1WGMA

Solution structure of the u-box in human ubiquitin conjugation factor e4a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the U-box in human ubiquitin conjugation factor E4A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin conjugation factor E4A
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wgmA01
2DX8A 3N9OA 5H1UA 2RI7A 1FP0A 5AIUA 2VPEA 1RMDA 5EYAF 2VPGA 5JG6A 2Y1MA 5TBNA 1VYXA 3KV5A 2PNXA 2ECIA 2KFTA 3KV6A 2M6MA 2M3HA 3PUQA 2K16A 3PURA 2Y43A 5AITA 4LK9A 2YSMA 1WEVA 3N9PA 3U5MA 1BORA 2CKLA 2K4DA 1WENA 4GNDA 3O37A 4XI1A 2KE1A 3M63A 4Q6FA 2LGLA 2H0DB 3LQJA 2MD8C 5B79A 2LDRA 3SOXA 1WEOA 2JRJA 5D1LB 2F42A 4AVXA 2F6JA 3ZTGA 2QIZA 4L58A 4PPEA 4A0CD 2LGKA 1Z60A 3QZVA 4YBSA 3V43A 1CHCA 3C5KA 2YT5A 1WESA 3NG2A 2VJEB 4ZQLA 2D8SA 3GL6A 2YHNA 2I50A 4AUQB 3U5OA 1FBVA 3HTKC 3HCSA 4P5OB 5TDWA 2ECWA 2AN6A 2MIQA 3O33A 5LKZA 5DINA 5KH3A 4PTBA 2KYUA 5J3XA 2FSAA 2JMDA 5I3LA 2VNFA 2KGGA 5G0FA 1JOCA 1HYJA 5FB0A 4I7BA 4R8PK 4IC3A 2ECJA 4UP0A 2VJFB 4I7CA 2KWOA 2MA6A 2YHOA 2L43A 3L11A 3N9MA 5C13A 4YATA 4BBQA 2Y1NA 4BHWA 1K2FA 2MA5A 2EA6A 4YADA 2KWJA 2EGPA 4UI9B 3U5PA 1WEQA 1MM3A 2BAYA 2YYRA 2MUMA 4QF3A 4A49A 3EB6A 1WFKA 3RPGB 3HCUA 4R2YA 4W4UA 2L5UA 1WEPA 4MVTA 1MM2A 1LDJB 3I2DA 1HYIA 3GV4A 4V3LC 4A4CA 4AYCA 2M1RA 3N9QA 2L0BA 2YU4A 1VFYA 2ZETC 4S3OC 4LADB 2KR4A 4LKAA 4L7XA 4N3WA 1WEEA 5C11A 1ZBDB 3RPGC 2LXHC 2HYED 2MD7B 5B77A 3N9NA 2LN0A 2M85A 3IHPA 4WZ3B 5G05B 2ECVA 2YREA 2LXPC 5KH9A 1N87A 4WZ2A 4YC9A 5LKUA 5KH7A 4B7YC 1U6GB 3SHBA 4CCGX 2VPDA 2L75A 4R7EA 2E6SA 2LV9A 3ZYQA 2RSDA 1JM7A 5LCWB 2OXQC 3ZVYA 5G04B 2KWNA 3T6RA 4GNEA 2UZGA 2G43A 2C2LA 2ECTA 1WEMA 5H1TA 1WILA 2YW8A 2LGGA 2YQMA 1WEUA 2KWKA 1G25A 4AP4A 4B86C 2CKLB 4YBMA 1DVPA 4A4BA 2K1JA 4MSXA 3ZPV1 4LLBA 2PUYA 4N4FA 5B8DA 4QF2A 5LKXA 4UP5A 1X4IA 2ECGA 4I7DA 2L80A 2FUIA 3KNVA 4ZDTA 5B75A 1VD4A 2KREA 4TKPB 2YQLA 1WGMA 1Z2QA 1V87A 4C9ZA 4GB0A 4F52B 2JMIA 3LQHA 3L1ZB 2VP7A 3DQVR 3M62A 2YURA 3DPLR 3LQIA 2JMJA 3C6WA 3KQIA 2LQ6A 5FB1A 4FO9A 4X3GA 1WE9A 4GNGA 3PHDA 4YAXA 5B76A 4ZUXU 5H1VA 2ECNA 2VJEA 3MHSA 2E6RA 2QICA 1XWHA 2F6NA 2YUCA 2H0DA 2KU3A 3O36A 5FERA 1X4UA 1Z6UA 3ZNIA 3N9LA 3T7LA 5TDRA 4FK5A 5H9MA 2MT5A 2CSZA 3O34A 3U5NA 1T1HA 3EB5A 2KIZA 3O70A 4V3KC 4WZ0A 3ZPVE 3VK6A 2XEUA 4CA1A 2G6QA 2LGVA 2IDAA 2YSJA 5TABA 1E4UA 3LRQA 4WA6A 1JM7B 4FIPA 4AYCB 2HDPA 2MNYA 3FL2A 4YABA 5DKAA 2QJ0A 4GNFA 5D1KB 2K17A 4LJNA 4IC2A 3L1XA 3RTRB 2KGIA 1IYMA 2VPBA 2CSYA 4S3OB 3ZVZB 2G45A 3MHHA 2CT2A 1WEWA 4NN2A 1LDKC 3ASLA 2EODA 3O7AA 5FEYA 5B78A 1F62A 2NAAA 5TRBA 2XB1A 4YBTA 3M99A 3SOWA 2C2VS 1WIMA 5LKTA 3O35A 2FUUA 3HCTA 2VJFA 2MNZA 4O64A 2LRIC 1X4JA 5D1MB 3SOUA 4FJCA
chains in the Genus database with same CATH superfamily
2DX8A 3N9OA 5H1UA 2RI7A 1FP0A 5AIUA 2EXUA 4O62A 5SVIA 2VPEA 1RMDA 5EYAF 2VPGA 5JG6A 2Y1MA 3SUBA 5TBNA 1VYXA 3KV5A 4H9DA 4OGEA 2PNXA 2ECIA 2KFTA 4OGCA 3KV6A 3FAOA 2M6MA 2M3HA 3PUQA 2K16A 3PURA 2Y43A 5AITA 4LK9A 2YSMA 1WEVA 3N9PA 3U5MA 2XOYA 1BORA 2CKLA 2K4DA 1WENA 4GNDA 3O37A 4XI1A 2KE1A 3M63A 4Q6FA 2LGLA 4Z0RA 2H0DB 3LQJA 2LAUA 2MD8C 5B79A 2LDRA 3SOXA 1WEOA 2JRJA 5D1LB 2F42A 4AVXA 2F6JA 3ZTGA 2QIZA 4L58A 4PPEA 5K3QA 4A0CD 2LGKA 1Z60A 3QZVA 1CHCA 3V43A 4YBSA 3C5KA 2MKEA 2YT5A 1WESA 3NG2A 2VJEB 4ZQLA 2D8SA 3GL6A 2YHNA 2I50A 4AUQB 3U5OA 1FBVA 3HTKC 3HCSA 4P5OB 5TDWA 2ECWA 2AN6A 2MIQA 3O33A 5LKZA 5DINA 5KH3A 4PTBA 3M7KA 2KYUA 3LVRE 3Q1DA 5J3XA 2FSAA 2JMDA 5I3LA 2VNFA 2KGGA 1JOCA 5G0FA 1HYJA 5FB0A 4I7BA 4R8PK 4IC3A 2ECJA 2OWAA 4UP0A 2VJFB 2DJAA 4I7CA 2KWOA 2MA6A 2XP0A 2YHOA 2L43A 3L11A 3N9MA 5C13A 4YATA 4BBQA 2Y1NA 4BHWA 1K2FA 2MA5A 2EA6A 4YADA 2XOZA 2KWJA 2EGPA 4UI9B 3U5PA 1WEQA 1MM3A 2BAYA 2YYRA 2MUMA 4QF3A 4A49A 3EB6A 1WFKA 3RPGB 3HCUA 4R2YA 4W4UA 2L5UA 1WEPA 2XOCA 4MVTA 1MM2A 2DSMA 1LDJB 3MDBC 3I2DA 1HYIA 2JM3A 3GV4A 4V3LC 4A4CA 4AYCA 2M1RA 3N9QA 2L0BA 2YU4A 1VFYA 3LJUX 2ZETC 4S3OC 4F1PA 4LADB 2KR4A 4LKAA 4L7XA 4N3WA 2FD4A 1WEEA 5C11A 1ZBDB 3RPGC 2LXHC 2HYED 4Z0OA 2MD7B 5B77A 3N9NA 2LN0A 2M85A 3IHPA 4WZ3B 5G05B 2ECVA 2YREA 2LXPC 5KH9A 1N87A 4WZ2A 4YC9A 5LKUA 5KH7A 4B7YC 1U6GB 3PLWA 3SHBA 3FJUB 2VPDA 2L75A 4CCGX 4R7EA 2E6SA 2LV9A 3ZYQA 2RSDA 1JM7A 5LCWB 2CRRA 2OXQC 2D8UA 3ZVYA 5G04B 2KWNA 3T6RA 4GNEA 2UZGA 2YVRA 3LDYA 2G43A 2C2LA 2ECTA 2JUNA 1WEMA 5H1TA 2RR4A 1WILA 2YW8A 2LGGA 2YQMA 2M13A 1WEUA 3FANA 2KWKA 2KKXA 3KDEC 1G25A 4AP4A 4B86C 2CKLB 2KKYA 3DDTA 3DWDA 4YBMA 4QQ4A 2E61A 1DVPA 4MSXA 2K1JA 3ZPV1 4A4BA 4LLBA 2PUYA 4N4FA 5B8DA 2B0OE 4QF2A 5LKXA 4UP5A 1X4IA 2ECGA 1MBMA 4I7DA 2L80A 2FUIA 3KNVA 2L7PA 4ZDTA 5B75A 1DCQA 1VD4A 2KREA 4TKPB 2YQLA 1WGMA 1Z2QA 1V87A 4C9ZA 4GB0A 3LQHA 2JMIA 4F52B 2CRWA 3L1ZB 2VP7A 3DQVR 2CONA 3M62A 2YURA 3DPLR 3LQIA 2JMJA 3C6WA 3KQIA 2LQ6A 5FB1A 4FO9A 4X3GA 1WE9A 4GNGA 3PHDA 4YAXA 5B76A 3T9KA 4ZUXU 5H1VA 2ECNA 2VJEA 3MHSA 2E6RA 2QICA 1XWHA 2F6NA 5SVXA 2YUCA 2H0DA 2KU3A 3O36A 5FERA 1X4UA 1Z6UA 3JUEA 3ZNIA 3N9LA 3O47A 3T7LA 5TDRA 4FK5A 2EGMA 5H9MA 2MT5A 2CSZA 3O34A 3U5NA 1T1HA 3EB5A 2KIZA 3O70A 4V3KC 4WZ0A 5SVIB 3ZPVE 3VK6A 2XEUA 4CA1A 2G6QA 3LVQE 2LGVA 3FM8C 2IDAA 3H7HA 2YSJA 5TABA 1E4UA 3LRQA 4WA6A 1JM7B 4FIPA 2CSVA 4AYCB 2HDPA 2MNYA 3FL2A 4YABA 5DKAA 2QJ0A 4GNFA 5D1KB 2K17A 4LJNA 4IC2A 3L1XA 3RTRB 2KGIA 1IYMA 2VPBA 2CSYA 4S3OB 3ZVZB 2G45A 3MHHA 2CT2A 1WEWA 2FFWA 4NN2A 2P57A 1LDKC 3ASLA 2EODA 3O7AA 5FEYA 5B78A 1F62A 2NAAA 5TRBA 3FEHA 2IQJA 5SVYA 2XB1A 4YBTA 3M99A 3SOWA 2C2VS 1WIMA 5LKTA 3O35A 2FUUA 3HCTA 2VJFA 3E2DA 2MNZA 4O64A 2LRIC 1X4JA 5D1MB 3SOUA 4FJCA
chains in the Genus database with same CATH topology
2DX8A 3N9OA 5H1UA 2RI7A 1FP0A 5AIUA 2VPEA 1RMDA 5EYAF 2VPGA 5JG6A 2Y1MA 5TBNA 1VYXA 3KV5A 2PNXA 2ECIA 2KFTA 3KV6A 2M6MA 2M3HA 3PUQA 2K16A 3PURA 2Y43A 5AITA 4LK9A 2YSMA 1WEVA 3N9PA 3U5MA 1BORA 2CKLA 2K4DA 1WENA 4GNDA 3O37A 4XI1A 2KE1A 3M63A 4Q6FA 2LGLA 2H0DB 3LQJA 2MD8C 5B79A 2LDRA 3SOXA 1WEOA 2JRJA 5D1LB 2F42A 4AVXA 2F6JA 3ZTGA 2QIZA 4L58A 4PPEA 4A0CD 2LGKA 1Z60A 3QZVA 4YBSA 3V43A 1CHCA 3C5KA 2YT5A 1WESA 3NG2A 2VJEB 4ZQLA 2D8SA 3GL6A 2YHNA 2I50A 4AUQB 3U5OA 1FBVA 3HTKC 3HCSA 4P5OB 5TDWA 2ECWA 2AN6A 2MIQA 3O33A 5LKZA 5DINA 5KH3A 4PTBA 2KYUA 5J3XA 2FSAA 2JMDA 5I3LA 2VNFA 2KGGA 5G0FA 1JOCA 1HYJA 5FB0A 4I7BA 4R8PK 4IC3A 2ECJA 4UP0A 2VJFB 4I7CA 2KWOA 2MA6A 2YHOA 2L43A 3L11A 3N9MA 5C13A 4YATA 4BBQA 2Y1NA 4BHWA 1K2FA 2MA5A 2EA6A 4YADA 2KWJA 2EGPA 4UI9B 3U5PA 1WEQA 1MM3A 2BAYA 2YYRA 2MUMA 4QF3A 4A49A 3EB6A 1WFKA 3RPGB 3HCUA 4R2YA 4W4UA 2L5UA 1WEPA 4MVTA 1MM2A 1LDJB 3I2DA 1HYIA 3GV4A 4V3LC 4A4CA 4AYCA 2M1RA 3N9QA 2L0BA 2YU4A 1VFYA 2ZETC 4S3OC 4LADB 2KR4A 4LKAA 4L7XA 4N3WA 1WEEA 5C11A 1ZBDB 3RPGC 2LXHC 2HYED 2MD7B 5B77A 3N9NA 2LN0A 2M85A 3IHPA 4WZ3B 5G05B 2ECVA 2YREA 2LXPC 5KH9A 1N87A 4WZ2A 4YC9A 5LKUA 5KH7A 4B7YC 1U6GB 3SHBA 4CCGX 2VPDA 2L75A 4R7EA 2E6SA 2LV9A 3ZYQA 2RSDA 1JM7A 5LCWB 2OXQC 3ZVYA 5G04B 2KWNA 3T6RA 4GNEA 2UZGA 2G43A 2C2LA 2ECTA 1WEMA 5H1TA 1WILA 2YW8A 2LGGA 2YQMA 1WEUA 2KWKA 1G25A 4AP4A 4B86C 2CKLB 4YBMA 1DVPA 4A4BA 2K1JA 4MSXA 3ZPV1 4LLBA 2PUYA 4N4FA 5B8DA 4QF2A 5LKXA 4UP5A 1X4IA 2ECGA 4I7DA 2L80A 2FUIA 3KNVA 4ZDTA 5B75A 1VD4A 2KREA 4TKPB 2YQLA 1WGMA 1Z2QA 1V87A 4C9ZA 4GB0A 4F52B 2JMIA 3LQHA 3L1ZB 2VP7A 3DQVR 3M62A 2YURA 3DPLR 3LQIA 2JMJA 3C6WA 3KQIA 2LQ6A 5FB1A 4FO9A 4X3GA 1WE9A 4GNGA 3PHDA 4YAXA 5B76A 4ZUXU 5H1VA 2ECNA 2VJEA 3MHSA 2E6RA 2QICA 1XWHA 2F6NA 2YUCA 2H0DA 2KU3A 3O36A 5FERA 1X4UA 1Z6UA 3ZNIA 3N9LA 3T7LA 5TDRA 4FK5A 5H9MA 2MT5A 2CSZA 3O34A 3U5NA 1T1HA 3EB5A 2KIZA 3O70A 4V3KC 4WZ0A 3ZPVE 3VK6A 2XEUA 4CA1A 2G6QA 2LGVA 2IDAA 2YSJA 5TABA 1E4UA 3LRQA 4WA6A 1JM7B 4FIPA 4AYCB 2HDPA 2MNYA 3FL2A 4YABA 5DKAA 2QJ0A 4GNFA 5D1KB 2K17A 4LJNA 4IC2A 3L1XA 3RTRB 2KGIA 1IYMA 2VPBA 2CSYA 4S3OB 3ZVZB 2G45A 3MHHA 2CT2A 1WEWA 4NN2A 1LDKC 3ASLA 2EODA 3O7AA 5FEYA 5B78A 1F62A 2NAAA 5TRBA 2XB1A 4YBTA 3M99A 3SOWA 2C2VS 1WIMA 5LKTA 3O35A 2FUUA 3HCTA 2VJFA 2MNZA 4O64A 2LRIC 1X4JA 5D1MB 3SOUA 4FJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX8 A;  3N9O A;  5H1U A;  2RI7 A;  1FP0 A;  5AIU A;  2VPE A;  1RMD A;  5EYA F;  2VPG A;  5JG6 A;  2Y1M A;  5TBN A;  1VYX A;  3KV5 A;  2PNX A;  2ECI A;  2KFT A;  3KV6 A;  2M6M A;  2M3H A;  3PUQ A;  2K16 A;  3PUR A;  2Y43 A;  5AIT A;  4LK9 A;  2YSM A;  1WEV A;  3N9P A;  3U5M A;  1BOR A;  2CKL A;  2K4D A;  1WEN A;  4GND A;  3O37 A;  4XI1 A;  2KE1 A;  3M63 A;  4Q6F A;  2LGL A;  2H0D B;  3LQJ A;  2MD8 C;  5B79 A;  2LDR A;  3SOX A;  1WEO A;  2JRJ A;  5D1L B;  2F42 A;  4AVX A;  2F6J A;  3ZTG A;  2QIZ A;  4L58 A;  4PPE A;  4A0C D;  2LGK A;  1Z60 A;  3QZV A;  4YBS A;  3V43 A;  1CHC A;  3C5K A;  2YT5 A;  1WES A;  3NG2 A;  2VJE B;  4ZQL A;  2D8S A;  3GL6 A;  2YHN A;  2I50 A;  4AUQ B;  3U5O A;  1FBV A;  3HTK C;  3HCS A;  4P5O B;  5TDW A;  2ECW A;  2AN6 A;  2MIQ A;  3O33 A;  5LKZ A;  5DIN A;  5KH3 A;  4PTB A;  2KYU A;  5J3X A;  2FSA A;  2JMD A;  5I3L A;  2VNF A;  2KGG A;  5G0F A;  1JOC A;  1HYJ A;  5FB0 A;  4I7B A;  4R8P K;  4IC3 A;  2ECJ A;  4UP0 A;  2VJF B;  4I7C A;  2KWO A;  2MA6 A;  2YHO A;  2L43 A;  3L11 A;  3N9M A;  5C13 A;  4YAT A;  4BBQ A;  2Y1N A;  4BHW A;  1K2F A;  2MA5 A;  2EA6 A;  4YAD A;  2KWJ A;  2EGP A;  4UI9 B;  3U5P A;  1WEQ A;  1MM3 A;  2BAY A;  2YYR A;  2MUM A;  4QF3 A;  4A49 A;  3EB6 A;  1WFK A;  3RPG B;  3HCU A;  4R2Y A;  4W4U A;  2L5U A;  1WEP A;  4MVT A;  1MM2 A;  1LDJ B;  3I2D A;  1HYI A;  3GV4 A;  4V3L C;  4A4C A;  4AYC A;  2M1R A;  3N9Q A;  2L0B A;  2YU4 A;  1VFY A;  2ZET C;  4S3O C;  4LAD B;  2KR4 A;  4LKA A;  4L7X A;  4N3W A;  1WEE A;  5C11 A;  1ZBD B;  3RPG C;  2LXH C;  2HYE D;  2MD7 B;  5B77 A;  3N9N A;  2LN0 A;  2M85 A;  3IHP A;  4WZ3 B;  5G05 B;  2ECV A;  2YRE A;  2LXP C;  5KH9 A;  1N87 A;  4WZ2 A;  4YC9 A;  5LKU A;  5KH7 A;  4B7Y C;  1U6G B;  3SHB A;  4CCG X;  2VPD A;  2L75 A;  4R7E A;  2E6S A;  2LV9 A;  3ZYQ A;  2RSD A;  1JM7 A;  5LCW B;  2OXQ C;  3ZVY A;  5G04 B;  2KWN A;  3T6R A;  4GNE A;  2UZG A;  2G43 A;  2C2L A;  2ECT A;  1WEM A;  5H1T A;  1WIL A;  2YW8 A;  2LGG A;  2YQM A;  1WEU A;  2KWK A;  1G25 A;  4AP4 A;  4B86 C;  2CKL B;  4YBM A;  1DVP A;  4A4B A;  2K1J A;  4MSX A;  3ZPV 1;  4LLB A;  2PUY A;  4N4F A;  5B8D A;  4QF2 A;  5LKX A;  4UP5 A;  1X4I A;  2ECG A;  4I7D A;  2L80 A;  2FUI A;  3KNV A;  4ZDT A;  5B75 A;  1VD4 A;  2KRE A;  4TKP B;  2YQL A;  1WGM A;  1Z2Q A;  1V87 A;  4C9Z A;  4GB0 A;  4F52 B;  2JMI A;  3LQH A;  3L1Z B;  2VP7 A;  3DQV R;  3M62 A;  2YUR A;  3DPL R;  3LQI A;  2JMJ A;  3C6W A;  3KQI A;  2LQ6 A;  5FB1 A;  4FO9 A;  4X3G A;  1WE9 A;  4GNG A;  3PHD A;  4YAX A;  5B76 A;  4ZUX U;  5H1V A;  2ECN A;  2VJE A;  3MHS A;  2E6R A;  2QIC A;  1XWH A;  2F6N A;  2YUC A;  2H0D A;  2KU3 A;  3O36 A;  5FER A;  1X4U A;  1Z6U A;  3ZNI A;  3N9L A;  3T7L A;  5TDR A;  4FK5 A;  5H9M A;  2MT5 A;  2CSZ A;  3O34 A;  3U5N A;  1T1H A;  3EB5 A;  2KIZ A;  3O70 A;  4V3K C;  4WZ0 A;  3ZPV E;  3VK6 A;  2XEU A;  4CA1 A;  2G6Q A;  2LGV A;  2IDA A;  2YSJ A;  5TAB A;  1E4U A;  3LRQ A;  4WA6 A;  1JM7 B;  4FIP A;  4AYC B;  2HDP A;  2MNY A;  3FL2 A;  4YAB A;  5DKA A;  2QJ0 A;  4GNF A;  5D1K B;  2K17 A;  4LJN A;  4IC2 A;  3L1X A;  3RTR B;  2KGI A;  1IYM A;  2VPB A;  2CSY A;  4S3O B;  3ZVZ B;  2G45 A;  3MHH A;  2CT2 A;  1WEW A;  4NN2 A;  1LDK C;  3ASL A;  2EOD A;  3O7A A;  5FEY A;  5B78 A;  1F62 A;  2NAA A;  5TRB A;  2XB1 A;  4YBT A;  3M99 A;  3SOW A;  2C2V S;  1WIM A;  5LKT A;  3O35 A;  2FUU A;  3HCT A;  2VJF A;  2MNZ A;  4O64 A;  2LRI C;  1X4J A;  5D1M B;  3SOU A;  4FJC A; 
#chains in the Genus database with same CATH topology
 2DX8 A;  3N9O A;  5H1U A;  2RI7 A;  1FP0 A;  5AIU A;  2EXU A;  4O62 A;  5SVI A;  2VPE A;  1RMD A;  5EYA F;  2VPG A;  5JG6 A;  2Y1M A;  3SUB A;  5TBN A;  1VYX A;  3KV5 A;  4H9D A;  4OGE A;  2PNX A;  2ECI A;  2KFT A;  4OGC A;  3KV6 A;  3FAO A;  2M6M A;  2M3H A;  3PUQ A;  2K16 A;  3PUR A;  2Y43 A;  5AIT A;  4LK9 A;  2YSM A;  1WEV A;  3N9P A;  3U5M A;  2XOY A;  1BOR A;  2CKL A;  2K4D A;  1WEN A;  4GND A;  3O37 A;  4XI1 A;  2KE1 A;  3M63 A;  4Q6F A;  2LGL A;  4Z0R A;  2H0D B;  3LQJ A;  2LAU A;  2MD8 C;  5B79 A;  2LDR A;  3SOX A;  1WEO A;  2JRJ A;  5D1L B;  2F42 A;  4AVX A;  2F6J A;  3ZTG A;  2QIZ A;  4L58 A;  4PPE A;  5K3Q A;  4A0C D;  2LGK A;  1Z60 A;  3QZV A;  1CHC A;  3V43 A;  4YBS A;  3C5K A;  2MKE A;  2YT5 A;  1WES A;  3NG2 A;  2VJE B;  4ZQL A;  2D8S A;  3GL6 A;  2YHN A;  2I50 A;  4AUQ B;  3U5O A;  1FBV A;  3HTK C;  3HCS A;  4P5O B;  5TDW A;  2ECW A;  2AN6 A;  2MIQ A;  3O33 A;  5LKZ A;  5DIN A;  5KH3 A;  4PTB A;  3M7K A;  2KYU A;  3LVR E;  3Q1D A;  5J3X A;  2FSA A;  2JMD A;  5I3L A;  2VNF A;  2KGG A;  1JOC A;  5G0F A;  1HYJ A;  5FB0 A;  4I7B A;  4R8P K;  4IC3 A;  2ECJ A;  2OWA A;  4UP0 A;  2VJF B;  2DJA A;  4I7C A;  2KWO A;  2MA6 A;  2XP0 A;  2YHO A;  2L43 A;  3L11 A;  3N9M A;  5C13 A;  4YAT A;  4BBQ A;  2Y1N A;  4BHW A;  1K2F A;  2MA5 A;  2EA6 A;  4YAD A;  2XOZ A;  2KWJ A;  2EGP A;  4UI9 B;  3U5P A;  1WEQ A;  1MM3 A;  2BAY A;  2YYR A;  2MUM A;  4QF3 A;  4A49 A;  3EB6 A;  1WFK A;  3RPG B;  3HCU A;  4R2Y A;  4W4U A;  2L5U A;  1WEP A;  2XOC A;  4MVT A;  1MM2 A;  2DSM A;  1LDJ B;  3MDB C;  3I2D A;  1HYI A;  2JM3 A;  3GV4 A;  4V3L C;  4A4C A;  4AYC A;  2M1R A;  3N9Q A;  2L0B A;  2YU4 A;  1VFY A;  3LJU X;  2ZET C;  4S3O C;  4F1P A;  4LAD B;  2KR4 A;  4LKA A;  4L7X A;  4N3W A;  2FD4 A;  1WEE A;  5C11 A;  1ZBD B;  3RPG C;  2LXH C;  2HYE D;  4Z0O A;  2MD7 B;  5B77 A;  3N9N A;  2LN0 A;  2M85 A;  3IHP A;  4WZ3 B;  5G05 B;  2ECV A;  2YRE A;  2LXP C;  5KH9 A;  1N87 A;  4WZ2 A;  4YC9 A;  5LKU A;  5KH7 A;  4B7Y C;  1U6G B;  3PLW A;  3SHB A;  3FJU B;  2VPD A;  2L75 A;  4CCG X;  4R7E A;  2E6S A;  2LV9 A;  3ZYQ A;  2RSD A;  1JM7 A;  5LCW B;  2CRR A;  2OXQ C;  2D8U A;  3ZVY A;  5G04 B;  2KWN A;  3T6R A;  4GNE A;  2UZG A;  2YVR A;  3LDY A;  2G43 A;  2C2L A;  2ECT A;  2JUN A;  1WEM A;  5H1T A;  2RR4 A;  1WIL A;  2YW8 A;  2LGG A;  2YQM A;  2M13 A;  1WEU A;  3FAN A;  2KWK A;  2KKX A;  3KDE C;  1G25 A;  4AP4 A;  4B86 C;  2CKL B;  2KKY A;  3DDT A;  3DWD A;  4YBM A;  4QQ4 A;  2E61 A;  1DVP A;  4MSX A;  2K1J A;  3ZPV 1;  4A4B A;  4LLB A;  2PUY A;  4N4F A;  5B8D A;  2B0O E;  4QF2 A;  5LKX A;  4UP5 A;  1X4I A;  2ECG A;  1MBM A;  4I7D A;  2L80 A;  2FUI A;  3KNV A;  2L7P A;  4ZDT A;  5B75 A;  1DCQ A;  1VD4 A;  2KRE A;  4TKP B;  2YQL A;  1WGM A;  1Z2Q A;  1V87 A;  4C9Z A;  4GB0 A;  3LQH A;  2JMI A;  4F52 B;  2CRW A;  3L1Z B;  2VP7 A;  3DQV R;  2CON A;  3M62 A;  2YUR A;  3DPL R;  3LQI A;  2JMJ A;  3C6W A;  3KQI A;  2LQ6 A;  5FB1 A;  4FO9 A;  4X3G A;  1WE9 A;  4GNG A;  3PHD A;  4YAX A;  5B76 A;  3T9K A;  4ZUX U;  5H1V A;  2ECN A;  2VJE A;  3MHS A;  2E6R A;  2QIC A;  1XWH A;  2F6N A;  5SVX A;  2YUC A;  2H0D A;  2KU3 A;  3O36 A;  5FER A;  1X4U A;  1Z6U A;  3JUE A;  3ZNI A;  3N9L A;  3O47 A;  3T7L A;  5TDR A;  4FK5 A;  2EGM A;  5H9M A;  2MT5 A;  2CSZ A;  3O34 A;  3U5N A;  1T1H A;  3EB5 A;  2KIZ A;  3O70 A;  4V3K C;  4WZ0 A;  5SVI B;  3ZPV E;  3VK6 A;  2XEU A;  4CA1 A;  2G6Q A;  3LVQ E;  2LGV A;  3FM8 C;  2IDA A;  3H7H A;  2YSJ A;  5TAB A;  1E4U A;  3LRQ A;  4WA6 A;  1JM7 B;  4FIP A;  2CSV A;  4AYC B;  2HDP A;  2MNY A;  3FL2 A;  4YAB A;  5DKA A;  2QJ0 A;  4GNF A;  5D1K B;  2K17 A;  4LJN A;  4IC2 A;  3L1X A;  3RTR B;  2KGI A;  1IYM A;  2VPB A;  2CSY A;  4S3O B;  3ZVZ B;  2G45 A;  3MHH A;  2CT2 A;  1WEW A;  2FFW A;  4NN2 A;  2P57 A;  1LDK C;  3ASL A;  2EOD A;  3O7A A;  5FEY A;  5B78 A;  1F62 A;  2NAA A;  5TRB A;  3FEH A;  2IQJ A;  5SVY A;  2XB1 A;  4YBT A;  3M99 A;  3SOW A;  2C2V S;  1WIM A;  5LKT A;  3O35 A;  2FUU A;  3HCT A;  2VJF A;  3E2D A;  2MNZ A;  4O64 A;  2LRI C;  1X4J A;  5D1M B;  3SOU A;  4FJC A; 
#chains in the Genus database with same CATH homology
 2DX8 A;  3N9O A;  5H1U A;  2RI7 A;  1FP0 A;  5AIU A;  2VPE A;  1RMD A;  5EYA F;  2VPG A;  5JG6 A;  2Y1M A;  5TBN A;  1VYX A;  3KV5 A;  2PNX A;  2ECI A;  2KFT A;  3KV6 A;  2M6M A;  2M3H A;  3PUQ A;  2K16 A;  3PUR A;  2Y43 A;  5AIT A;  4LK9 A;  2YSM A;  1WEV A;  3N9P A;  3U5M A;  1BOR A;  2CKL A;  2K4D A;  1WEN A;  4GND A;  3O37 A;  4XI1 A;  2KE1 A;  3M63 A;  4Q6F A;  2LGL A;  2H0D B;  3LQJ A;  2MD8 C;  5B79 A;  2LDR A;  3SOX A;  1WEO A;  2JRJ A;  5D1L B;  2F42 A;  4AVX A;  2F6J A;  3ZTG A;  2QIZ A;  4L58 A;  4PPE A;  4A0C D;  2LGK A;  1Z60 A;  3QZV A;  4YBS A;  3V43 A;  1CHC A;  3C5K A;  2YT5 A;  1WES A;  3NG2 A;  2VJE B;  4ZQL A;  2D8S A;  3GL6 A;  2YHN A;  2I50 A;  4AUQ B;  3U5O A;  1FBV A;  3HTK C;  3HCS A;  4P5O B;  5TDW A;  2ECW A;  2AN6 A;  2MIQ A;  3O33 A;  5LKZ A;  5DIN A;  5KH3 A;  4PTB A;  2KYU A;  5J3X A;  2FSA A;  2JMD A;  5I3L A;  2VNF A;  2KGG A;  5G0F A;  1JOC A;  1HYJ A;  5FB0 A;  4I7B A;  4R8P K;  4IC3 A;  2ECJ A;  4UP0 A;  2VJF B;  4I7C A;  2KWO A;  2MA6 A;  2YHO A;  2L43 A;  3L11 A;  3N9M A;  5C13 A;  4YAT A;  4BBQ A;  2Y1N A;  4BHW A;  1K2F A;  2MA5 A;  2EA6 A;  4YAD A;  2KWJ A;  2EGP A;  4UI9 B;  3U5P A;  1WEQ A;  1MM3 A;  2BAY A;  2YYR A;  2MUM A;  4QF3 A;  4A49 A;  3EB6 A;  1WFK A;  3RPG B;  3HCU A;  4R2Y A;  4W4U A;  2L5U A;  1WEP A;  4MVT A;  1MM2 A;  1LDJ B;  3I2D A;  1HYI A;  3GV4 A;  4V3L C;  4A4C A;  4AYC A;  2M1R A;  3N9Q A;  2L0B A;  2YU4 A;  1VFY A;  2ZET C;  4S3O C;  4LAD B;  2KR4 A;  4LKA A;  4L7X A;  4N3W A;  1WEE A;  5C11 A;  1ZBD B;  3RPG C;  2LXH C;  2HYE D;  2MD7 B;  5B77 A;  3N9N A;  2LN0 A;  2M85 A;  3IHP A;  4WZ3 B;  5G05 B;  2ECV A;  2YRE A;  2LXP C;  5KH9 A;  1N87 A;  4WZ2 A;  4YC9 A;  5LKU A;  5KH7 A;  4B7Y C;  1U6G B;  3SHB A;  4CCG X;  2VPD A;  2L75 A;  4R7E A;  2E6S A;  2LV9 A;  3ZYQ A;  2RSD A;  1JM7 A;  5LCW B;  2OXQ C;  3ZVY A;  5G04 B;  2KWN A;  3T6R A;  4GNE A;  2UZG A;  2G43 A;  2C2L A;  2ECT A;  1WEM A;  5H1T A;  1WIL A;  2YW8 A;  2LGG A;  2YQM A;  1WEU A;  2KWK A;  1G25 A;  4AP4 A;  4B86 C;  2CKL B;  4YBM A;  1DVP A;  4A4B A;  2K1J A;  4MSX A;  3ZPV 1;  4LLB A;  2PUY A;  4N4F A;  5B8D A;  4QF2 A;  5LKX A;  4UP5 A;  1X4I A;  2ECG A;  4I7D A;  2L80 A;  2FUI A;  3KNV A;  4ZDT A;  5B75 A;  1VD4 A;  2KRE A;  4TKP B;  2YQL A;  1WGM A;  1Z2Q A;  1V87 A;  4C9Z A;  4GB0 A;  4F52 B;  2JMI A;  3LQH A;  3L1Z B;  2VP7 A;  3DQV R;  3M62 A;  2YUR A;  3DPL R;  3LQI A;  2JMJ A;  3C6W A;  3KQI A;  2LQ6 A;  5FB1 A;  4FO9 A;  4X3G A;  1WE9 A;  4GNG A;  3PHD A;  4YAX A;  5B76 A;  4ZUX U;  5H1V A;  2ECN A;  2VJE A;  3MHS A;  2E6R A;  2QIC A;  1XWH A;  2F6N A;  2YUC A;  2H0D A;  2KU3 A;  3O36 A;  5FER A;  1X4U A;  1Z6U A;  3ZNI A;  3N9L A;  3T7L A;  5TDR A;  4FK5 A;  5H9M A;  2MT5 A;  2CSZ A;  3O34 A;  3U5N A;  1T1H A;  3EB5 A;  2KIZ A;  3O70 A;  4V3K C;  4WZ0 A;  3ZPV E;  3VK6 A;  2XEU A;  4CA1 A;  2G6Q A;  2LGV A;  2IDA A;  2YSJ A;  5TAB A;  1E4U A;  3LRQ A;  4WA6 A;  1JM7 B;  4FIP A;  4AYC B;  2HDP A;  2MNY A;  3FL2 A;  4YAB A;  5DKA A;  2QJ0 A;  4GNF A;  5D1K B;  2K17 A;  4LJN A;  4IC2 A;  3L1X A;  3RTR B;  2KGI A;  1IYM A;  2VPB A;  2CSY A;  4S3O B;  3ZVZ B;  2G45 A;  3MHH A;  2CT2 A;  1WEW A;  4NN2 A;  1LDK C;  3ASL A;  2EOD A;  3O7A A;  5FEY A;  5B78 A;  1F62 A;  2NAA A;  5TRB A;  2XB1 A;  4YBT A;  3M99 A;  3SOW A;  2C2V S;  1WIM A;  5LKT A;  3O35 A;  2FUU A;  3HCT A;  2VJF A;  2MNZ A;  4O64 A;  2LRI C;  1X4J A;  5D1M B;  3SOU A;  4FJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...