1WGMA

Solution structure of the u-box in human ubiquitin conjugation factor e4a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the U-box in human ubiquitin conjugation factor E4A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin conjugation factor E4A
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wgmA01
1WESA 4W4UA 3RTRB 4TKPB 2KIZA 2QJ0A 4BHWA 4GNDA 2G6QA 2KWJA 4L7XA 2LV9A 1WEQA 3VK6A 2F6NA 1Z6UA 2LXPC 4NN2A 3MHSA 4LADB 5H9MA 2QIZA 2KFTA 2YSMA 3DQVR 5TDWA 4XI1A 1X4UA 2YUCA 4UI9B 3C6WA 1WE9A 4Q6FA 4UP5A 4CCGX 4AYCA 5C13A 5LKZA 2IDAA 2EODA 3O36A 1LDKC 1Z2QA 5KH7A 3NG2A 3ZVZB 1VD4A 3U5OA 3T6RA 2VPEA 4CA1A 2ECTA 3N9LA 2RSDA 3L11A 3PURA 4YC9A 5G05B 4FO9A 3FL2A 3O70A 1WEOA 3U5MA 4MSXA 4O64A 2YHOA 2MD8C 3ZNIA 1VFYA 2VJEA 1WEWA 5LKXA 2VJFB 2C2VS 4YATA 4P5OB 1WENA 1MM3A 3EB6A 2YW8A 4B7YC 2H0DA 4PTBA 2ECGA 2PNXA 1G25A 4QF3A 2YQMA 3HCUA 2Y1NA 5DINA 1XWHA 1Z60A 2MD7B 1E4UA 2YU4A 2K4DA 2L43A 3ZTGA 4LK9A 3L1XA 3M99A 2VPGA 4S3OB 3I2DA 3T7LA 2MIQA 2ZETC 2LGGA 2G45A 4X3GA 1T1HA 1JM7B 2VPDA 2VPBA 2CSYA 4YAXA 4YBTA 2VJEB 3EB5A 4LKAA 5FERA 3M62A 3U5PA 2G43A 2MA5A 2K1JA 3L1ZB 2KYUA 2HYED 3N9PA 4BBQA 1WEEA 2LGLA 2FUUA 3SOXA 4S3OC 2JMJA 2KR4A 3SOUA 2BAYA 5B79A 3QZVA 4GNEA 1WIMA 4FK5A 1FP0A 5J3XA 5I3LA 5C11A 1WGMA 3ZPVE 4N4FA 1BORA 2UZGA 4YABA 2YHNA 3KV6A 2KE1A 2L80A 2D8SA 3ZVYA 3HTKC 2KWKA 5B77A 4A4BA 2L75A 2LXHC 1HYIA 4AUQB 4R2YA 2YSJA 4UP0A 1WEPA 4A49A 5B76A 2CT2A 2LGKA 2LRIC 3SOWA 4B86C 3O33A 2JRJA 2YT5A 3SHBA 2E6RA 2VNFA 3KQIA 4ZDTA 5D1LB 5B78A 5EYAF 2ECVA 5LKUA 2I50A 4GNGA 3GV4A 2FSAA 3N9QA 5B75A 2KWNA 1FBVA 3N9MA 2YQLA 1U6GB 2MT5A 1JOCA 2KGIA 5H1TA 1WEVA 2L5UA 2E6SA 5TBNA 3ASLA 4QF2A 1IYMA 2F6JA 4WZ3B 4YADA 2LDRA 2CKLA 5H1VA 2CKLB 3N9OA 4WZ2A 1X4JA 3RPGB 2DX8A 4FJCA 3DPLR 4N3WA 4F52B 2ECJA 2YURA 3LRQA 1N87A 4WA6A 3N9NA 5KH3A 2AN6A 2YYRA 2XB1A 4A4CA 3IHPA 3KV5A 1VYXA 2RI7A 3O7AA 2K17A 2FUIA 3O37A 2Y1MA 5FB0A 3U5NA 4LJNA 2H0DB 4V3KC 2VP7A 2VJFA 5FEYA 4LLBA 5DKAA 1K2FA 2K16A 4ZQLA 4R7EA 1WFKA 3C5KA 3M63A 4AVXA 2EGPA 3LQIA 3ZPV1 4A0CD 5LKTA 1MM2A 2LGVA 1V87A 1DVPA 4I7DA 2OXQC 4GB0A 2MNYA 2M85A 4C9ZA 1X4IA 3ZYQA 5G0FA 3GL6A 3LQHA 3MHHA 3HCSA 4GNFA 2F42A 2CSZA 2PUYA 4AYCB 5AITA 4I7BA 3PHDA 4IC2A 2M3HA 2KU3A 1RMDA 4PPEA 3RPGC 5B8DA 2ECWA 2MUMA 2ECNA 4FIPA 4YBMA 5H1UA 1WEMA 2KREA 4AP4A 2KGGA 2LN0A 1WEUA 4V3LC 5TDRA 2YREA 2L0BA 3O34A 2EA6A 5AIUA 4ZUXU 4MVTA 2JMIA 2LQ6A 5LCWB 1JM7A 3HCTA 2JMDA 1HYJA 2XEUA 2HDPA 4IC3A 4R8PK 3O35A 1LDJB 5KH9A 2M1RA 2MNZA 2QICA 2Y43A 2NAAA 2MA6A 4YBSA 3PUQA 3KNVA 1CHCA 2M6MA 5D1KB 1WILA 5D1MB 2ECIA 3V43A 1ZBDB 4WZ0A 5G04B 4I7CA 4L58A 2C2LA 3LQJA 2KWOA 5JG6A 1F62A 5TRBA 5FB1A 5TABA
chains in the Genus database with same CATH superfamily
1WESA 2RR4A 3H7HA 4W4UA 3RTRB 4TKPB 2KIZA 2QJ0A 2KKXA 4BHWA 4GNDA 2G6QA 2KWJA 4L7XA 2LV9A 3DWDA 1WEQA 3VK6A 2F6NA 1Z6UA 2LXPC 4NN2A 3MHSA 4LADB 2DJAA 5H9MA 2QIZA 4Z0RA 2KFTA 2YSMA 2CRWA 3DQVR 5TDWA 2M13A 4XI1A 1X4UA 2YUCA 4UI9B 3C6WA 1WE9A 4Q6FA 4UP5A 4CCGX 4AYCA 5C13A 5SVIA 5LKZA 2IDAA 2EODA 3O36A 1LDKC 2JM3A 1Z2QA 5KH7A 3NG2A 3ZVZB 2CONA 1VD4A 3U5OA 3T6RA 2JUNA 2VPEA 4CA1A 2ECTA 3N9LA 2EGMA 2RSDA 4H9DA 2L7PA 3L11A 3PURA 4YC9A 5G05B 4QQ4A 4FO9A 3FL2A 3O70A 1WEOA 3U5MA 4MSXA 4O64A 2YHOA 2MD8C 1VFYA 2VJEA 3ZNIA 1WEWA 5LKXA 2VJFB 2C2VS 4YATA 4P5OB 2LAUA 1WENA 3O47A 1MM3A 3EB6A 2YW8A 4B7YC 2H0DA 4PTBA 2ECGA 2PNXA 1G25A 4QF3A 2YQMA 3HCUA 4O62A 2YVRA 2Y1NA 5DINA 1XWHA 1Z60A 2MD7B 1E4UA 2YU4A 2K4DA 2L43A 3ZTGA 4LK9A 3L1XA 3M99A 2VPGA 4S3OB 3I2DA 3T9KA 3T7LA 2MIQA 2ZETC 2LGGA 2G45A 4X3GA 1T1HA 1JM7B 4Z0OA 2VPDA 2VPBA 2CSYA 4YAXA 4YBTA 2VJEB 3EB5A 4LKAA 1MBMA 5FERA 3M62A 3U5PA 2G43A 2MA5A 2K1JA 3L1ZB 2KYUA 2HYED 3N9PA 4BBQA 1WEEA 2LGLA 2FUUA 3SOXA 4S3OC 2JMJA 2KR4A 3SOUA 2BAYA 5B79A 3QZVA 4GNEA 4OGEA 1WIMA 4FK5A 1FP0A 2B0OE 5J3XA 5I3LA 5C11A 1WGMA 3ZPVE 4N4FA 1BORA 2UZGA 4YABA 2YHNA 5K3QA 3KV6A 2KE1A 2L80A 2D8SA 3ZVYA 3HTKC 2KWKA 5B77A 4A4BA 2L75A 2LXHC 1HYIA 4AUQB 4R2YA 2YSJA 4UP0A 1WEPA 2OWAA 4A49A 5B76A 2CSVA 2CT2A 2P57A 2LGKA 2LRIC 3SOWA 5SVYA 4B86C 3O33A 2JRJA 2YT5A 3SHBA 2E6RA 2VNFA 3KQIA 4ZDTA 2XOCA 2DSMA 5D1LB 5B78A 2XOZA 5EYAF 2ECVA 5LKUA 2I50A 4GNGA 3GV4A 2FSAA 3LJUX 3N9QA 3KDEC 5B75A 2KWNA 1FBVA 3N9MA 2YQLA 1U6GB 3MDBC 2MT5A 4F1PA 1JOCA 2KGIA 5H1TA 1WEVA 3LDYA 2L5UA 2E6SA 5TBNA 3ASLA 4QF2A 1IYMA 2F6JA 4WZ3B 4YADA 2LDRA 2XOYA 3FANA 2CKLA 5H1VA 2CKLB 3N9OA 4WZ2A 1X4JA 3DDTA 3RPGB 2DX8A 4FJCA 3DPLR 1DCQA 4N3WA 4F52B 2ECJA 2YURA 3LRQA 1N87A 4WA6A 3N9NA 3LVRE 5KH3A 2AN6A 2YYRA 2XB1A 4A4CA 3IHPA 3KV5A 1VYXA 2RI7A 3O7AA 2K17A 2FUIA 3O37A 2Y1MA 5FB0A 3U5NA 4LJNA 2H0DB 4V3KC 2E61A 2VP7A 2VJFA 5FEYA 4LLBA 5DKAA 1K2FA 3Q1DA 2K16A 4ZQLA 4R7EA 1WFKA 2MKEA 3C5KA 3M63A 4AVXA 2EGPA 3LQIA 3ZPV1 4A0CD 5LKTA 2IQJA 1MM2A 2LGVA 1V87A 1DVPA 4I7DA 2OXQC 4OGCA 3FEHA 4GB0A 2MNYA 2M85A 4C9ZA 1X4IA 3ZYQA 5G0FA 3GL6A 3LQHA 3MHHA 3HCSA 4GNFA 2F42A 2CSZA 2PUYA 4AYCB 5AITA 2KKYA 4I7BA 3PHDA 4IC2A 2M3HA 2KU3A 3M7KA 3SUBA 1RMDA 4PPEA 2XP0A 5SVXA 3RPGC 5B8DA 2ECWA 2MUMA 3FAOA 2ECNA 2FFWA 4FIPA 4YBMA 2D8UA 5H1UA 1WEMA 2KREA 4AP4A 2KGGA 2LN0A 1WEUA 4V3LC 5TDRA 2YREA 2L0BA 3O34A 2EA6A 2EXUA 5AIUA 4ZUXU 4MVTA 2JMIA 2LQ6A 5LCWB 1JM7A 3HCTA 2CRRA 2JMDA 1HYJA 2XEUA 2HDPA 4IC3A 4R8PK 3O35A 1LDJB 5KH9A 3FM8C 2M1RA 2MNZA 2QICA 2Y43A 2NAAA 2MA6A 4YBSA 3FJUB 3PUQA 3PLWA 3KNVA 1CHCA 2M6MA 5D1KB 5SVIB 1WILA 3JUEA 2FD4A 5D1MB 2ECIA 3E2DA 3V43A 1ZBDB 4WZ0A 5G04B 4I7CA 4L58A 2C2LA 3LQJA 2KWOA 5JG6A 1F62A 5TRBA 5FB1A 5TABA 3LVQE
chains in the Genus database with same CATH topology
1WESA 4W4UA 3RTRB 4TKPB 2KIZA 2QJ0A 4BHWA 4GNDA 2G6QA 2KWJA 4L7XA 2LV9A 1WEQA 3VK6A 2F6NA 1Z6UA 2LXPC 4NN2A 3MHSA 4LADB 5H9MA 2QIZA 2KFTA 2YSMA 3DQVR 5TDWA 4XI1A 1X4UA 2YUCA 4UI9B 3C6WA 1WE9A 4Q6FA 4UP5A 4CCGX 4AYCA 5C13A 5LKZA 2IDAA 2EODA 3O36A 1LDKC 1Z2QA 5KH7A 3NG2A 3ZVZB 1VD4A 3U5OA 3T6RA 2VPEA 4CA1A 2ECTA 3N9LA 2RSDA 3L11A 3PURA 4YC9A 5G05B 4FO9A 3FL2A 3O70A 1WEOA 3U5MA 4MSXA 4O64A 2YHOA 2MD8C 3ZNIA 1VFYA 2VJEA 1WEWA 5LKXA 2VJFB 2C2VS 4YATA 4P5OB 1WENA 1MM3A 3EB6A 2YW8A 4B7YC 2H0DA 4PTBA 2ECGA 2PNXA 1G25A 4QF3A 2YQMA 3HCUA 2Y1NA 5DINA 1XWHA 1Z60A 2MD7B 1E4UA 2YU4A 2K4DA 2L43A 3ZTGA 4LK9A 3L1XA 3M99A 2VPGA 4S3OB 3I2DA 3T7LA 2MIQA 2ZETC 2LGGA 2G45A 4X3GA 1T1HA 1JM7B 2VPDA 2VPBA 2CSYA 4YAXA 4YBTA 2VJEB 3EB5A 4LKAA 5FERA 3M62A 3U5PA 2G43A 2MA5A 2K1JA 3L1ZB 2KYUA 2HYED 3N9PA 4BBQA 1WEEA 2LGLA 2FUUA 3SOXA 4S3OC 2JMJA 2KR4A 3SOUA 2BAYA 5B79A 3QZVA 4GNEA 1WIMA 4FK5A 1FP0A 5J3XA 5I3LA 5C11A 1WGMA 3ZPVE 4N4FA 1BORA 2UZGA 4YABA 2YHNA 3KV6A 2KE1A 2L80A 2D8SA 3ZVYA 3HTKC 2KWKA 5B77A 4A4BA 2L75A 2LXHC 1HYIA 4AUQB 4R2YA 2YSJA 4UP0A 1WEPA 4A49A 5B76A 2CT2A 2LGKA 2LRIC 3SOWA 4B86C 3O33A 2JRJA 2YT5A 3SHBA 2E6RA 2VNFA 3KQIA 4ZDTA 5D1LB 5B78A 5EYAF 2ECVA 5LKUA 2I50A 4GNGA 3GV4A 2FSAA 3N9QA 5B75A 2KWNA 1FBVA 3N9MA 2YQLA 1U6GB 2MT5A 1JOCA 2KGIA 5H1TA 1WEVA 2L5UA 2E6SA 5TBNA 3ASLA 4QF2A 1IYMA 2F6JA 4WZ3B 4YADA 2LDRA 2CKLA 5H1VA 2CKLB 3N9OA 4WZ2A 1X4JA 3RPGB 2DX8A 4FJCA 3DPLR 4N3WA 4F52B 2ECJA 2YURA 3LRQA 1N87A 4WA6A 3N9NA 5KH3A 2AN6A 2YYRA 2XB1A 4A4CA 3IHPA 3KV5A 1VYXA 2RI7A 3O7AA 2K17A 2FUIA 3O37A 2Y1MA 5FB0A 3U5NA 4LJNA 2H0DB 4V3KC 2VP7A 2VJFA 5FEYA 4LLBA 5DKAA 1K2FA 2K16A 4ZQLA 4R7EA 1WFKA 3C5KA 3M63A 4AVXA 2EGPA 3LQIA 3ZPV1 4A0CD 5LKTA 1MM2A 2LGVA 1V87A 1DVPA 4I7DA 2OXQC 4GB0A 2MNYA 2M85A 4C9ZA 1X4IA 3ZYQA 5G0FA 3GL6A 3LQHA 3MHHA 3HCSA 4GNFA 2F42A 2CSZA 2PUYA 4AYCB 5AITA 4I7BA 3PHDA 4IC2A 2M3HA 2KU3A 1RMDA 4PPEA 3RPGC 5B8DA 2ECWA 2MUMA 2ECNA 4FIPA 4YBMA 5H1UA 1WEMA 2KREA 4AP4A 2KGGA 2LN0A 1WEUA 4V3LC 5TDRA 2YREA 2L0BA 3O34A 2EA6A 5AIUA 4ZUXU 4MVTA 2JMIA 2LQ6A 5LCWB 1JM7A 3HCTA 2JMDA 1HYJA 2XEUA 2HDPA 4IC3A 4R8PK 3O35A 1LDJB 5KH9A 2M1RA 2MNZA 2QICA 2Y43A 2NAAA 2MA6A 4YBSA 3PUQA 3KNVA 1CHCA 2M6MA 5D1KB 1WILA 5D1MB 2ECIA 3V43A 1ZBDB 4WZ0A 5G04B 4I7CA 4L58A 2C2LA 3LQJA 2KWOA 5JG6A 1F62A 5TRBA 5FB1A 5TABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WES A;  4W4U A;  3RTR B;  4TKP B;  2KIZ A;  2QJ0 A;  4BHW A;  4GND A;  2G6Q A;  2KWJ A;  4L7X A;  2LV9 A;  1WEQ A;  3VK6 A;  2F6N A;  1Z6U A;  2LXP C;  4NN2 A;  3MHS A;  4LAD B;  5H9M A;  2QIZ A;  2KFT A;  2YSM A;  3DQV R;  5TDW A;  4XI1 A;  1X4U A;  2YUC A;  4UI9 B;  3C6W A;  1WE9 A;  4Q6F A;  4UP5 A;  4CCG X;  4AYC A;  5C13 A;  5LKZ A;  2IDA A;  2EOD A;  3O36 A;  1LDK C;  1Z2Q A;  5KH7 A;  3NG2 A;  3ZVZ B;  1VD4 A;  3U5O A;  3T6R A;  2VPE A;  4CA1 A;  2ECT A;  3N9L A;  2RSD A;  3L11 A;  3PUR A;  4YC9 A;  5G05 B;  4FO9 A;  3FL2 A;  3O70 A;  1WEO A;  3U5M A;  4MSX A;  4O64 A;  2YHO A;  2MD8 C;  3ZNI A;  1VFY A;  2VJE A;  1WEW A;  5LKX A;  2VJF B;  2C2V S;  4YAT A;  4P5O B;  1WEN A;  1MM3 A;  3EB6 A;  2YW8 A;  4B7Y C;  2H0D A;  4PTB A;  2ECG A;  2PNX A;  1G25 A;  4QF3 A;  2YQM A;  3HCU A;  2Y1N A;  5DIN A;  1XWH A;  1Z60 A;  2MD7 B;  1E4U A;  2YU4 A;  2K4D A;  2L43 A;  3ZTG A;  4LK9 A;  3L1X A;  3M99 A;  2VPG A;  4S3O B;  3I2D A;  3T7L A;  2MIQ A;  2ZET C;  2LGG A;  2G45 A;  4X3G A;  1T1H A;  1JM7 B;  2VPD A;  2VPB A;  2CSY A;  4YAX A;  4YBT A;  2VJE B;  3EB5 A;  4LKA A;  5FER A;  3M62 A;  3U5P A;  2G43 A;  2MA5 A;  2K1J A;  3L1Z B;  2KYU A;  2HYE D;  3N9P A;  4BBQ A;  1WEE A;  2LGL A;  2FUU A;  3SOX A;  4S3O C;  2JMJ A;  2KR4 A;  3SOU A;  2BAY A;  5B79 A;  3QZV A;  4GNE A;  1WIM A;  4FK5 A;  1FP0 A;  5J3X A;  5I3L A;  5C11 A;  1WGM A;  3ZPV E;  4N4F A;  1BOR A;  2UZG A;  4YAB A;  2YHN A;  3KV6 A;  2KE1 A;  2L80 A;  2D8S A;  3ZVY A;  3HTK C;  2KWK A;  5B77 A;  4A4B A;  2L75 A;  2LXH C;  1HYI A;  4AUQ B;  4R2Y A;  2YSJ A;  4UP0 A;  1WEP A;  4A49 A;  5B76 A;  2CT2 A;  2LGK A;  2LRI C;  3SOW A;  4B86 C;  3O33 A;  2JRJ A;  2YT5 A;  3SHB A;  2E6R A;  2VNF A;  3KQI A;  4ZDT A;  5D1L B;  5B78 A;  5EYA F;  2ECV A;  5LKU A;  2I50 A;  4GNG A;  3GV4 A;  2FSA A;  3N9Q A;  5B75 A;  2KWN A;  1FBV A;  3N9M A;  2YQL A;  1U6G B;  2MT5 A;  1JOC A;  2KGI A;  5H1T A;  1WEV A;  2L5U A;  2E6S A;  5TBN A;  3ASL A;  4QF2 A;  1IYM A;  2F6J A;  4WZ3 B;  4YAD A;  2LDR A;  2CKL A;  5H1V A;  2CKL B;  3N9O A;  4WZ2 A;  1X4J A;  3RPG B;  2DX8 A;  4FJC A;  3DPL R;  4N3W A;  4F52 B;  2ECJ A;  2YUR A;  3LRQ A;  1N87 A;  4WA6 A;  3N9N A;  5KH3 A;  2AN6 A;  2YYR A;  2XB1 A;  4A4C A;  3IHP A;  3KV5 A;  1VYX A;  2RI7 A;  3O7A A;  2K17 A;  2FUI A;  3O37 A;  2Y1M A;  5FB0 A;  3U5N A;  4LJN A;  2H0D B;  4V3K C;  2VP7 A;  2VJF A;  5FEY A;  4LLB A;  5DKA A;  1K2F A;  2K16 A;  4ZQL A;  4R7E A;  1WFK A;  3C5K A;  3M63 A;  4AVX A;  2EGP A;  3LQI A;  3ZPV 1;  4A0C D;  5LKT A;  1MM2 A;  2LGV A;  1V87 A;  1DVP A;  4I7D A;  2OXQ C;  4GB0 A;  2MNY A;  2M85 A;  4C9Z A;  1X4I A;  3ZYQ A;  5G0F A;  3GL6 A;  3LQH A;  3MHH A;  3HCS A;  4GNF A;  2F42 A;  2CSZ A;  2PUY A;  4AYC B;  5AIT A;  4I7B A;  3PHD A;  4IC2 A;  2M3H A;  2KU3 A;  1RMD A;  4PPE A;  3RPG C;  5B8D A;  2ECW A;  2MUM A;  2ECN A;  4FIP A;  4YBM A;  5H1U A;  1WEM A;  2KRE A;  4AP4 A;  2KGG A;  2LN0 A;  1WEU A;  4V3L C;  5TDR A;  2YRE A;  2L0B A;  3O34 A;  2EA6 A;  5AIU A;  4ZUX U;  4MVT A;  2JMI A;  2LQ6 A;  5LCW B;  1JM7 A;  3HCT A;  2JMD A;  1HYJ A;  2XEU A;  2HDP A;  4IC3 A;  4R8P K;  3O35 A;  1LDJ B;  5KH9 A;  2M1R A;  2MNZ A;  2QIC A;  2Y43 A;  2NAA A;  2MA6 A;  4YBS A;  3PUQ A;  3KNV A;  1CHC A;  2M6M A;  5D1K B;  1WIL A;  5D1M B;  2ECI A;  3V43 A;  1ZBD B;  4WZ0 A;  5G04 B;  4I7C A;  4L58 A;  2C2L A;  3LQJ A;  2KWO A;  5JG6 A;  1F62 A;  5TRB A;  5FB1 A;  5TAB A; 
#chains in the Genus database with same CATH topology
 1WES A;  2RR4 A;  3H7H A;  4W4U A;  3RTR B;  4TKP B;  2KIZ A;  2QJ0 A;  2KKX A;  4BHW A;  4GND A;  2G6Q A;  2KWJ A;  4L7X A;  2LV9 A;  3DWD A;  1WEQ A;  3VK6 A;  2F6N A;  1Z6U A;  2LXP C;  4NN2 A;  3MHS A;  4LAD B;  2DJA A;  5H9M A;  2QIZ A;  4Z0R A;  2KFT A;  2YSM A;  2CRW A;  3DQV R;  5TDW A;  2M13 A;  4XI1 A;  1X4U A;  2YUC A;  4UI9 B;  3C6W A;  1WE9 A;  4Q6F A;  4UP5 A;  4CCG X;  4AYC A;  5C13 A;  5SVI A;  5LKZ A;  2IDA A;  2EOD A;  3O36 A;  1LDK C;  2JM3 A;  1Z2Q A;  5KH7 A;  3NG2 A;  3ZVZ B;  2CON A;  1VD4 A;  3U5O A;  3T6R A;  2JUN A;  2VPE A;  4CA1 A;  2ECT A;  3N9L A;  2EGM A;  2RSD A;  4H9D A;  2L7P A;  3L11 A;  3PUR A;  4YC9 A;  5G05 B;  4QQ4 A;  4FO9 A;  3FL2 A;  3O70 A;  1WEO A;  3U5M A;  4MSX A;  4O64 A;  2YHO A;  2MD8 C;  1VFY A;  2VJE A;  3ZNI A;  1WEW A;  5LKX A;  2VJF B;  2C2V S;  4YAT A;  4P5O B;  2LAU A;  1WEN A;  3O47 A;  1MM3 A;  3EB6 A;  2YW8 A;  4B7Y C;  2H0D A;  4PTB A;  2ECG A;  2PNX A;  1G25 A;  4QF3 A;  2YQM A;  3HCU A;  4O62 A;  2YVR A;  2Y1N A;  5DIN A;  1XWH A;  1Z60 A;  2MD7 B;  1E4U A;  2YU4 A;  2K4D A;  2L43 A;  3ZTG A;  4LK9 A;  3L1X A;  3M99 A;  2VPG A;  4S3O B;  3I2D A;  3T9K A;  3T7L A;  2MIQ A;  2ZET C;  2LGG A;  2G45 A;  4X3G A;  1T1H A;  1JM7 B;  4Z0O A;  2VPD A;  2VPB A;  2CSY A;  4YAX A;  4YBT A;  2VJE B;  3EB5 A;  4LKA A;  1MBM A;  5FER A;  3M62 A;  3U5P A;  2G43 A;  2MA5 A;  2K1J A;  3L1Z B;  2KYU A;  2HYE D;  3N9P A;  4BBQ A;  1WEE A;  2LGL A;  2FUU A;  3SOX A;  4S3O C;  2JMJ A;  2KR4 A;  3SOU A;  2BAY A;  5B79 A;  3QZV A;  4GNE A;  4OGE A;  1WIM A;  4FK5 A;  1FP0 A;  2B0O E;  5J3X A;  5I3L A;  5C11 A;  1WGM A;  3ZPV E;  4N4F A;  1BOR A;  2UZG A;  4YAB A;  2YHN A;  5K3Q A;  3KV6 A;  2KE1 A;  2L80 A;  2D8S A;  3ZVY A;  3HTK C;  2KWK A;  5B77 A;  4A4B A;  2L75 A;  2LXH C;  1HYI A;  4AUQ B;  4R2Y A;  2YSJ A;  4UP0 A;  1WEP A;  2OWA A;  4A49 A;  5B76 A;  2CSV A;  2CT2 A;  2P57 A;  2LGK A;  2LRI C;  3SOW A;  5SVY A;  4B86 C;  3O33 A;  2JRJ A;  2YT5 A;  3SHB A;  2E6R A;  2VNF A;  3KQI A;  4ZDT A;  2XOC A;  2DSM A;  5D1L B;  5B78 A;  2XOZ A;  5EYA F;  2ECV A;  5LKU A;  2I50 A;  4GNG A;  3GV4 A;  2FSA A;  3LJU X;  3N9Q A;  3KDE C;  5B75 A;  2KWN A;  1FBV A;  3N9M A;  2YQL A;  1U6G B;  3MDB C;  2MT5 A;  4F1P A;  1JOC A;  2KGI A;  5H1T A;  1WEV A;  3LDY A;  2L5U A;  2E6S A;  5TBN A;  3ASL A;  4QF2 A;  1IYM A;  2F6J A;  4WZ3 B;  4YAD A;  2LDR A;  2XOY A;  3FAN A;  2CKL A;  5H1V A;  2CKL B;  3N9O A;  4WZ2 A;  1X4J A;  3DDT A;  3RPG B;  2DX8 A;  4FJC A;  3DPL R;  1DCQ A;  4N3W A;  4F52 B;  2ECJ A;  2YUR A;  3LRQ A;  1N87 A;  4WA6 A;  3N9N A;  3LVR E;  5KH3 A;  2AN6 A;  2YYR A;  2XB1 A;  4A4C A;  3IHP A;  3KV5 A;  1VYX A;  2RI7 A;  3O7A A;  2K17 A;  2FUI A;  3O37 A;  2Y1M A;  5FB0 A;  3U5N A;  4LJN A;  2H0D B;  4V3K C;  2E61 A;  2VP7 A;  2VJF A;  5FEY A;  4LLB A;  5DKA A;  1K2F A;  3Q1D A;  2K16 A;  4ZQL A;  4R7E A;  1WFK A;  2MKE A;  3C5K A;  3M63 A;  4AVX A;  2EGP A;  3LQI A;  3ZPV 1;  4A0C D;  5LKT A;  2IQJ A;  1MM2 A;  2LGV A;  1V87 A;  1DVP A;  4I7D A;  2OXQ C;  4OGC A;  3FEH A;  4GB0 A;  2MNY A;  2M85 A;  4C9Z A;  1X4I A;  3ZYQ A;  5G0F A;  3GL6 A;  3LQH A;  3MHH A;  3HCS A;  4GNF A;  2F42 A;  2CSZ A;  2PUY A;  4AYC B;  5AIT A;  2KKY A;  4I7B A;  3PHD A;  4IC2 A;  2M3H A;  2KU3 A;  3M7K A;  3SUB A;  1RMD A;  4PPE A;  2XP0 A;  5SVX A;  3RPG C;  5B8D A;  2ECW A;  2MUM A;  3FAO A;  2ECN A;  2FFW A;  4FIP A;  4YBM A;  2D8U A;  5H1U A;  1WEM A;  2KRE A;  4AP4 A;  2KGG A;  2LN0 A;  1WEU A;  4V3L C;  5TDR A;  2YRE A;  2L0B A;  3O34 A;  2EA6 A;  2EXU A;  5AIU A;  4ZUX U;  4MVT A;  2JMI A;  2LQ6 A;  5LCW B;  1JM7 A;  3HCT A;  2CRR A;  2JMD A;  1HYJ A;  2XEU A;  2HDP A;  4IC3 A;  4R8P K;  3O35 A;  1LDJ B;  5KH9 A;  3FM8 C;  2M1R A;  2MNZ A;  2QIC A;  2Y43 A;  2NAA A;  2MA6 A;  4YBS A;  3FJU B;  3PUQ A;  3PLW A;  3KNV A;  1CHC A;  2M6M A;  5D1K B;  5SVI B;  1WIL A;  3JUE A;  2FD4 A;  5D1M B;  2ECI A;  3E2D A;  3V43 A;  1ZBD B;  4WZ0 A;  5G04 B;  4I7C A;  4L58 A;  2C2L A;  3LQJ A;  2KWO A;  5JG6 A;  1F62 A;  5TRB A;  5FB1 A;  5TAB A;  3LVQ E; 
#chains in the Genus database with same CATH homology
 1WES A;  4W4U A;  3RTR B;  4TKP B;  2KIZ A;  2QJ0 A;  4BHW A;  4GND A;  2G6Q A;  2KWJ A;  4L7X A;  2LV9 A;  1WEQ A;  3VK6 A;  2F6N A;  1Z6U A;  2LXP C;  4NN2 A;  3MHS A;  4LAD B;  5H9M A;  2QIZ A;  2KFT A;  2YSM A;  3DQV R;  5TDW A;  4XI1 A;  1X4U A;  2YUC A;  4UI9 B;  3C6W A;  1WE9 A;  4Q6F A;  4UP5 A;  4CCG X;  4AYC A;  5C13 A;  5LKZ A;  2IDA A;  2EOD A;  3O36 A;  1LDK C;  1Z2Q A;  5KH7 A;  3NG2 A;  3ZVZ B;  1VD4 A;  3U5O A;  3T6R A;  2VPE A;  4CA1 A;  2ECT A;  3N9L A;  2RSD A;  3L11 A;  3PUR A;  4YC9 A;  5G05 B;  4FO9 A;  3FL2 A;  3O70 A;  1WEO A;  3U5M A;  4MSX A;  4O64 A;  2YHO A;  2MD8 C;  3ZNI A;  1VFY A;  2VJE A;  1WEW A;  5LKX A;  2VJF B;  2C2V S;  4YAT A;  4P5O B;  1WEN A;  1MM3 A;  3EB6 A;  2YW8 A;  4B7Y C;  2H0D A;  4PTB A;  2ECG A;  2PNX A;  1G25 A;  4QF3 A;  2YQM A;  3HCU A;  2Y1N A;  5DIN A;  1XWH A;  1Z60 A;  2MD7 B;  1E4U A;  2YU4 A;  2K4D A;  2L43 A;  3ZTG A;  4LK9 A;  3L1X A;  3M99 A;  2VPG A;  4S3O B;  3I2D A;  3T7L A;  2MIQ A;  2ZET C;  2LGG A;  2G45 A;  4X3G A;  1T1H A;  1JM7 B;  2VPD A;  2VPB A;  2CSY A;  4YAX A;  4YBT A;  2VJE B;  3EB5 A;  4LKA A;  5FER A;  3M62 A;  3U5P A;  2G43 A;  2MA5 A;  2K1J A;  3L1Z B;  2KYU A;  2HYE D;  3N9P A;  4BBQ A;  1WEE A;  2LGL A;  2FUU A;  3SOX A;  4S3O C;  2JMJ A;  2KR4 A;  3SOU A;  2BAY A;  5B79 A;  3QZV A;  4GNE A;  1WIM A;  4FK5 A;  1FP0 A;  5J3X A;  5I3L A;  5C11 A;  1WGM A;  3ZPV E;  4N4F A;  1BOR A;  2UZG A;  4YAB A;  2YHN A;  3KV6 A;  2KE1 A;  2L80 A;  2D8S A;  3ZVY A;  3HTK C;  2KWK A;  5B77 A;  4A4B A;  2L75 A;  2LXH C;  1HYI A;  4AUQ B;  4R2Y A;  2YSJ A;  4UP0 A;  1WEP A;  4A49 A;  5B76 A;  2CT2 A;  2LGK A;  2LRI C;  3SOW A;  4B86 C;  3O33 A;  2JRJ A;  2YT5 A;  3SHB A;  2E6R A;  2VNF A;  3KQI A;  4ZDT A;  5D1L B;  5B78 A;  5EYA F;  2ECV A;  5LKU A;  2I50 A;  4GNG A;  3GV4 A;  2FSA A;  3N9Q A;  5B75 A;  2KWN A;  1FBV A;  3N9M A;  2YQL A;  1U6G B;  2MT5 A;  1JOC A;  2KGI A;  5H1T A;  1WEV A;  2L5U A;  2E6S A;  5TBN A;  3ASL A;  4QF2 A;  1IYM A;  2F6J A;  4WZ3 B;  4YAD A;  2LDR A;  2CKL A;  5H1V A;  2CKL B;  3N9O A;  4WZ2 A;  1X4J A;  3RPG B;  2DX8 A;  4FJC A;  3DPL R;  4N3W A;  4F52 B;  2ECJ A;  2YUR A;  3LRQ A;  1N87 A;  4WA6 A;  3N9N A;  5KH3 A;  2AN6 A;  2YYR A;  2XB1 A;  4A4C A;  3IHP A;  3KV5 A;  1VYX A;  2RI7 A;  3O7A A;  2K17 A;  2FUI A;  3O37 A;  2Y1M A;  5FB0 A;  3U5N A;  4LJN A;  2H0D B;  4V3K C;  2VP7 A;  2VJF A;  5FEY A;  4LLB A;  5DKA A;  1K2F A;  2K16 A;  4ZQL A;  4R7E A;  1WFK A;  3C5K A;  3M63 A;  4AVX A;  2EGP A;  3LQI A;  3ZPV 1;  4A0C D;  5LKT A;  1MM2 A;  2LGV A;  1V87 A;  1DVP A;  4I7D A;  2OXQ C;  4GB0 A;  2MNY A;  2M85 A;  4C9Z A;  1X4I A;  3ZYQ A;  5G0F A;  3GL6 A;  3LQH A;  3MHH A;  3HCS A;  4GNF A;  2F42 A;  2CSZ A;  2PUY A;  4AYC B;  5AIT A;  4I7B A;  3PHD A;  4IC2 A;  2M3H A;  2KU3 A;  1RMD A;  4PPE A;  3RPG C;  5B8D A;  2ECW A;  2MUM A;  2ECN A;  4FIP A;  4YBM A;  5H1U A;  1WEM A;  2KRE A;  4AP4 A;  2KGG A;  2LN0 A;  1WEU A;  4V3L C;  5TDR A;  2YRE A;  2L0B A;  3O34 A;  2EA6 A;  5AIU A;  4ZUX U;  4MVT A;  2JMI A;  2LQ6 A;  5LCW B;  1JM7 A;  3HCT A;  2JMD A;  1HYJ A;  2XEU A;  2HDP A;  4IC3 A;  4R8P K;  3O35 A;  1LDJ B;  5KH9 A;  2M1R A;  2MNZ A;  2QIC A;  2Y43 A;  2NAA A;  2MA6 A;  4YBS A;  3PUQ A;  3KNV A;  1CHC A;  2M6M A;  5D1K B;  1WIL A;  5D1M B;  2ECI A;  3V43 A;  1ZBD B;  4WZ0 A;  5G04 B;  4I7C A;  4L58 A;  2C2L A;  3LQJ A;  2KWO A;  5JG6 A;  1F62 A;  5TRB A;  5FB1 A;  5TAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...