1WGMA

Solution structure of the u-box in human ubiquitin conjugation factor e4a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin conjugation factor E4A
publication title Solution structure of the U-box in human ubiquitin conjugation factor E4A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wgmA01
1WEWA 5KH7A 3U5MA 3M62A 4PTBA 1HYJA 1WESA 4AUQB 2KU3A 2FUIA 5TABA 4AVXA 2L0BA 2HYED 4YBTA 4GB0A 1IYMA 3U5PA 2YQMA 4LLBA 2QJ0A 2JMDA 2VJFB 2K17A 4PPEA 2LQ6A 1JM7B 2M3HA 2LDRA 2LGGA 2UZGA 2ECVA 2MA6A 3PURA 5G0FA 3O36A 3ZPVE 1N87A 4YBSA 4AP4A 1VYXA 1Z2QA 1MM2A 2VJEA 5D1KB 1WEPA 4WZ3B 3GV4A 3HCSA 4QF2A 4NN2A 2JMJA 2ECWA 3ZPV1 2LV9A 4R7EA 3LQHA 2DX8A 4FIPA 4S3OC 2BAYA 2VPBA 1WEOA 3RPGB 2F6NA 2EGPA 1WEEA 3ZVYA 4GNEA 1WENA 5H1VA 2VNFA 5TDWA 3HTKC 4LKAA 3LQIA 2F42A 2KYUA 3N9NA 2YQLA 2HDPA 2YU4A 2KREA 1WGMA 4A4BA 3PHDA 4LADB 1CHCA 4BBQA 3M63A 3KV5A 2YSMA 2JRJA 2RI7A 5DKAA 2RSDA 3EB6A 5FEYA 2YT5A 2ECIA 2E6RA 1WFKA 5G05B 5DINA 1X4UA 1U6GB 1WEQA 3SOUA 1WEVA 3MHHA 4FK5A 2KGGA 2FSAA 1FBVA 2Y43A 4MSXA 3O7AA 2MD7B 4O64A 3LQJA 4I7BA 5AITA 2KGIA 4B86C 5KH3A 2VPGA 2LGVA 1ZBDB 2YHNA 4ZUXU 4WA6A 1WEUA 2VJEB 1LDKC 1K2FA 2KWOA 4AYCA 3ZNIA 3SOXA 3O33A 5KH9A 3O35A 2CSZA 3N9MA 1HYIA 1Z60A 4MVTA 3N9PA 3MHSA 3SHBA 3NG2A 2VPEA 2KWJA 4ZQLA 2Y1MA 3EB5A 4I7DA 2PUYA 2VPDA 4YC9A 4CCGX 5H9MA 2YW8A 3L1ZB 2L43A 1DVPA 2I50A 5FERA 2G6QA 4YBMA 4B7YC 2LRIC 4WZ0A 4A4CA 2YUCA 4UI9B 2H0DA 2KWKA 3T6RA 4LJNA 4R2YA 2MIQA 1X4JA 2F6JA 4I7CA 4X3GA 3O70A 5C13A 1V87A 3N9LA 2Y1NA 2C2LA 2E6SA 4V3KC 2G43A 3DQVR 2JMIA 4S3OB 1F62A 2FUUA 3C6WA 4LK9A 4A49A 2VP7A 2VJFA 5LKXA 5LCWB 2XB1A 2M6MA 1WIMA 2ZETC 2LXPC 2LGLA 5EYAF 2D8SA 3KQIA 5LKZA 2ECGA 1VD4A 1X4IA 5B79A 4P5OB 3T7LA 3PUQA 4A0CD 5B78A 2YHOA 4IC2A 2LGKA 3QZVA 3U5OA 4XI1A 3ASLA 4R8PK 2ECTA 3L11A 4N3WA 1Z6UA 2AN6A 2M85A 5B77A 2C2VS 2M1RA 2H0DB 4BHWA 1LDJB 2MNYA 3LRQA 5JG6A 1WILA 2QICA 2XEUA 3SOWA 2CT2A 5FB0A 2MA5A 2NAAA 5H1UA 3I2DA 5J3XA 2ECNA 2KE1A 2QIZA 5B75A 2EA6A 2G45A 1RMDA 4YAXA 2YREA 3N9QA 4L58A 3KNVA 3KV6A 4N4FA 4F52B 2LXHC 5AIUA 3ZVZB 2CKLA 2MD8C 3N9OA 3O37A 2MUMA 2KR4A 2K1JA 2OXQC 1VFYA 2KIZA 5D1MB 4W4UA 2EODA 5TBNA 1G25A 5FB1A 4GNFA 3FL2A 4GNGA 4QF3A 3L1XA 4UP0A 5TDRA 3ZYQA 3M99A 4C9ZA 2L80A 3V43A 4V3LC 2L5UA 4L7XA 4YATA 4FO9A 3C5KA 2KFTA 5I3LA 2MNZA 5H1TA 2YYRA 5G04B 3ZTGA 5TRBA 5LKTA 1WE9A 4ZDTA 1JOCA 3U5NA 5D1LB 1T1HA 3HCUA 4YABA 2CSYA 3RPGC 4GNDA 1JM7A 2YSJA 4Q6FA 2MT5A 3RTRB 2K4DA 3O34A 5B8DA 4AYCB 5LKUA 4WZ2A 2ECJA 1E4UA 2IDAA 1WEMA 2YURA 2LN0A 4IC3A 3HCTA 5C11A 2KWNA 3VK6A 4TKPB 4FJCA 2CKLB 1MM3A 1FP0A 1XWHA 2PNXA 2L75A 3GL6A 1BORA 2K16A 5B76A 3IHPA 3DPLR 4YADA 4UP5A 4CA1A
chains in the Genus database with same CATH superfamily
1WEWA 5KH7A 4H9DA 3U5MA 3M62A 4PTBA 1HYJA 1WESA 4AUQB 2KU3A 2FUIA 5TABA 4AVXA 3LJUX 2L0BA 2HYED 4YBTA 4GB0A 1IYMA 3U5PA 2YQMA 4LLBA 2QJ0A 2JMDA 2VJFB 3E2DA 2M13A 2K17A 4PPEA 2XOYA 2LQ6A 1JM7B 2M3HA 2LDRA 2LGGA 2UZGA 4OGEA 2CSVA 2ECVA 2MA6A 3PURA 5G0FA 4QQ4A 3O36A 3ZPVE 1N87A 2KKXA 4YBSA 4AP4A 1VYXA 1Z2QA 2FD4A 1MM2A 2VJEA 5D1KB 1WEPA 2XOZA 4WZ3B 3GV4A 4Z0RA 3HCSA 4QF2A 4NN2A 1DCQA 2JMJA 3FM8C 2B0OE 3LVRE 2ECWA 3ZPV1 3DWDA 2LV9A 4R7EA 3LQHA 2DX8A 4FIPA 4S3OC 2BAYA 2JUNA 2VPBA 1WEOA 3RPGB 2F6NA 2EGPA 1WEEA 3ZVYA 4GNEA 1WENA 5H1VA 2VNFA 5TDWA 3HTKC 3M7KA 5K3QA 4LKAA 3LQIA 2F42A 2KYUA 3N9NA 2YQLA 2HDPA 2YU4A 2KREA 1WGMA 4A4BA 3PHDA 4LADB 1CHCA 4BBQA 3M63A 2OWAA 2YSMA 2FFWA 3KV5A 2JRJA 2RI7A 5DKAA 2RSDA 3EB6A 5FEYA 2YT5A 2ECIA 2E6RA 1WFKA 5G05B 5DINA 1X4UA 1U6GB 1WEQA 3SOUA 1WEVA 4Z0OA 3MHHA 5SVYA 3O47A 4FK5A 2DSMA 2KGGA 2FSAA 4OGCA 1FBVA 2Y43A 4MSXA 3O7AA 2MD7B 4O64A 3LQJA 4I7BA 5AITA 2KGIA 4B86C 3LVQE 5KH3A 2VPGA 2LGVA 1ZBDB 2YHNA 4ZUXU 4WA6A 1WEUA 2VJEB 1LDKC 1K2FA 3MDBC 2KWOA 4AYCA 3ZNIA 3SOXA 3O33A 5KH9A 3O35A 2CSZA 3N9MA 1HYIA 1Z60A 4MVTA 3N9PA 3MHSA 3SHBA 3NG2A 2VPEA 2KWJA 4ZQLA 2Y1MA 3EB5A 4I7DA 2MKEA 2PUYA 2VPDA 4YC9A 4F1PA 5SVXA 4CCGX 5H9MA 3SUBA 2YVRA 2YW8A 3FJUB 3L1ZB 2L43A 1DVPA 2CONA 2I50A 5FERA 2G6QA 4YBMA 4B7YC 2EGMA 2LRIC 4WZ0A 3JUEA 4A4CA 2YUCA 4UI9B 2H0DA 2KWKA 3T6RA 4LJNA 4R2YA 2MIQA 1X4JA 2P57A 2F6JA 4I7CA 4X3GA 3O70A 5C13A 1V87A 3N9LA 3Q1DA 2Y1NA 2E6SA 2C2LA 4V3KC 2G43A 3DQVR 2JMIA 4S3OB 1F62A 2FUUA 3C6WA 4LK9A 2E61A 4A49A 2VP7A 2VJFA 5LKXA 5LCWB 2XB1A 2M6MA 1WIMA 2ZETC 2LXPC 1MBMA 2LGLA 5EYAF 2D8SA 2LAUA 3KQIA 5LKZA 2ECGA 1VD4A 1X4IA 5B79A 4P5OB 3T7LA 3PUQA 4A0CD 5B78A 2YHOA 4IC2A 2LGKA 3QZVA 3U5OA 3FAOA 4XI1A 3ASLA 4R8PK 2ECTA 3L11A 4N3WA 1Z6UA 2AN6A 2M85A 5B77A 2C2VS 3DDTA 2M1RA 2H0DB 4BHWA 1LDJB 2MNYA 3LRQA 5JG6A 1WILA 2QICA 2XEUA 3SOWA 2CT2A 5FB0A 2MA5A 2NAAA 5H1UA 3I2DA 5J3XA 2ECNA 2XP0A 3KDEC 2KE1A 2QIZA 5B75A 2EA6A 2G45A 1RMDA 4YAXA 2YREA 3N9QA 4L58A 3KNVA 3KV6A 4N4FA 4F52B 2LXHC 5AIUA 2EXUA 3ZVZB 2CKLA 2MD8C 3N9OA 3O37A 2MUMA 2XOCA 2KR4A 2K1JA 2OXQC 1VFYA 2KIZA 5D1MB 4W4UA 2EODA 5SVIA 5TBNA 1G25A 2IQJA 3FEHA 5FB1A 4GNFA 2CRRA 3FL2A 4GNGA 4QF3A 3L1XA 4UP0A 5TDRA 3ZYQA 3M99A 4C9ZA 2L80A 3V43A 4V3LC 2L5UA 4L7XA 2DJAA 4YATA 4FO9A 3C5KA 2KFTA 5I3LA 2JM3A 2MNZA 5H1TA 2YYRA 5G04B 3ZTGA 5TRBA 5LKTA 2L7PA 1WE9A 4ZDTA 1JOCA 3U5NA 5D1LB 1T1HA 3HCUA 4YABA 2CSYA 3RPGC 4GNDA 1JM7A 2YSJA 4Q6FA 2MT5A 3RTRB 2K4DA 3O34A 5B8DA 4AYCB 5LKUA 4WZ2A 3T9KA 2ECJA 1E4UA 2IDAA 1WEMA 2YURA 2D8UA 2LN0A 3LDYA 4IC3A 3HCTA 3PLWA 5C11A 2KWNA 3VK6A 4TKPB 2CRWA 4FJCA 2CKLB 1MM3A 1FP0A 1XWHA 4O62A 2PNXA 2L75A 3FANA 3GL6A 1BORA 2K16A 3H7HA 5B76A 3IHPA 2RR4A 5SVIB 3DPLR 4YADA 4UP5A 2KKYA 4CA1A
chains in the Genus database with same CATH topology
1WEWA 5KH7A 3U5MA 3M62A 4PTBA 1HYJA 1WESA 4AUQB 2KU3A 2FUIA 5TABA 4AVXA 2L0BA 2HYED 4YBTA 4GB0A 1IYMA 3U5PA 2YQMA 4LLBA 2QJ0A 2JMDA 2VJFB 2K17A 4PPEA 2LQ6A 1JM7B 2M3HA 2LDRA 2LGGA 2UZGA 2ECVA 2MA6A 3PURA 5G0FA 3O36A 3ZPVE 1N87A 4YBSA 4AP4A 1VYXA 1Z2QA 1MM2A 2VJEA 5D1KB 1WEPA 4WZ3B 3GV4A 3HCSA 4QF2A 4NN2A 2JMJA 2ECWA 3ZPV1 2LV9A 4R7EA 3LQHA 2DX8A 4FIPA 4S3OC 2BAYA 2VPBA 1WEOA 3RPGB 2F6NA 2EGPA 1WEEA 3ZVYA 4GNEA 1WENA 5H1VA 2VNFA 5TDWA 3HTKC 4LKAA 3LQIA 2F42A 2KYUA 3N9NA 2YQLA 2HDPA 2YU4A 2KREA 1WGMA 4A4BA 3PHDA 4LADB 1CHCA 4BBQA 3M63A 3KV5A 2YSMA 2JRJA 2RI7A 5DKAA 2RSDA 3EB6A 5FEYA 2YT5A 2ECIA 2E6RA 1WFKA 5G05B 5DINA 1X4UA 1U6GB 1WEQA 3SOUA 1WEVA 3MHHA 4FK5A 2KGGA 2FSAA 1FBVA 2Y43A 4MSXA 3O7AA 2MD7B 4O64A 3LQJA 4I7BA 5AITA 2KGIA 4B86C 5KH3A 2VPGA 2LGVA 1ZBDB 2YHNA 4ZUXU 4WA6A 1WEUA 2VJEB 1LDKC 1K2FA 2KWOA 4AYCA 3ZNIA 3SOXA 3O33A 5KH9A 3O35A 2CSZA 3N9MA 1HYIA 1Z60A 4MVTA 3N9PA 3MHSA 3SHBA 3NG2A 2VPEA 2KWJA 4ZQLA 2Y1MA 3EB5A 4I7DA 2PUYA 2VPDA 4YC9A 4CCGX 5H9MA 2YW8A 3L1ZB 2L43A 1DVPA 2I50A 5FERA 2G6QA 4YBMA 4B7YC 2LRIC 4WZ0A 4A4CA 2YUCA 4UI9B 2H0DA 2KWKA 3T6RA 4LJNA 4R2YA 2MIQA 1X4JA 2F6JA 4I7CA 4X3GA 3O70A 5C13A 1V87A 3N9LA 2Y1NA 2C2LA 2E6SA 4V3KC 2G43A 3DQVR 2JMIA 4S3OB 1F62A 2FUUA 3C6WA 4LK9A 4A49A 2VP7A 2VJFA 5LKXA 5LCWB 2XB1A 2M6MA 1WIMA 2ZETC 2LXPC 2LGLA 5EYAF 2D8SA 3KQIA 5LKZA 2ECGA 1VD4A 1X4IA 5B79A 4P5OB 3T7LA 3PUQA 4A0CD 5B78A 2YHOA 4IC2A 2LGKA 3QZVA 3U5OA 4XI1A 3ASLA 4R8PK 2ECTA 3L11A 4N3WA 1Z6UA 2AN6A 2M85A 5B77A 2C2VS 2M1RA 2H0DB 4BHWA 1LDJB 2MNYA 3LRQA 5JG6A 1WILA 2QICA 2XEUA 3SOWA 2CT2A 5FB0A 2MA5A 2NAAA 5H1UA 3I2DA 5J3XA 2ECNA 2KE1A 2QIZA 5B75A 2EA6A 2G45A 1RMDA 4YAXA 2YREA 3N9QA 4L58A 3KNVA 3KV6A 4N4FA 4F52B 2LXHC 5AIUA 3ZVZB 2CKLA 2MD8C 3N9OA 3O37A 2MUMA 2KR4A 2K1JA 2OXQC 1VFYA 2KIZA 5D1MB 4W4UA 2EODA 5TBNA 1G25A 5FB1A 4GNFA 3FL2A 4GNGA 4QF3A 3L1XA 4UP0A 5TDRA 3ZYQA 3M99A 4C9ZA 2L80A 3V43A 4V3LC 2L5UA 4L7XA 4YATA 4FO9A 3C5KA 2KFTA 5I3LA 2MNZA 5H1TA 2YYRA 5G04B 3ZTGA 5TRBA 5LKTA 1WE9A 4ZDTA 1JOCA 3U5NA 5D1LB 1T1HA 3HCUA 4YABA 2CSYA 3RPGC 4GNDA 1JM7A 2YSJA 4Q6FA 2MT5A 3RTRB 2K4DA 3O34A 5B8DA 4AYCB 5LKUA 4WZ2A 2ECJA 1E4UA 2IDAA 1WEMA 2YURA 2LN0A 4IC3A 3HCTA 5C11A 2KWNA 3VK6A 4TKPB 4FJCA 2CKLB 1MM3A 1FP0A 1XWHA 2PNXA 2L75A 3GL6A 1BORA 2K16A 5B76A 3IHPA 3DPLR 4YADA 4UP5A 4CA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEW A;  5KH7 A;  3U5M A;  3M62 A;  4PTB A;  1HYJ A;  1WES A;  4AUQ B;  2KU3 A;  2FUI A;  5TAB A;  4AVX A;  2L0B A;  2HYE D;  4YBT A;  4GB0 A;  1IYM A;  3U5P A;  2YQM A;  4LLB A;  2QJ0 A;  2JMD A;  2VJF B;  2K17 A;  4PPE A;  2LQ6 A;  1JM7 B;  2M3H A;  2LDR A;  2LGG A;  2UZG A;  2ECV A;  2MA6 A;  3PUR A;  5G0F A;  3O36 A;  3ZPV E;  1N87 A;  4YBS A;  4AP4 A;  1VYX A;  1Z2Q A;  1MM2 A;  2VJE A;  5D1K B;  1WEP A;  4WZ3 B;  3GV4 A;  3HCS A;  4QF2 A;  4NN2 A;  2JMJ A;  2ECW A;  3ZPV 1;  2LV9 A;  4R7E A;  3LQH A;  2DX8 A;  4FIP A;  4S3O C;  2BAY A;  2VPB A;  1WEO A;  3RPG B;  2F6N A;  2EGP A;  1WEE A;  3ZVY A;  4GNE A;  1WEN A;  5H1V A;  2VNF A;  5TDW A;  3HTK C;  4LKA A;  3LQI A;  2F42 A;  2KYU A;  3N9N A;  2YQL A;  2HDP A;  2YU4 A;  2KRE A;  1WGM A;  4A4B A;  3PHD A;  4LAD B;  1CHC A;  4BBQ A;  3M63 A;  3KV5 A;  2YSM A;  2JRJ A;  2RI7 A;  5DKA A;  2RSD A;  3EB6 A;  5FEY A;  2YT5 A;  2ECI A;  2E6R A;  1WFK A;  5G05 B;  5DIN A;  1X4U A;  1U6G B;  1WEQ A;  3SOU A;  1WEV A;  3MHH A;  4FK5 A;  2KGG A;  2FSA A;  1FBV A;  2Y43 A;  4MSX A;  3O7A A;  2MD7 B;  4O64 A;  3LQJ A;  4I7B A;  5AIT A;  2KGI A;  4B86 C;  5KH3 A;  2VPG A;  2LGV A;  1ZBD B;  2YHN A;  4ZUX U;  4WA6 A;  1WEU A;  2VJE B;  1LDK C;  1K2F A;  2KWO A;  4AYC A;  3ZNI A;  3SOX A;  3O33 A;  5KH9 A;  3O35 A;  2CSZ A;  3N9M A;  1HYI A;  1Z60 A;  4MVT A;  3N9P A;  3MHS A;  3SHB A;  3NG2 A;  2VPE A;  2KWJ A;  4ZQL A;  2Y1M A;  3EB5 A;  4I7D A;  2PUY A;  2VPD A;  4YC9 A;  4CCG X;  5H9M A;  2YW8 A;  3L1Z B;  2L43 A;  1DVP A;  2I50 A;  5FER A;  2G6Q A;  4YBM A;  4B7Y C;  2LRI C;  4WZ0 A;  4A4C A;  2YUC A;  4UI9 B;  2H0D A;  2KWK A;  3T6R A;  4LJN A;  4R2Y A;  2MIQ A;  1X4J A;  2F6J A;  4I7C A;  4X3G A;  3O70 A;  5C13 A;  1V87 A;  3N9L A;  2Y1N A;  2C2L A;  2E6S A;  4V3K C;  2G43 A;  3DQV R;  2JMI A;  4S3O B;  1F62 A;  2FUU A;  3C6W A;  4LK9 A;  4A49 A;  2VP7 A;  2VJF A;  5LKX A;  5LCW B;  2XB1 A;  2M6M A;  1WIM A;  2ZET C;  2LXP C;  2LGL A;  5EYA F;  2D8S A;  3KQI A;  5LKZ A;  2ECG A;  1VD4 A;  1X4I A;  5B79 A;  4P5O B;  3T7L A;  3PUQ A;  4A0C D;  5B78 A;  2YHO A;  4IC2 A;  2LGK A;  3QZV A;  3U5O A;  4XI1 A;  3ASL A;  4R8P K;  2ECT A;  3L11 A;  4N3W A;  1Z6U A;  2AN6 A;  2M85 A;  5B77 A;  2C2V S;  2M1R A;  2H0D B;  4BHW A;  1LDJ B;  2MNY A;  3LRQ A;  5JG6 A;  1WIL A;  2QIC A;  2XEU A;  3SOW A;  2CT2 A;  5FB0 A;  2MA5 A;  2NAA A;  5H1U A;  3I2D A;  5J3X A;  2ECN A;  2KE1 A;  2QIZ A;  5B75 A;  2EA6 A;  2G45 A;  1RMD A;  4YAX A;  2YRE A;  3N9Q A;  4L58 A;  3KNV A;  3KV6 A;  4N4F A;  4F52 B;  2LXH C;  5AIU A;  3ZVZ B;  2CKL A;  2MD8 C;  3N9O A;  3O37 A;  2MUM A;  2KR4 A;  2K1J A;  2OXQ C;  1VFY A;  2KIZ A;  5D1M B;  4W4U A;  2EOD A;  5TBN A;  1G25 A;  5FB1 A;  4GNF A;  3FL2 A;  4GNG A;  4QF3 A;  3L1X A;  4UP0 A;  5TDR A;  3ZYQ A;  3M99 A;  4C9Z A;  2L80 A;  3V43 A;  4V3L C;  2L5U A;  4L7X A;  4YAT A;  4FO9 A;  3C5K A;  2KFT A;  5I3L A;  2MNZ A;  5H1T A;  2YYR A;  5G04 B;  3ZTG A;  5TRB A;  5LKT A;  1WE9 A;  4ZDT A;  1JOC A;  3U5N A;  5D1L B;  1T1H A;  3HCU A;  4YAB A;  2CSY A;  3RPG C;  4GND A;  1JM7 A;  2YSJ A;  4Q6F A;  2MT5 A;  3RTR B;  2K4D A;  3O34 A;  5B8D A;  4AYC B;  5LKU A;  4WZ2 A;  2ECJ A;  1E4U A;  2IDA A;  1WEM A;  2YUR A;  2LN0 A;  4IC3 A;  3HCT A;  5C11 A;  2KWN A;  3VK6 A;  4TKP B;  4FJC A;  2CKL B;  1MM3 A;  1FP0 A;  1XWH A;  2PNX A;  2L75 A;  3GL6 A;  1BOR A;  2K16 A;  5B76 A;  3IHP A;  3DPL R;  4YAD A;  4UP5 A;  4CA1 A; 
#chains in the Genus database with same CATH topology
 1WEW A;  5KH7 A;  4H9D A;  3U5M A;  3M62 A;  4PTB A;  1HYJ A;  1WES A;  4AUQ B;  2KU3 A;  2FUI A;  5TAB A;  4AVX A;  3LJU X;  2L0B A;  2HYE D;  4YBT A;  4GB0 A;  1IYM A;  3U5P A;  2YQM A;  4LLB A;  2QJ0 A;  2JMD A;  2VJF B;  3E2D A;  2M13 A;  2K17 A;  4PPE A;  2XOY A;  2LQ6 A;  1JM7 B;  2M3H A;  2LDR A;  2LGG A;  2UZG A;  4OGE A;  2CSV A;  2ECV A;  2MA6 A;  3PUR A;  5G0F A;  4QQ4 A;  3O36 A;  3ZPV E;  1N87 A;  2KKX A;  4YBS A;  4AP4 A;  1VYX A;  1Z2Q A;  2FD4 A;  1MM2 A;  2VJE A;  5D1K B;  1WEP A;  2XOZ A;  4WZ3 B;  3GV4 A;  4Z0R A;  3HCS A;  4QF2 A;  4NN2 A;  1DCQ A;  2JMJ A;  3FM8 C;  2B0O E;  3LVR E;  2ECW A;  3ZPV 1;  3DWD A;  2LV9 A;  4R7E A;  3LQH A;  2DX8 A;  4FIP A;  4S3O C;  2BAY A;  2JUN A;  2VPB A;  1WEO A;  3RPG B;  2F6N A;  2EGP A;  1WEE A;  3ZVY A;  4GNE A;  1WEN A;  5H1V A;  2VNF A;  5TDW A;  3HTK C;  3M7K A;  5K3Q A;  4LKA A;  3LQI A;  2F42 A;  2KYU A;  3N9N A;  2YQL A;  2HDP A;  2YU4 A;  2KRE A;  1WGM A;  4A4B A;  3PHD A;  4LAD B;  1CHC A;  4BBQ A;  3M63 A;  2OWA A;  2YSM A;  2FFW A;  3KV5 A;  2JRJ A;  2RI7 A;  5DKA A;  2RSD A;  3EB6 A;  5FEY A;  2YT5 A;  2ECI A;  2E6R A;  1WFK A;  5G05 B;  5DIN A;  1X4U A;  1U6G B;  1WEQ A;  3SOU A;  1WEV A;  4Z0O A;  3MHH A;  5SVY A;  3O47 A;  4FK5 A;  2DSM A;  2KGG A;  2FSA A;  4OGC A;  1FBV A;  2Y43 A;  4MSX A;  3O7A A;  2MD7 B;  4O64 A;  3LQJ A;  4I7B A;  5AIT A;  2KGI A;  4B86 C;  3LVQ E;  5KH3 A;  2VPG A;  2LGV A;  1ZBD B;  2YHN A;  4ZUX U;  4WA6 A;  1WEU A;  2VJE B;  1LDK C;  1K2F A;  3MDB C;  2KWO A;  4AYC A;  3ZNI A;  3SOX A;  3O33 A;  5KH9 A;  3O35 A;  2CSZ A;  3N9M A;  1HYI A;  1Z60 A;  4MVT A;  3N9P A;  3MHS A;  3SHB A;  3NG2 A;  2VPE A;  2KWJ A;  4ZQL A;  2Y1M A;  3EB5 A;  4I7D A;  2MKE A;  2PUY A;  2VPD A;  4YC9 A;  4F1P A;  5SVX A;  4CCG X;  5H9M A;  3SUB A;  2YVR A;  2YW8 A;  3FJU B;  3L1Z B;  2L43 A;  1DVP A;  2CON A;  2I50 A;  5FER A;  2G6Q A;  4YBM A;  4B7Y C;  2EGM A;  2LRI C;  4WZ0 A;  3JUE A;  4A4C A;  2YUC A;  4UI9 B;  2H0D A;  2KWK A;  3T6R A;  4LJN A;  4R2Y A;  2MIQ A;  1X4J A;  2P57 A;  2F6J A;  4I7C A;  4X3G A;  3O70 A;  5C13 A;  1V87 A;  3N9L A;  3Q1D A;  2Y1N A;  2E6S A;  2C2L A;  4V3K C;  2G43 A;  3DQV R;  2JMI A;  4S3O B;  1F62 A;  2FUU A;  3C6W A;  4LK9 A;  2E61 A;  4A49 A;  2VP7 A;  2VJF A;  5LKX A;  5LCW B;  2XB1 A;  2M6M A;  1WIM A;  2ZET C;  2LXP C;  1MBM A;  2LGL A;  5EYA F;  2D8S A;  2LAU A;  3KQI A;  5LKZ A;  2ECG A;  1VD4 A;  1X4I A;  5B79 A;  4P5O B;  3T7L A;  3PUQ A;  4A0C D;  5B78 A;  2YHO A;  4IC2 A;  2LGK A;  3QZV A;  3U5O A;  3FAO A;  4XI1 A;  3ASL A;  4R8P K;  2ECT A;  3L11 A;  4N3W A;  1Z6U A;  2AN6 A;  2M85 A;  5B77 A;  2C2V S;  3DDT A;  2M1R A;  2H0D B;  4BHW A;  1LDJ B;  2MNY A;  3LRQ A;  5JG6 A;  1WIL A;  2QIC A;  2XEU A;  3SOW A;  2CT2 A;  5FB0 A;  2MA5 A;  2NAA A;  5H1U A;  3I2D A;  5J3X A;  2ECN A;  2XP0 A;  3KDE C;  2KE1 A;  2QIZ A;  5B75 A;  2EA6 A;  2G45 A;  1RMD A;  4YAX A;  2YRE A;  3N9Q A;  4L58 A;  3KNV A;  3KV6 A;  4N4F A;  4F52 B;  2LXH C;  5AIU A;  2EXU A;  3ZVZ B;  2CKL A;  2MD8 C;  3N9O A;  3O37 A;  2MUM A;  2XOC A;  2KR4 A;  2K1J A;  2OXQ C;  1VFY A;  2KIZ A;  5D1M B;  4W4U A;  2EOD A;  5SVI A;  5TBN A;  1G25 A;  2IQJ A;  3FEH A;  5FB1 A;  4GNF A;  2CRR A;  3FL2 A;  4GNG A;  4QF3 A;  3L1X A;  4UP0 A;  5TDR A;  3ZYQ A;  3M99 A;  4C9Z A;  2L80 A;  3V43 A;  4V3L C;  2L5U A;  4L7X A;  2DJA A;  4YAT A;  4FO9 A;  3C5K A;  2KFT A;  5I3L A;  2JM3 A;  2MNZ A;  5H1T A;  2YYR A;  5G04 B;  3ZTG A;  5TRB A;  5LKT A;  2L7P A;  1WE9 A;  4ZDT A;  1JOC A;  3U5N A;  5D1L B;  1T1H A;  3HCU A;  4YAB A;  2CSY A;  3RPG C;  4GND A;  1JM7 A;  2YSJ A;  4Q6F A;  2MT5 A;  3RTR B;  2K4D A;  3O34 A;  5B8D A;  4AYC B;  5LKU A;  4WZ2 A;  3T9K A;  2ECJ A;  1E4U A;  2IDA A;  1WEM A;  2YUR A;  2D8U A;  2LN0 A;  3LDY A;  4IC3 A;  3HCT A;  3PLW A;  5C11 A;  2KWN A;  3VK6 A;  4TKP B;  2CRW A;  4FJC A;  2CKL B;  1MM3 A;  1FP0 A;  1XWH A;  4O62 A;  2PNX A;  2L75 A;  3FAN A;  3GL6 A;  1BOR A;  2K16 A;  3H7H A;  5B76 A;  3IHP A;  2RR4 A;  5SVI B;  3DPL R;  4YAD A;  4UP5 A;  2KKY A;  4CA1 A; 
#chains in the Genus database with same CATH homology
 1WEW A;  5KH7 A;  3U5M A;  3M62 A;  4PTB A;  1HYJ A;  1WES A;  4AUQ B;  2KU3 A;  2FUI A;  5TAB A;  4AVX A;  2L0B A;  2HYE D;  4YBT A;  4GB0 A;  1IYM A;  3U5P A;  2YQM A;  4LLB A;  2QJ0 A;  2JMD A;  2VJF B;  2K17 A;  4PPE A;  2LQ6 A;  1JM7 B;  2M3H A;  2LDR A;  2LGG A;  2UZG A;  2ECV A;  2MA6 A;  3PUR A;  5G0F A;  3O36 A;  3ZPV E;  1N87 A;  4YBS A;  4AP4 A;  1VYX A;  1Z2Q A;  1MM2 A;  2VJE A;  5D1K B;  1WEP A;  4WZ3 B;  3GV4 A;  3HCS A;  4QF2 A;  4NN2 A;  2JMJ A;  2ECW A;  3ZPV 1;  2LV9 A;  4R7E A;  3LQH A;  2DX8 A;  4FIP A;  4S3O C;  2BAY A;  2VPB A;  1WEO A;  3RPG B;  2F6N A;  2EGP A;  1WEE A;  3ZVY A;  4GNE A;  1WEN A;  5H1V A;  2VNF A;  5TDW A;  3HTK C;  4LKA A;  3LQI A;  2F42 A;  2KYU A;  3N9N A;  2YQL A;  2HDP A;  2YU4 A;  2KRE A;  1WGM A;  4A4B A;  3PHD A;  4LAD B;  1CHC A;  4BBQ A;  3M63 A;  3KV5 A;  2YSM A;  2JRJ A;  2RI7 A;  5DKA A;  2RSD A;  3EB6 A;  5FEY A;  2YT5 A;  2ECI A;  2E6R A;  1WFK A;  5G05 B;  5DIN A;  1X4U A;  1U6G B;  1WEQ A;  3SOU A;  1WEV A;  3MHH A;  4FK5 A;  2KGG A;  2FSA A;  1FBV A;  2Y43 A;  4MSX A;  3O7A A;  2MD7 B;  4O64 A;  3LQJ A;  4I7B A;  5AIT A;  2KGI A;  4B86 C;  5KH3 A;  2VPG A;  2LGV A;  1ZBD B;  2YHN A;  4ZUX U;  4WA6 A;  1WEU A;  2VJE B;  1LDK C;  1K2F A;  2KWO A;  4AYC A;  3ZNI A;  3SOX A;  3O33 A;  5KH9 A;  3O35 A;  2CSZ A;  3N9M A;  1HYI A;  1Z60 A;  4MVT A;  3N9P A;  3MHS A;  3SHB A;  3NG2 A;  2VPE A;  2KWJ A;  4ZQL A;  2Y1M A;  3EB5 A;  4I7D A;  2PUY A;  2VPD A;  4YC9 A;  4CCG X;  5H9M A;  2YW8 A;  3L1Z B;  2L43 A;  1DVP A;  2I50 A;  5FER A;  2G6Q A;  4YBM A;  4B7Y C;  2LRI C;  4WZ0 A;  4A4C A;  2YUC A;  4UI9 B;  2H0D A;  2KWK A;  3T6R A;  4LJN A;  4R2Y A;  2MIQ A;  1X4J A;  2F6J A;  4I7C A;  4X3G A;  3O70 A;  5C13 A;  1V87 A;  3N9L A;  2Y1N A;  2C2L A;  2E6S A;  4V3K C;  2G43 A;  3DQV R;  2JMI A;  4S3O B;  1F62 A;  2FUU A;  3C6W A;  4LK9 A;  4A49 A;  2VP7 A;  2VJF A;  5LKX A;  5LCW B;  2XB1 A;  2M6M A;  1WIM A;  2ZET C;  2LXP C;  2LGL A;  5EYA F;  2D8S A;  3KQI A;  5LKZ A;  2ECG A;  1VD4 A;  1X4I A;  5B79 A;  4P5O B;  3T7L A;  3PUQ A;  4A0C D;  5B78 A;  2YHO A;  4IC2 A;  2LGK A;  3QZV A;  3U5O A;  4XI1 A;  3ASL A;  4R8P K;  2ECT A;  3L11 A;  4N3W A;  1Z6U A;  2AN6 A;  2M85 A;  5B77 A;  2C2V S;  2M1R A;  2H0D B;  4BHW A;  1LDJ B;  2MNY A;  3LRQ A;  5JG6 A;  1WIL A;  2QIC A;  2XEU A;  3SOW A;  2CT2 A;  5FB0 A;  2MA5 A;  2NAA A;  5H1U A;  3I2D A;  5J3X A;  2ECN A;  2KE1 A;  2QIZ A;  5B75 A;  2EA6 A;  2G45 A;  1RMD A;  4YAX A;  2YRE A;  3N9Q A;  4L58 A;  3KNV A;  3KV6 A;  4N4F A;  4F52 B;  2LXH C;  5AIU A;  3ZVZ B;  2CKL A;  2MD8 C;  3N9O A;  3O37 A;  2MUM A;  2KR4 A;  2K1J A;  2OXQ C;  1VFY A;  2KIZ A;  5D1M B;  4W4U A;  2EOD A;  5TBN A;  1G25 A;  5FB1 A;  4GNF A;  3FL2 A;  4GNG A;  4QF3 A;  3L1X A;  4UP0 A;  5TDR A;  3ZYQ A;  3M99 A;  4C9Z A;  2L80 A;  3V43 A;  4V3L C;  2L5U A;  4L7X A;  4YAT A;  4FO9 A;  3C5K A;  2KFT A;  5I3L A;  2MNZ A;  5H1T A;  2YYR A;  5G04 B;  3ZTG A;  5TRB A;  5LKT A;  1WE9 A;  4ZDT A;  1JOC A;  3U5N A;  5D1L B;  1T1H A;  3HCU A;  4YAB A;  2CSY A;  3RPG C;  4GND A;  1JM7 A;  2YSJ A;  4Q6F A;  2MT5 A;  3RTR B;  2K4D A;  3O34 A;  5B8D A;  4AYC B;  5LKU A;  4WZ2 A;  2ECJ A;  1E4U A;  2IDA A;  1WEM A;  2YUR A;  2LN0 A;  4IC3 A;  3HCT A;  5C11 A;  2KWN A;  3VK6 A;  4TKP B;  4FJC A;  2CKL B;  1MM3 A;  1FP0 A;  1XWH A;  2PNX A;  2L75 A;  3GL6 A;  1BOR A;  2K16 A;  5B76 A;  3IHP A;  3DPL R;  4YAD A;  4UP5 A;  4CA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...