3PUQ A;  2KWK A;  5FEY A;  2ECN A;  4ZUX U;  2C2V S;  1WFK A;  5JG6 A;  2LGK A;  3KV6 A;  5B75 A;  2KR4 A;  2KWO A;  5D1M B;  4GB0 A;  3T7L A;  3O70 A;  5LKU A;  2KWN A;  1WGM A;  4YAB A;  3O33 A;  2VPG A;  3U5M A;  4LJN A;  3O34 A;  4A4B A;  2L0B A;  4R2Y A;  1G25 A;  2HYE D;  2G6Q A;  3N9L A;  4S3O B;  2LGG A;  2MUM A;  2RI7 A;  3ZYQ A;  5FB1 A;  3LQH A;  3PHD A;  1RMD A;  3RTR B;  1DVP A;  2G45 A;  5KH7 A;  2FUI A;  1WIM A;  1FP0 A;  2VJF A;  1JM7 A;  3O35 A;  2LQ6 A;  4A4C A;  4C9Z A;  1WEN A;  2L80 A;  4X3G A;  3N9P A;  1WEV A;  5H1V A;  3ZPV E;  2QJ0 A;  5B79 A;  2YSJ A;  2ECV A;  4LKA A;  5LKX A;  3KV5 A;  2BAY A;  2KE1 A;  3DPL R;  2CT2 A;  3HCT A;  1WEW A;  2YUR A;  5TAB A;  4YBM A;  1JM7 B;  4PPE A;  2ECJ A;  5J3X A;  3NG2 A;  1LDJ B;  1JOC A;  4NN2 A;  3O37 A;  5AIT A;  5B8D A;  1CHC A;  3EB5 A;  3T6R A;  3ZPV 1;  3O7A A;  2Y1N A;  3QZV A;  3PUR A;  5H9M A;  1IYM A;  4V3L C;  3SOW A;  1Z60 A;  3C5K A;  3LQI A;  4N3W A;  2MD8 C;  4YAX A;  2LXH C;  2MA5 A;  1WEQ A;  1E4U A;  4PTB A;  2F6N A;  2YUC A;  4I7C A;  2M1R A;  3N9Q A;  2G43 A;  4XI1 A;  4BHW A;  5AIU A;  5LCW B;  1ZBD B;  2EOD A;  1WEE A;  3GL6 A;  2KRE A;  5KH3 A;  4I7D A;  2PNX A;  1WEU A;  3SHB A;  2ECW A;  2CSZ A;  4WZ2 A;  5B77 A;  2LGV A;  5DIN A;  3ZVZ B;  1XWH A;  2RSD A;  2DX8 A;  3GV4 A;  5TBN A;  5LKT A;  4LAD B;  5EYA F;  2KYU A;  2L75 A;  1K2F A;  5FER A;  3LQJ A;  1T1H A;  3EB6 A;  2K1J A;  2YQM A;  5B76 A;  4QF3 A;  4UP5 A;  2EGP A;  1MM3 A;  3RPG B;  4R8P K;  4BBQ A;  4I7B A;  2E6S A;  4W4U A;  2MNY A;  2ZET C;  4YBT A;  3N9O A;  2K16 A;  4A49 A;  4N4F A;  1VD4 A;  2VPD A;  4FK5 A;  2D8S A;  2PUY A;  4UI9 B;  2LDR A;  5TRB A;  4Q6F A;  5LKZ A;  3I2D A;  2ECI A;  4A0C D;  1WE9 A;  2LRI C;  4FO9 A;  5G0F A;  3U5O A;  3O36 A;  3ZNI A;  4GNG A;  2YYR A;  2VP7 A;  4B86 C;  3M62 A;  4YC9 A;  5TDW A;  2EA6 A;  2KFT A;  4LK9 A;  4S3O C;  4TKP B;  3SOU A; 
#chains in the Genus database with same CATH topology
 4P5O B;  4F52 B;  2VJE A;  4L7X A;  4YAT A;  2VJF B;  3ZTG A;  2MD7 B;  2CON A;  4AP4 A;  2NAA A;  2XB1 A;  3SUB A;  5SVI A;  2L5U A;  4OGC A;  2YHN A;  2UZG A;  2VNF A;  2CKL A;  2IDA A;  3M63 A;  2MT5 A;  2JMI A;  1Z2Q A;  4GND A;  4MSX A;  3VK6 A;  2QIZ A;  3MHS A;  5DKA A;  2YU4 A;  2VPB A;  4CCG X;  5C11 A;  1DCQ A;  1WIL A;  2DSM A;  2JM3 A;  2RR4 A;  3SOX A;  1LDK C;  1HYI A;  3IHP A;  1X4I A;  2YSM A;  2C2L A;  5SVY A;  2OWA A;  2LXP C;  5G05 B;  2H0D A;  4GNE A;  5D1L B;  2MKE A;  1X4U A;  2MA6 A;  2LN0 A;  5SVI B;  2CSY A;  2OXQ C;  3N9M A;  1Z6U A;  3O47 A;  2CKL B;  2Y43 A;  2EGM A;  4O64 A;  2QIC A;  3KQI A;  3C6W A;  1MM2 A;  2HDP A;  3JUE A;  4UP0 A;  3DQV R;  4YAD A;  2M6M A;  4B7Y C;  3U5N A;  2JRJ A;  2YHO A;  5TDR A;  2FFW A;  1VFY A;  2H0D B;  3L1Z B;  4V3K C;  2IQJ A;  3L1X A;  4ZDT A;  2MIQ A;  4MVT A;  4YBS A;  4WZ0 A;  2KIZ A;  3DWD A;  2E61 A;  2KGI A;  2Y1M A;  2ECT A;  4Z0R A;  5B78 A;  4WA6 A;  2I50 A;  4QF2 A;  4H9D A;  3HCS A;  3FL2 A;  3FEH A;  4FJC A;  2ECG A;  5H1U A;  3HTK C;  2B0O E;  4IC3 A;  5KH9 A;  4AVX A;  1VYX A;  3V43 A;  4WZ3 B;  2E6R A;  3RPG C;  4F1P A;  3M99 A;  1V87 A;  2KGG A;  1F62 A;  2M3H A;  5I3L A;  2XEU A;  4FIP A;  2FSA A;  2L7P A;  3H7H A;  3KNV A;  3FAO A;  3MHH A;  2LAU A;  2KU3 A;  3L11 A;  2YQL A;  2YT5 A;  2K4D A;  2LGL A;  1WEM A;  4Z0O A;  4AYC A;  3U5P A;  2KKX A;  2AN6 A;  2K17 A;  2KWJ A;  2XOC A;  2JMD A;  5FB0 A;  3E2D A;  1U6G B;  2MNZ A;  1X4J A;  2P57 A;  4QQ4 A;  1FBV A;  3N9N A;  3LJU X;  5G04 B;  1N87 A;  5C13 A;  2VJE B;  3LDY A;  2F42 A;  2JMJ A;  2YRE A;  1HYJ A;  3LRQ A;  2VPE A;  4GNF A;  2LV9 A;  2YW8 A;  3ZVY A;  2M85 A;  5H1T A;  2FUU A;  1WEP A;  3LVQ E;  4AYC B;  2M13 A;  1WES A;  2L43 A;  4L58 A;  3ASL A;  4LLB A;  3LVR E;  2F6J A;  4O62 A;  5D1K B;  4ZQL A;  3HCU A;  4R7E A;  4CA1 A;  1WEO A;  1BOR A;  4IC2 A;  4AUQ B;  3PUQ A;  2CSV A;  2KWK A;  5FEY A;  2ECN A;  4ZUX U;  2C2V S;  1WFK A;  5JG6 A;  2LGK A;  3KV6 A;  4OGE A;  5B75 A;  5K3Q A;  2KR4 A;  2KWO A;  5D1M B;  3MDB C;  4GB0 A;  3T7L A;  3O70 A;  5LKU A;  2KWN A;  1WGM A;  2YVR A;  4YAB A;  3O33 A;  2VPG A;  3U5M A;  4LJN A;  3O34 A;  4A4B A;  2L0B A;  4R2Y A;  1G25 A;  2HYE D;  3M7K A;  2XP0 A;  2G6Q A;  3N9L A;  4S3O B;  5SVX A;  2LGG A;  2MUM A;  2RI7 A;  3FM8 C;  3ZYQ A;  5FB1 A;  3LQH A;  3PHD A;  1RMD A;  3RTR B;  1DVP A;  2G45 A;  5KH7 A;  2FUI A;  1WIM A;  1FP0 A;  2VJF A;  1JM7 A;  3O35 A;  3FJU B;  2LQ6 A;  4A4C A;  4C9Z A;  1WEN A;  2L80 A;  4X3G A;  3N9P A;  1WEV A;  5H1V A;  3ZPV E;  2QJ0 A;  5B79 A;  2YSJ A;  2ECV A;  3Q1D A;  4LKA A;  5LKX A;  3KV5 A;  2BAY A;  1MBM A;  2XOZ A;  2KE1 A;  2FD4 A;  3DPL R;  2CT2 A;  3HCT A;  1WEW A;  2YUR A;  5TAB A;  4YBM A;  1JM7 B;  4PPE A;  2ECJ A;  5J3X A;  3NG2 A;  1LDJ B;  1JOC A;  4NN2 A;  3O37 A;  5AIT A;  5B8D A;  1CHC A;  3EB5 A;  3T6R A;  3ZPV 1;  3O7A A;  2Y1N A;  3QZV A;  3PUR A;  5H9M A;  1IYM A;  2DJA A;  4V3L C;  3KDE C;  3SOW A;  3DDT A;  1Z60 A;  3C5K A;  3LQI A;  4N3W A;  2MD8 C;  4YAX A;  2LXH C;  2XOY A;  2MA5 A;  1WEQ A;  1E4U A;  4PTB A;  2F6N A;  2YUC A;  4I7C A;  2M1R A;  3N9Q A;  2G43 A;  4XI1 A;  4BHW A;  5AIU A;  5LCW B;  1ZBD B;  2D8U A;  2EOD A;  1WEE A;  3GL6 A;  2KRE A;  5KH3 A;  4I7D A;  2PNX A;  1WEU A;  3SHB A;  2ECW A;  2CSZ A;  4WZ2 A;  5B77 A;  2LGV A;  5DIN A;  3ZVZ B;  1XWH A;  2RSD A;  2DX8 A;  3GV4 A;  5TBN A;  5LKT A;  4LAD B;  5EYA F;  2KYU A;  2L75 A;  1K2F A;  5FER A;  3PLW A;  3LQJ A;  1T1H A;  3EB6 A;  2KKY A;  2K1J A;  2YQM A;  2JUN A;  5B76 A;  4QF3 A;  4UP5 A;  2EGP A;  1MM3 A;  3RPG B;  3FAN A;  4R8P K;  4BBQ A;  4I7B A;  2E6S A;  4W4U A;  2MNY A;  2ZET C;  4YBT A;  3N9O A;  2K16 A;  4A49 A;  2CRW A;  1VD4 A;  4N4F A;  3T9K A;  2VPD A;  4FK5 A;  2D8S A;  2EXU A;  2PUY A;  4UI9 B;  2LDR A;  5TRB A;  4Q6F A;  5LKZ A;  3I2D A;  2ECI A;  4A0C D;  1WE9 A;  2CRR A;  2LRI C;  4FO9 A;  5G0F A;  3U5O A;  3O36 A;  3ZNI A;  4GNG A;  2YYR A;  2VP7 A;  4B86 C;  3M62 A;  4YC9 A;  5TDW A;  2EA6 A;  2KFT A;  4LK9 A;  4S3O C;  4TKP B;  3SOU A; 
#chains in the Genus database with same CATH homology
 4P5O B;  4F52 B;  2VJE A;  4L7X A;  4YAT A;  2VJF B;  3ZTG A;  2MD7 B;  4AP4 A;  2NAA A;  2XB1 A;  2L5U A;  2YHN A;  2UZG A;  2VNF A;  2CKL A;  2IDA A;  3M63 A;  2MT5 A;  2JMI A;  1Z2Q A;  4GND A;  4MSX A;  3VK6 A;  2QIZ A;  3MHS A;  5DKA A;  2YU4 A;  2VPB A;  4CCG X;  5C11 A;  1WIL A;  3SOX A;  1LDK C;  1HYI A;  3IHP A;  1X4I A;  2YSM A;  2C2L A;  2LXP C;  5G05 B;  2H0D A;  4GNE A;  5D1L B;  1X4U A;  2MA6 A;  2LN0 A;  2CSY A;  2OXQ C;  3N9M A;  1Z6U A;  2CKL B;  2Y43 A;  4O64 A;  2QIC A;  3KQI A;  3C6W A;  1MM2 A;  2HDP A;  4UP0 A;  3DQV R;  4YAD A;  2M6M A;  4B7Y C;  3U5N A;  2JRJ A;  2YHO A;  5TDR A;  1VFY A;  2H0D B;  3L1Z B;  4V3K C;  3L1X A;  4ZDT A;  2MIQ A;  4MVT A;  4YBS A;  4WZ0 A;  2KIZ A;  2KGI A;  2Y1M A;  2ECT A;  5B78 A;  4WA6 A;  2I50 A;  4QF2 A;  3HCS A;  3FL2 A;  4FJC A;  2ECG A;  5H1U A;  3HTK C;  4IC3 A;  5KH9 A;  4AVX A;  1VYX A;  3V43 A;  4WZ3 B;  2E6R A;  3RPG C;  3M99 A;  1V87 A;  2KGG A;  1F62 A;  2M3H A;  5I3L A;  2XEU A;  4FIP A;  2FSA A;  3KNV A;  3MHH A;  2KU3 A;  3L11 A;  2YQL A;  2YT5 A;  2K4D A;  2LGL A;  1WEM A;  4AYC A;  3U5P A;  2AN6 A;  2K17 A;  2KWJ A;  2JMD A;  5FB0 A;  1U6G B;  2MNZ A;  1X4J A;  1FBV A;  3N9N A;  5G04 B;  1N87 A;  5C13 A;  2VJE B;  2F42 A;  2JMJ A;  2YRE A;  1HYJ A;  3LRQ A;  2VPE A;  4GNF A;  2LV9 A;  2YW8 A;  3ZVY A;  2M85 A;  5H1T A;  2FUU A;  1WEP A;  4AYC B;  1WES A;  2L43 A;  4L58 A;  3ASL A;  4LLB A;  2F6J A;  5D1K B;  4ZQL A;  3HCU A;  4R7E A;  4CA1 A;  1WEO A;  1BOR A;  4IC2 A;  4AUQ B;  3PUQ A;  2KWK A;  5FEY A;  2ECN A;  4ZUX U;  2C2V S;  1WFK A;  5JG6 A;  2LGK A;  3KV6 A;  5B75 A;  2KR4 A;  2KWO A;  5D1M B;  4GB0 A;  3T7L A;  3O70 A;  5LKU A;  2KWN A;  1WGM A;  4YAB A;  3O33 A;  2VPG A;  3U5M A;  4LJN A;  3O34 A;  4A4B A;  2L0B A;  4R2Y A;  1G25 A;  2HYE D;  2G6Q A;  3N9L A;  4S3O B;  2LGG A;  2MUM A;  2RI7 A;  3ZYQ A;  5FB1 A;  3LQH A;  3PHD A;  1RMD A;  3RTR B;  1DVP A;  2G45 A;  5KH7 A;  2FUI A;  1WIM A;  1FP0 A;  2VJF A;  1JM7 A;  3O35 A;  2LQ6 A;  4A4C A;  4C9Z A;  1WEN A;  2L80 A;  4X3G A;  3N9P A;  1WEV A;  5H1V A;  3ZPV E;  2QJ0 A;  5B79 A;  2YSJ A;  2ECV A;  4LKA A;  5LKX A;  3KV5 A;  2BAY A;  2KE1 A;  3DPL R;  2CT2 A;  3HCT A;  1WEW A;  2YUR A;  5TAB A;  4YBM A;  1JM7 B;  4PPE A;  2ECJ A;  5J3X A;  3NG2 A;  1LDJ B;  1JOC A;  4NN2 A;  3O37 A;  5AIT A;  5B8D A;  1CHC A;  3EB5 A;  3T6R A;  3ZPV 1;  3O7A A;  2Y1N A;  3QZV A;  3PUR A;  5H9M A;  1IYM A;  4V3L C;  3SOW A;  1Z60 A;  3C5K A;  3LQI A;  4N3W A;  2MD8 C;  4YAX A;  2LXH C;  2MA5 A;  1WEQ A;  1E4U A;  4PTB A;  2F6N A;  2YUC A;  4I7C A;  2M1R A;  3N9Q A;  2G43 A;  4XI1 A;  4BHW A;  5AIU A;  5LCW B;  1ZBD B;  2EOD A;  1WEE A;  3GL6 A;  2KRE A;  5KH3 A;  4I7D A;  2PNX A;  1WEU A;  3SHB A;  2ECW A;  2CSZ A;  4WZ2 A;  5B77 A;  2LGV A;  5DIN A;  3ZVZ B;  1XWH A;  2RSD A;  2DX8 A;  3GV4 A;  5TBN A;  5LKT A;  4LAD B;  5EYA F;  2KYU A;  2L75 A;  1K2F A;  5FER A;  3LQJ A;  1T1H A;  3EB6 A;  2K1J A;  2YQM A;  5B76 A;  4QF3 A;  4UP5 A;  2EGP A;  1MM3 A;  3RPG B;  4R8P K;  4BBQ A;  4I7B A;  2E6S A;  4W4U A;  2MNY A;  2ZET C;  4YBT A;  3N9O A;  2K16 A;  4A49 A;  4N4F A;  1VD4 A;  2VPD A;  4FK5 A;  2D8S A;  2PUY A;  4UI9 B;  2LDR A;  5TRB A;  4Q6F A;  5LKZ A;  3I2D A;  2ECI A;  4A0C D;  1WE9 A;  2LRI C;  4FO9 A;  5G0F A;  3U5O A;  3O36 A;  3ZNI A;  4GNG A;  2YYR A;  2VP7 A;  4B86 C;  3M62 A;  4YC9 A;  5TDW A;  2EA6 A;  2KFT A;  4LK9 A;  4S3O C;  4TKP B;  3SOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...