1WGMA

Solution structure of the u-box in human ubiquitin conjugation factor e4a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin conjugation factor E4A
publication title Solution structure of the U-box in human ubiquitin conjugation factor E4A
rcsb
source organism Homo sapiens
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wgmA01
5D1LB 4XI1A 1MM3A 1K2FA 4GNGA 4CCGX 2KWKA 2CKLB 2L75A 4S3OB 2H0DA 4YBSA 2LGVA 3N9QA 5FB0A 4FO9A 4A0CD 3T7LA 4TKPB 5B76A 2CKLA 4YAXA 5FEYA 4R2YA 2LV9A 3KQIA 3KV5A 3IHPA 3ZVYA 3V43A 3KV6A 3ASLA 3LQHA 2VPEA 3GV4A 3ZYQA 3O35A 5TDRA 2M85A 2VJFB 1Z60A 1Z6UA 2VPGA 5G0FA 2VNFA 2KWOA 4AVXA 2KFTA 4AP4A 4LJNA 1LDKC 4P5OB 2YUCA 2DX8A 5LKXA 3N9NA 3N9OA 4YATA 2MA5A 3ZPVE 2E6RA 3ZVZB 2OXQC 3PHDA 2L43A 5AITA 4WZ0A 1WGMA 2C2LA 1WEWA 2YSMA 2F6JA 3U5NA 3L1ZB 2XEUA 2LN0A 3ZTGA 1ZBDB 3U5MA 2QICA 2NAAA 2LRIC 2LGLA 3O37A 4AYCB 4V3KC 5G04B 2YHNA 3HCTA 2BAYA 5LKZA 1V87A 2K1JA 3EB6A 2PNXA 2PUYA 1XWHA 3N9PA 4AYCA 4NN2A 3M63A 2M6MA 3RPGB 1HYIA 2Y1NA 3PURA 5B75A 4FK5A 4A49A 3HTKC 2JMIA 1WENA 5JG6A 5KH3A 2ECVA 1E4UA 1CHCA 3L11A 3NG2A 4IC3A 1RMDA 4I7CA 3VK6A 2QIZA 5FERA 1WEUA 4LK9A 2ECIA 5DINA 2VJEB 2M1RA 3HCUA 2D8SA 4A4BA 2MNZA 2YYRA 3MHSA 2K17A 2MD8C 4WA6A 2MIQA 5B79A 3SOXA 1U6GB 1WEMA 1WFKA 3LQJA 2CT2A 4ZQLA 3U5OA 4IC2A 3O33A 1N87A 1VD4A 4FJCA 4LADB 3ZPV1 3DPLR 3N9MA 4S3OC 4UP5A 4YBMA 2KIZA 2L80A 5C11A 2KREA 4BHWA 4L7XA 1JM7B 1WEQA 1WEPA 4N4FA 3SHBA 2Y1MA 1WILA 1DVPA 3EB5A 1F62A 2VJFA 5KH7A 4R8PK 2E6SA 2G6QA 2HYED 2YQLA 4GNEA 1X4IA 2VP7A 3PUQA 4WZ2A 4X3GA 2KWJA 2F42A 4PTBA 5EYAF 2QJ0A 2MT5A 2YHOA 4V3LC 1LDJB 2UZGA 4ZUXU 1X4JA 4MSXA 3HCSA 5H9MA 5KH9A 2VPDA 2Y43A 1VYXA 2FUIA 2L0BA 1MM2A 3C6WA 4GNDA 2KE1A 4QF3A 2YREA 2LDRA 3FL2A 1WEEA 5I3LA 5H1VA 5FB1A 5B8DA 2K4DA 2F6NA 1T1HA 3RPGC 2CSYA 1WE9A 2ECJA 3U5PA 2AN6A 3SOWA 2YW8A 3C5KA 5TBNA 4C9ZA 1VFYA 3T6RA 1FBVA 4GB0A 4Q6FA 3M62A 1BORA 2FUUA 2IDAA 1WEVA 3O36A 2VJEA 5LKTA 2C2VS 2LXPC 2KYUA 5DKAA 5J3XA 3LQIA 4PPEA 4O64A 4CA1A 5LKUA 5B78A 1FP0A 2H0DB 4QF2A 4B7YC 2RI7A 2JMDA 3RTRB 2FSAA 4ZDTA 2YURA 2CSZA 2YSJA 2ECTA 2LQ6A 4LLBA 5D1MB 4A4CA 3N9LA 3MHHA 4FIPA 1HYJA 2ZETC 1X4UA 1G25A 2EGPA 5G05B 1JM7A 2KU3A 3L1XA 5B77A 2MNYA 4I7DA 3KNVA 4AUQB 4B86C 4MVTA 3LRQA 2VPBA 2G45A 2ECGA 2G43A 2M3HA 1Z2QA 4W4UA 2JRJA 2YT5A 2MD7B 5TABA 4YC9A 2YU4A 3M99A 4LKAA 1WESA 4N3WA 4BBQA 2MA6A 1WIMA 5AIUA 4GNFA 5TRBA 2RSDA 1IYMA 5D1KB 2L5UA 2LGKA 4YBTA 1WEOA 2ECNA 4UP0A 5H1UA 2KGGA 4WZ3B 5H1TA 2HDPA 3SOUA 3ZNIA 1JOCA 2YQMA 2XB1A 4F52B 2KWNA 2K16A 3GL6A 3O70A 2EA6A 4L58A 2EODA 2MUMA 3O7AA 2LGGA 4YABA 3I2DA 4R7EA 2LXHC 4YADA 5TDWA 2JMJA 2KGIA 5LCWB 4I7BA 5C13A 3O34A 3DQVR 4UI9B 2I50A 2ECWA 2KR4A 3QZVA
chains in the Genus database with same CATH superfamily
5D1LB 4XI1A 1MM3A 3LVQE 2DJAA 1K2FA 4GNGA 4CCGX 2KWKA 2CKLB 2L75A 4S3OB 2H0DA 4YBSA 2LGVA 3N9QA 5FB0A 4FO9A 4A0CD 3T7LA 4TKPB 5B76A 2CKLA 4YAXA 5FEYA 4R2YA 2LV9A 3KQIA 3KV5A 3IHPA 3ZVYA 3V43A 3KV6A 3ASLA 3LQHA 2VPEA 3GV4A 3ZYQA 3O35A 5TDRA 2M85A 2VJFB 4Z0OA 1Z60A 1Z6UA 2VPGA 5G0FA 2VNFA 2YVRA 2KWOA 4AVXA 2KFTA 4AP4A 4LJNA 1LDKC 4P5OB 2YUCA 2DX8A 5LKXA 3N9NA 3N9OA 4YATA 4H9DA 2MA5A 3ZPVE 2KKXA 3O47A 2E6RA 3ZVZB 3E2DA 3JUEA 2OXQC 3PHDA 2L43A 5AITA 4WZ0A 2P57A 3LDYA 1WGMA 3H7HA 2C2LA 1WEWA 2YSMA 2F6JA 3U5NA 3L1ZB 2XEUA 2LN0A 3ZTGA 1ZBDB 3U5MA 2QICA 1DCQA 2NAAA 2LRIC 2LGLA 3O37A 4AYCB 4V3KC 5G04B 2YHNA 3HCTA 3MDBC 2BAYA 2MKEA 5LKZA 1V87A 2K1JA 3EB6A 2PNXA 2PUYA 1XWHA 3N9PA 4AYCA 4NN2A 3M63A 2M6MA 3RPGB 1HYIA 2Y1NA 3PURA 5B75A 4FK5A 4A49A 3HTKC 2JMIA 1WENA 5JG6A 5KH3A 2ECVA 2FFWA 1E4UA 2EGMA 1CHCA 3L11A 3NG2A 4IC3A 1RMDA 4I7CA 3VK6A 2FD4A 2QIZA 5FERA 1WEUA 4LK9A 2ECIA 5DINA 2VJEB 2M1RA 3HCUA 2D8SA 3FJUB 4A4BA 1MBMA 2MNZA 2YYRA 3MHSA 2K17A 2MD8C 4WA6A 5SVIA 2MIQA 5B79A 2RR4A 3SOXA 1U6GB 1WEMA 1WFKA 3LQJA 4O62A 2CT2A 4ZQLA 3Q1DA 3U5OA 4IC2A 3O33A 1N87A 1VD4A 4FJCA 4LADB 3ZPV1 3DPLR 3N9MA 4S3OC 4UP5A 4YBMA 2KIZA 2L80A 5C11A 2KREA 3DWDA 2CRRA 4BHWA 4L7XA 1JM7B 1WEQA 2JUNA 1WEPA 4N4FA 2IQJA 3SHBA 2Y1MA 1WILA 1DVPA 3M7KA 3EB5A 1F62A 2VJFA 3DDTA 5KH7A 2KKYA 4R8PK 2E6SA 2G6QA 2HYED 2YQLA 4GNEA 1X4IA 2VP7A 5SVXA 3PUQA 3T9KA 2OWAA 3FANA 4WZ2A 2KWJA 4X3GA 2F42A 4PTBA 5EYAF 2QJ0A 2MT5A 2YHOA 4V3LC 4OGEA 1LDJB 2UZGA 4ZUXU 1X4JA 4MSXA 2XP0A 3HCSA 5H9MA 5KH9A 3FAOA 2VPDA 2Y43A 1VYXA 2FUIA 4F1PA 2L0BA 1MM2A 3C6WA 4GNDA 2KE1A 4QF3A 2YREA 2LDRA 3FL2A 1WEEA 5I3LA 3KDEC 5H1VA 5FB1A 5B8DA 2K4DA 2F6NA 1T1HA 3RPGC 2CSYA 1WE9A 2ECJA 3U5PA 2AN6A 3SOWA 2YW8A 3C5KA 5TBNA 4C9ZA 1VFYA 3T6RA 1FBVA 2LAUA 4GB0A 4Q6FA 3M62A 2CRWA 1BORA 2FUUA 2IDAA 1WEVA 3O36A 2XOZA 2VJEA 5LKTA 2C2VS 2EXUA 2E61A 2LXPC 2KYUA 5DKAA 5J3XA 3LQIA 4PPEA 4O64A 4CA1A 5LKUA 5B78A 1FP0A 2H0DB 4QF2A 4B7YC 2RI7A 5SVYA 2JMDA 3RTRB 2FSAA 2CSVA 4ZDTA 2YURA 2CSZA 2YSJA 2ECTA 2LQ6A 3LJUX 4LLBA 5D1MB 4A4CA 3N9LA 3MHHA 4FIPA 3FM8C 1HYJA 2ZETC 1X4UA 3FEHA 1G25A 4QQ4A 2EGPA 2JM3A 5G05B 1JM7A 2KU3A 3L1XA 5B77A 3PLWA 2MNYA 4I7DA 3KNVA 4AUQB 4B86C 4MVTA 2B0OE 3LRQA 2VPBA 2G45A 2ECGA 2G43A 2M3HA 1Z2QA 4W4UA 2JRJA 2M13A 2YT5A 2L7PA 2MD7B 2XOCA 4Z0RA 5TABA 5K3QA 4YC9A 2YU4A 3M99A 4LKAA 1WESA 4N3WA 4BBQA 2MA6A 1WIMA 5AIUA 4GNFA 2RSDA 5TRBA 1IYMA 5D1KB 2L5UA 2LGKA 4YBTA 1WEOA 2ECNA 4UP0A 5H1UA 2KGGA 4WZ3B 5H1TA 2HDPA 2CONA 3SOUA 3ZNIA 1JOCA 2YQMA 2XB1A 4F52B 2KWNA 2D8UA 3SUBA 2K16A 3GL6A 3O70A 2EA6A 4L58A 2EODA 2MUMA 3O7AA 2LGGA 4YABA 3I2DA 4R7EA 2LXHC 2DSMA 4YADA 5TDWA 2JMJA 2KGIA 5LCWB 4I7BA 3LVRE 5C13A 3O34A 3DQVR 4UI9B 4OGCA 2I50A 5SVIB 2ECWA 2XOYA 2KR4A 3QZVA
chains in the Genus database with same CATH topology
5D1LB 4XI1A 1MM3A 1K2FA 4GNGA 4CCGX 2KWKA 2CKLB 2L75A 4S3OB 2H0DA 4YBSA 2LGVA 3N9QA 5FB0A 4FO9A 4A0CD 3T7LA 4TKPB 5B76A 2CKLA 4YAXA 5FEYA 4R2YA 2LV9A 3KQIA 3KV5A 3IHPA 3ZVYA 3V43A 3KV6A 3ASLA 3LQHA 2VPEA 3GV4A 3ZYQA 3O35A 5TDRA 2M85A 2VJFB 1Z60A 1Z6UA 2VPGA 5G0FA 2VNFA 2KWOA 4AVXA 2KFTA 4AP4A 4LJNA 1LDKC 4P5OB 2YUCA 2DX8A 5LKXA 3N9NA 3N9OA 4YATA 2MA5A 3ZPVE 2E6RA 3ZVZB 2OXQC 3PHDA 2L43A 5AITA 4WZ0A 1WGMA 2C2LA 1WEWA 2YSMA 2F6JA 3U5NA 3L1ZB 2XEUA 2LN0A 3ZTGA 1ZBDB 3U5MA 2QICA 2NAAA 2LRIC 2LGLA 3O37A 4AYCB 4V3KC 5G04B 2YHNA 3HCTA 2BAYA 5LKZA 1V87A 2K1JA 3EB6A 2PNXA 2PUYA 1XWHA 3N9PA 4AYCA 4NN2A 3M63A 2M6MA 3RPGB 1HYIA 2Y1NA 3PURA 5B75A 4FK5A 4A49A 3HTKC 2JMIA 1WENA 5JG6A 5KH3A 2ECVA 1E4UA 1CHCA 3L11A 3NG2A 4IC3A 1RMDA 4I7CA 3VK6A 2QIZA 5FERA 1WEUA 4LK9A 2ECIA 5DINA 2VJEB 2M1RA 3HCUA 2D8SA 4A4BA 2MNZA 2YYRA 3MHSA 2K17A 2MD8C 4WA6A 2MIQA 5B79A 3SOXA 1U6GB 1WEMA 1WFKA 3LQJA 2CT2A 4ZQLA 3U5OA 4IC2A 3O33A 1N87A 1VD4A 4FJCA 4LADB 3ZPV1 3DPLR 3N9MA 4S3OC 4UP5A 4YBMA 2KIZA 2L80A 5C11A 2KREA 4BHWA 4L7XA 1JM7B 1WEQA 1WEPA 4N4FA 3SHBA 2Y1MA 1WILA 1DVPA 3EB5A 1F62A 2VJFA 5KH7A 4R8PK 2E6SA 2G6QA 2HYED 2YQLA 4GNEA 1X4IA 2VP7A 3PUQA 4WZ2A 4X3GA 2KWJA 2F42A 4PTBA 5EYAF 2QJ0A 2MT5A 2YHOA 4V3LC 1LDJB 2UZGA 4ZUXU 1X4JA 4MSXA 3HCSA 5H9MA 5KH9A 2VPDA 2Y43A 1VYXA 2FUIA 2L0BA 1MM2A 3C6WA 4GNDA 2KE1A 4QF3A 2YREA 2LDRA 3FL2A 1WEEA 5I3LA 5H1VA 5FB1A 5B8DA 2K4DA 2F6NA 1T1HA 3RPGC 2CSYA 1WE9A 2ECJA 3U5PA 2AN6A 3SOWA 2YW8A 3C5KA 5TBNA 4C9ZA 1VFYA 3T6RA 1FBVA 4GB0A 4Q6FA 3M62A 1BORA 2FUUA 2IDAA 1WEVA 3O36A 2VJEA 5LKTA 2C2VS 2LXPC 2KYUA 5DKAA 5J3XA 3LQIA 4PPEA 4O64A 4CA1A 5LKUA 5B78A 1FP0A 2H0DB 4QF2A 4B7YC 2RI7A 2JMDA 3RTRB 2FSAA 4ZDTA 2YURA 2CSZA 2YSJA 2ECTA 2LQ6A 4LLBA 5D1MB 4A4CA 3N9LA 3MHHA 4FIPA 1HYJA 2ZETC 1X4UA 1G25A 2EGPA 5G05B 1JM7A 2KU3A 3L1XA 5B77A 2MNYA 4I7DA 3KNVA 4AUQB 4B86C 4MVTA 3LRQA 2VPBA 2G45A 2ECGA 2G43A 2M3HA 1Z2QA 4W4UA 2JRJA 2YT5A 2MD7B 5TABA 4YC9A 2YU4A 3M99A 4LKAA 1WESA 4N3WA 4BBQA 2MA6A 1WIMA 5AIUA 4GNFA 5TRBA 2RSDA 1IYMA 5D1KB 2L5UA 2LGKA 4YBTA 1WEOA 2ECNA 4UP0A 5H1UA 2KGGA 4WZ3B 5H1TA 2HDPA 3SOUA 3ZNIA 1JOCA 2YQMA 2XB1A 4F52B 2KWNA 2K16A 3GL6A 3O70A 2EA6A 4L58A 2EODA 2MUMA 3O7AA 2LGGA 4YABA 3I2DA 4R7EA 2LXHC 4YADA 5TDWA 2JMJA 2KGIA 5LCWB 4I7BA 5C13A 3O34A 3DQVR 4UI9B 2I50A 2ECWA 2KR4A 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1L B;  4XI1 A;  1MM3 A;  1K2F A;  4GNG A;  4CCG X;  2KWK A;  2CKL B;  2L75 A;  4S3O B;  2H0D A;  4YBS A;  2LGV A;  3N9Q A;  5FB0 A;  4FO9 A;  4A0C D;  3T7L A;  4TKP B;  5B76 A;  2CKL A;  4YAX A;  5FEY A;  4R2Y A;  2LV9 A;  3KQI A;  3KV5 A;  3IHP A;  3ZVY A;  3V43 A;  3KV6 A;  3ASL A;  3LQH A;  2VPE A;  3GV4 A;  3ZYQ A;  3O35 A;  5TDR A;  2M85 A;  2VJF B;  1Z60 A;  1Z6U A;  2VPG A;  5G0F A;  2VNF A;  2KWO A;  4AVX A;  2KFT A;  4AP4 A;  4LJN A;  1LDK C;  4P5O B;  2YUC A;  2DX8 A;  5LKX A;  3N9N A;  3N9O A;  4YAT A;  2MA5 A;  3ZPV E;  2E6R A;  3ZVZ B;  2OXQ C;  3PHD A;  2L43 A;  5AIT A;  4WZ0 A;  1WGM A;  2C2L A;  1WEW A;  2YSM A;  2F6J A;  3U5N A;  3L1Z B;  2XEU A;  2LN0 A;  3ZTG A;  1ZBD B;  3U5M A;  2QIC A;  2NAA A;  2LRI C;  2LGL A;  3O37 A;  4AYC B;  4V3K C;  5G04 B;  2YHN A;  3HCT A;  2BAY A;  5LKZ A;  1V87 A;  2K1J A;  3EB6 A;  2PNX A;  2PUY A;  1XWH A;  3N9P A;  4AYC A;  4NN2 A;  3M63 A;  2M6M A;  3RPG B;  1HYI A;  2Y1N A;  3PUR A;  5B75 A;  4FK5 A;  4A49 A;  3HTK C;  2JMI A;  1WEN A;  5JG6 A;  5KH3 A;  2ECV A;  1E4U A;  1CHC A;  3L11 A;  3NG2 A;  4IC3 A;  1RMD A;  4I7C A;  3VK6 A;  2QIZ A;  5FER A;  1WEU A;  4LK9 A;  2ECI A;  5DIN A;  2VJE B;  2M1R A;  3HCU A;  2D8S A;  4A4B A;  2MNZ A;  2YYR A;  3MHS A;  2K17 A;  2MD8 C;  4WA6 A;  2MIQ A;  5B79 A;  3SOX A;  1U6G B;  1WEM A;  1WFK A;  3LQJ A;  2CT2 A;  4ZQL A;  3U5O A;  4IC2 A;  3O33 A;  1N87 A;  1VD4 A;  4FJC A;  4LAD B;  3ZPV 1;  3DPL R;  3N9M A;  4S3O C;  4UP5 A;  4YBM A;  2KIZ A;  2L80 A;  5C11 A;  2KRE A;  4BHW A;  4L7X A;  1JM7 B;  1WEQ A;  1WEP A;  4N4F A;  3SHB A;  2Y1M A;  1WIL A;  1DVP A;  3EB5 A;  1F62 A;  2VJF A;  5KH7 A;  4R8P K;  2E6S A;  2G6Q A;  2HYE D;  2YQL A;  4GNE A;  1X4I A;  2VP7 A;  3PUQ A;  4WZ2 A;  4X3G A;  2KWJ A;  2F42 A;  4PTB A;  5EYA F;  2QJ0 A;  2MT5 A;  2YHO A;  4V3L C;  1LDJ B;  2UZG A;  4ZUX U;  1X4J A;  4MSX A;  3HCS A;  5H9M A;  5KH9 A;  2VPD A;  2Y43 A;  1VYX A;  2FUI A;  2L0B A;  1MM2 A;  3C6W A;  4GND A;  2KE1 A;  4QF3 A;  2YRE A;  2LDR A;  3FL2 A;  1WEE A;  5I3L A;  5H1V A;  5FB1 A;  5B8D A;  2K4D A;  2F6N A;  1T1H A;  3RPG C;  2CSY A;  1WE9 A;  2ECJ A;  3U5P A;  2AN6 A;  3SOW A;  2YW8 A;  3C5K A;  5TBN A;  4C9Z A;  1VFY A;  3T6R A;  1FBV A;  4GB0 A;  4Q6F A;  3M62 A;  1BOR A;  2FUU A;  2IDA A;  1WEV A;  3O36 A;  2VJE A;  5LKT A;  2C2V S;  2LXP C;  2KYU A;  5DKA A;  5J3X A;  3LQI A;  4PPE A;  4O64 A;  4CA1 A;  5LKU A;  5B78 A;  1FP0 A;  2H0D B;  4QF2 A;  4B7Y C;  2RI7 A;  2JMD A;  3RTR B;  2FSA A;  4ZDT A;  2YUR A;  2CSZ A;  2YSJ A;  2ECT A;  2LQ6 A;  4LLB A;  5D1M B;  4A4C A;  3N9L A;  3MHH A;  4FIP A;  1HYJ A;  2ZET C;  1X4U A;  1G25 A;  2EGP A;  5G05 B;  1JM7 A;  2KU3 A;  3L1X A;  5B77 A;  2MNY A;  4I7D A;  3KNV A;  4AUQ B;  4B86 C;  4MVT A;  3LRQ A;  2VPB A;  2G45 A;  2ECG A;  2G43 A;  2M3H A;  1Z2Q A;  4W4U A;  2JRJ A;  2YT5 A;  2MD7 B;  5TAB A;  4YC9 A;  2YU4 A;  3M99 A;  4LKA A;  1WES A;  4N3W A;  4BBQ A;  2MA6 A;  1WIM A;  5AIU A;  4GNF A;  5TRB A;  2RSD A;  1IYM A;  5D1K B;  2L5U A;  2LGK A;  4YBT A;  1WEO A;  2ECN A;  4UP0 A;  5H1U A;  2KGG A;  4WZ3 B;  5H1T A;  2HDP A;  3SOU A;  3ZNI A;  1JOC A;  2YQM A;  2XB1 A;  4F52 B;  2KWN A;  2K16 A;  3GL6 A;  3O70 A;  2EA6 A;  4L58 A;  2EOD A;  2MUM A;  3O7A A;  2LGG A;  4YAB A;  3I2D A;  4R7E A;  2LXH C;  4YAD A;  5TDW A;  2JMJ A;  2KGI A;  5LCW B;  4I7B A;  5C13 A;  3O34 A;  3DQV R;  4UI9 B;  2I50 A;  2ECW A;  2KR4 A;  3QZV A; 
#chains in the Genus database with same CATH topology
 5D1L B;  4XI1 A;  1MM3 A;  3LVQ E;  2DJA A;  1K2F A;  4GNG A;  4CCG X;  2KWK A;  2CKL B;  2L75 A;  4S3O B;  2H0D A;  4YBS A;  2LGV A;  3N9Q A;  5FB0 A;  4FO9 A;  4A0C D;  3T7L A;  4TKP B;  5B76 A;  2CKL A;  4YAX A;  5FEY A;  4R2Y A;  2LV9 A;  3KQI A;  3KV5 A;  3IHP A;  3ZVY A;  3V43 A;  3KV6 A;  3ASL A;  3LQH A;  2VPE A;  3GV4 A;  3ZYQ A;  3O35 A;  5TDR A;  2M85 A;  2VJF B;  4Z0O A;  1Z60 A;  1Z6U A;  2VPG A;  5G0F A;  2VNF A;  2YVR A;  2KWO A;  4AVX A;  2KFT A;  4AP4 A;  4LJN A;  1LDK C;  4P5O B;  2YUC A;  2DX8 A;  5LKX A;  3N9N A;  3N9O A;  4YAT A;  4H9D A;  2MA5 A;  3ZPV E;  2KKX A;  3O47 A;  2E6R A;  3ZVZ B;  3E2D A;  3JUE A;  2OXQ C;  3PHD A;  2L43 A;  5AIT A;  4WZ0 A;  2P57 A;  3LDY A;  1WGM A;  3H7H A;  2C2L A;  1WEW A;  2YSM A;  2F6J A;  3U5N A;  3L1Z B;  2XEU A;  2LN0 A;  3ZTG A;  1ZBD B;  3U5M A;  2QIC A;  1DCQ A;  2NAA A;  2LRI C;  2LGL A;  3O37 A;  4AYC B;  4V3K C;  5G04 B;  2YHN A;  3HCT A;  3MDB C;  2BAY A;  2MKE A;  5LKZ A;  1V87 A;  2K1J A;  3EB6 A;  2PNX A;  2PUY A;  1XWH A;  3N9P A;  4AYC A;  4NN2 A;  3M63 A;  2M6M A;  3RPG B;  1HYI A;  2Y1N A;  3PUR A;  5B75 A;  4FK5 A;  4A49 A;  3HTK C;  2JMI A;  1WEN A;  5JG6 A;  5KH3 A;  2ECV A;  2FFW A;  1E4U A;  2EGM A;  1CHC A;  3L11 A;  3NG2 A;  4IC3 A;  1RMD A;  4I7C A;  3VK6 A;  2FD4 A;  2QIZ A;  5FER A;  1WEU A;  4LK9 A;  2ECI A;  5DIN A;  2VJE B;  2M1R A;  3HCU A;  2D8S A;  3FJU B;  4A4B A;  1MBM A;  2MNZ A;  2YYR A;  3MHS A;  2K17 A;  2MD8 C;  4WA6 A;  5SVI A;  2MIQ A;  5B79 A;  2RR4 A;  3SOX A;  1U6G B;  1WEM A;  1WFK A;  3LQJ A;  4O62 A;  2CT2 A;  4ZQL A;  3Q1D A;  3U5O A;  4IC2 A;  3O33 A;  1N87 A;  1VD4 A;  4FJC A;  4LAD B;  3ZPV 1;  3DPL R;  3N9M A;  4S3O C;  4UP5 A;  4YBM A;  2KIZ A;  2L80 A;  5C11 A;  2KRE A;  3DWD A;  2CRR A;  4BHW A;  4L7X A;  1JM7 B;  1WEQ A;  2JUN A;  1WEP A;  4N4F A;  2IQJ A;  3SHB A;  2Y1M A;  1WIL A;  1DVP A;  3M7K A;  3EB5 A;  1F62 A;  2VJF A;  3DDT A;  5KH7 A;  2KKY A;  4R8P K;  2E6S A;  2G6Q A;  2HYE D;  2YQL A;  4GNE A;  1X4I A;  2VP7 A;  5SVX A;  3PUQ A;  3T9K A;  2OWA A;  3FAN A;  4WZ2 A;  2KWJ A;  4X3G A;  2F42 A;  4PTB A;  5EYA F;  2QJ0 A;  2MT5 A;  2YHO A;  4V3L C;  4OGE A;  1LDJ B;  2UZG A;  4ZUX U;  1X4J A;  4MSX A;  2XP0 A;  3HCS A;  5H9M A;  5KH9 A;  3FAO A;  2VPD A;  2Y43 A;  1VYX A;  2FUI A;  4F1P A;  2L0B A;  1MM2 A;  3C6W A;  4GND A;  2KE1 A;  4QF3 A;  2YRE A;  2LDR A;  3FL2 A;  1WEE A;  5I3L A;  3KDE C;  5H1V A;  5FB1 A;  5B8D A;  2K4D A;  2F6N A;  1T1H A;  3RPG C;  2CSY A;  1WE9 A;  2ECJ A;  3U5P A;  2AN6 A;  3SOW A;  2YW8 A;  3C5K A;  5TBN A;  4C9Z A;  1VFY A;  3T6R A;  1FBV A;  2LAU A;  4GB0 A;  4Q6F A;  3M62 A;  2CRW A;  1BOR A;  2FUU A;  2IDA A;  1WEV A;  3O36 A;  2XOZ A;  2VJE A;  5LKT A;  2C2V S;  2EXU A;  2E61 A;  2LXP C;  2KYU A;  5DKA A;  5J3X A;  3LQI A;  4PPE A;  4O64 A;  4CA1 A;  5LKU A;  5B78 A;  1FP0 A;  2H0D B;  4QF2 A;  4B7Y C;  2RI7 A;  5SVY A;  2JMD A;  3RTR B;  2FSA A;  2CSV A;  4ZDT A;  2YUR A;  2CSZ A;  2YSJ A;  2ECT A;  2LQ6 A;  3LJU X;  4LLB A;  5D1M B;  4A4C A;  3N9L A;  3MHH A;  4FIP A;  3FM8 C;  1HYJ A;  2ZET C;  1X4U A;  3FEH A;  1G25 A;  4QQ4 A;  2EGP A;  2JM3 A;  5G05 B;  1JM7 A;  2KU3 A;  3L1X A;  5B77 A;  3PLW A;  2MNY A;  4I7D A;  3KNV A;  4AUQ B;  4B86 C;  4MVT A;  2B0O E;  3LRQ A;  2VPB A;  2G45 A;  2ECG A;  2G43 A;  2M3H A;  1Z2Q A;  4W4U A;  2JRJ A;  2M13 A;  2YT5 A;  2L7P A;  2MD7 B;  2XOC A;  4Z0R A;  5TAB A;  5K3Q A;  4YC9 A;  2YU4 A;  3M99 A;  4LKA A;  1WES A;  4N3W A;  4BBQ A;  2MA6 A;  1WIM A;  5AIU A;  4GNF A;  2RSD A;  5TRB A;  1IYM A;  5D1K B;  2L5U A;  2LGK A;  4YBT A;  1WEO A;  2ECN A;  4UP0 A;  5H1U A;  2KGG A;  4WZ3 B;  5H1T A;  2HDP A;  2CON A;  3SOU A;  3ZNI A;  1JOC A;  2YQM A;  2XB1 A;  4F52 B;  2KWN A;  2D8U A;  3SUB A;  2K16 A;  3GL6 A;  3O70 A;  2EA6 A;  4L58 A;  2EOD A;  2MUM A;  3O7A A;  2LGG A;  4YAB A;  3I2D A;  4R7E A;  2LXH C;  2DSM A;  4YAD A;  5TDW A;  2JMJ A;  2KGI A;  5LCW B;  4I7B A;  3LVR E;  5C13 A;  3O34 A;  3DQV R;  4UI9 B;  4OGC A;  2I50 A;  5SVI B;  2ECW A;  2XOY A;  2KR4 A;  3QZV A; 
#chains in the Genus database with same CATH homology
 5D1L B;  4XI1 A;  1MM3 A;  1K2F A;  4GNG A;  4CCG X;  2KWK A;  2CKL B;  2L75 A;  4S3O B;  2H0D A;  4YBS A;  2LGV A;  3N9Q A;  5FB0 A;  4FO9 A;  4A0C D;  3T7L A;  4TKP B;  5B76 A;  2CKL A;  4YAX A;  5FEY A;  4R2Y A;  2LV9 A;  3KQI A;  3KV5 A;  3IHP A;  3ZVY A;  3V43 A;  3KV6 A;  3ASL A;  3LQH A;  2VPE A;  3GV4 A;  3ZYQ A;  3O35 A;  5TDR A;  2M85 A;  2VJF B;  1Z60 A;  1Z6U A;  2VPG A;  5G0F A;  2VNF A;  2KWO A;  4AVX A;  2KFT A;  4AP4 A;  4LJN A;  1LDK C;  4P5O B;  2YUC A;  2DX8 A;  5LKX A;  3N9N A;  3N9O A;  4YAT A;  2MA5 A;  3ZPV E;  2E6R A;  3ZVZ B;  2OXQ C;  3PHD A;  2L43 A;  5AIT A;  4WZ0 A;  1WGM A;  2C2L A;  1WEW A;  2YSM A;  2F6J A;  3U5N A;  3L1Z B;  2XEU A;  2LN0 A;  3ZTG A;  1ZBD B;  3U5M A;  2QIC A;  2NAA A;  2LRI C;  2LGL A;  3O37 A;  4AYC B;  4V3K C;  5G04 B;  2YHN A;  3HCT A;  2BAY A;  5LKZ A;  1V87 A;  2K1J A;  3EB6 A;  2PNX A;  2PUY A;  1XWH A;  3N9P A;  4AYC A;  4NN2 A;  3M63 A;  2M6M A;  3RPG B;  1HYI A;  2Y1N A;  3PUR A;  5B75 A;  4FK5 A;  4A49 A;  3HTK C;  2JMI A;  1WEN A;  5JG6 A;  5KH3 A;  2ECV A;  1E4U A;  1CHC A;  3L11 A;  3NG2 A;  4IC3 A;  1RMD A;  4I7C A;  3VK6 A;  2QIZ A;  5FER A;  1WEU A;  4LK9 A;  2ECI A;  5DIN A;  2VJE B;  2M1R A;  3HCU A;  2D8S A;  4A4B A;  2MNZ A;  2YYR A;  3MHS A;  2K17 A;  2MD8 C;  4WA6 A;  2MIQ A;  5B79 A;  3SOX A;  1U6G B;  1WEM A;  1WFK A;  3LQJ A;  2CT2 A;  4ZQL A;  3U5O A;  4IC2 A;  3O33 A;  1N87 A;  1VD4 A;  4FJC A;  4LAD B;  3ZPV 1;  3DPL R;  3N9M A;  4S3O C;  4UP5 A;  4YBM A;  2KIZ A;  2L80 A;  5C11 A;  2KRE A;  4BHW A;  4L7X A;  1JM7 B;  1WEQ A;  1WEP A;  4N4F A;  3SHB A;  2Y1M A;  1WIL A;  1DVP A;  3EB5 A;  1F62 A;  2VJF A;  5KH7 A;  4R8P K;  2E6S A;  2G6Q A;  2HYE D;  2YQL A;  4GNE A;  1X4I A;  2VP7 A;  3PUQ A;  4WZ2 A;  4X3G A;  2KWJ A;  2F42 A;  4PTB A;  5EYA F;  2QJ0 A;  2MT5 A;  2YHO A;  4V3L C;  1LDJ B;  2UZG A;  4ZUX U;  1X4J A;  4MSX A;  3HCS A;  5H9M A;  5KH9 A;  2VPD A;  2Y43 A;  1VYX A;  2FUI A;  2L0B A;  1MM2 A;  3C6W A;  4GND A;  2KE1 A;  4QF3 A;  2YRE A;  2LDR A;  3FL2 A;  1WEE A;  5I3L A;  5H1V A;  5FB1 A;  5B8D A;  2K4D A;  2F6N A;  1T1H A;  3RPG C;  2CSY A;  1WE9 A;  2ECJ A;  3U5P A;  2AN6 A;  3SOW A;  2YW8 A;  3C5K A;  5TBN A;  4C9Z A;  1VFY A;  3T6R A;  1FBV A;  4GB0 A;  4Q6F A;  3M62 A;  1BOR A;  2FUU A;  2IDA A;  1WEV A;  3O36 A;  2VJE A;  5LKT A;  2C2V S;  2LXP C;  2KYU A;  5DKA A;  5J3X A;  3LQI A;  4PPE A;  4O64 A;  4CA1 A;  5LKU A;  5B78 A;  1FP0 A;  2H0D B;  4QF2 A;  4B7Y C;  2RI7 A;  2JMD A;  3RTR B;  2FSA A;  4ZDT A;  2YUR A;  2CSZ A;  2YSJ A;  2ECT A;  2LQ6 A;  4LLB A;  5D1M B;  4A4C A;  3N9L A;  3MHH A;  4FIP A;  1HYJ A;  2ZET C;  1X4U A;  1G25 A;  2EGP A;  5G05 B;  1JM7 A;  2KU3 A;  3L1X A;  5B77 A;  2MNY A;  4I7D A;  3KNV A;  4AUQ B;  4B86 C;  4MVT A;  3LRQ A;  2VPB A;  2G45 A;  2ECG A;  2G43 A;  2M3H A;  1Z2Q A;  4W4U A;  2JRJ A;  2YT5 A;  2MD7 B;  5TAB A;  4YC9 A;  2YU4 A;  3M99 A;  4LKA A;  1WES A;  4N3W A;  4BBQ A;  2MA6 A;  1WIM A;  5AIU A;  4GNF A;  5TRB A;  2RSD A;  1IYM A;  5D1K B;  2L5U A;  2LGK A;  4YBT A;  1WEO A;  2ECN A;  4UP0 A;  5H1U A;  2KGG A;  4WZ3 B;  5H1T A;  2HDP A;  3SOU A;  3ZNI A;  1JOC A;  2YQM A;  2XB1 A;  4F52 B;  2KWN A;  2K16 A;  3GL6 A;  3O70 A;  2EA6 A;  4L58 A;  2EOD A;  2MUM A;  3O7A A;  2LGG A;  4YAB A;  3I2D A;  4R7E A;  2LXH C;  4YAD A;  5TDW A;  2JMJ A;  2KGI A;  5LCW B;  4I7B A;  5C13 A;  3O34 A;  3DQV R;  4UI9 B;  2I50 A;  2ECW A;  2KR4 A;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...