2MIQA

Solution nmr structure of phd type 1 zinc finger domain 1 of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium (nesg) target fr824j
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
SHMSGGSPLATGTTANTRGASQKKGGEPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase lid
publication title Solution NMR Structure of PHD Type 1 Zinc Finger Domain 1 from Lysine-specific Demethylase Lid from Drosophila melanogaster, Northeast Structural Genomics Consortium (NESG) Target FR824J
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 8
structure length 94
sequence length 94
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2miqA00
2JMIA 3NG2A 5KH7A 1Z6UA 1T1HA 3KV6A 1X4IA 3PURA 2KWJA 2VJEA 5FB0A 3HCTA 2RSDA 2YU4A 2F6JA 3HCSA 4AYCA 2LXHC 2YW8A 1IYMA 3O7AA 3PUQA 1WFKA 1LDKC 4I7DA 2E6RA 2MNZA 4AUQB 5C13A 1JM7B 2XB1A 2DX8A 4X3GA 2KR4A 2OXQC 2AN6A 2KFTA 4B86C 4R8PK 2YYRA 2MA6A 2K16A 3RPGB 2I50A 1WEOA 2VJFB 1VYXA 2MUMA 3DQVR 2KIZA 4YC9A 1K2FA 5H1UA 4N4FA 1WENA 4GNEA 2F6NA 4I7BA 2H0DA 4B7YC 1X4JA 4IC2A 4WZ3B 2KGIA 3HTKC 2MNYA 5H1VA 5LCWB 2CSYA 4N3WA 4FJCA 5LKXA 2VPDA 1WE9A 4AYCB 2NAAA 5D1KB 2EA6A 2Y1MA 1MM2A 5TDRA 2ECIA 2M1RA 2VPBA 3ZYQA 1RMDA 4Q6FA 3I2DA 5B75A 3O35A 2C2LA 2KE1A 1FBVA 2LGVA 5B79A 2LXPC 2KGGA 2ECGA 1CHCA 2KWKA 3IHPA 2LGGA 2VJFA 4CCGX 5AIUA 4LKAA 3KQIA 2VP7A 5TABA 1VFYA 4MSXA 5JG6A 3L1XA 2PUYA 1WILA 3L1ZB 4XI1A 2L75A 3U5MA 2LGLA 5G05B 2ECWA 2MD7B 4W4UA 5D1MB 3O34A 5DINA 3RPGC 2M6MA 3VK6A 1WEWA 3U5OA 4LADB 2CKLA 4A4CA 5KH3A 4BBQA 3SHBA 2G6QA 2KU3A 5TBNA 2LV9A 2MA5A 3ZPVE 3ZNIA 1WEMA 2FUIA 3C5KA 2MD8C 2ECVA 2YHOA 5LKZA 3M99A 1JOCA 3M62A 2YSJA 2JRJA 5B78A 3GV4A 3KV5A 1ZBDB 4BHWA 4AP4A 3O37A 3SOUA 4FK5A 4A0CD 4C9ZA 3N9NA 2M3HA 2K1JA 1HYJA 4S3OC 1WESA 2YQLA 4YATA 3ZVYA 3FL2A 2EGPA 1WEVA 4GNDA 4UP0A 2HYED 4YBMA 3MHHA 2VPEA 4L7XA 5C11A 2BAYA 2C2VS 3O70A 5LKTA 3N9LA 1WEPA 2CKLB 5D1LB 4A49A 2QJ0A 4MVTA 4R2YA 4CA1A 2VNFA 3C6WA 3MHSA 4GNFA 1VD4A 3HCUA 4GNGA 1WEQA 4WZ2A 4V3LC 1BORA 2CT2A 3U5PA 2K4DA 2YURA 2ECJA 2KYUA 2IDAA 5TRBA 4S3OB 3EB6A 1G25A 3QZVA 1Z60A 2JMJA 3ZTGA 4P5OB 4L58A 4WZ0A 1E4UA 1N87A 2F42A 4QF2A 2LRIC 1WGMA 5TDWA 2M85A 3N9PA 2Y1NA 4NN2A 1Z2QA 2YQMA 3T7LA 4LLBA 3L11A 3T6RA 2FUUA 2ECNA 1MM3A 3GL6A 2LGKA 2L80A 5G04B 1FP0A 5FB1A 4R7EA 4PTBA 1LDJB 5I3LA 2PNXA 1V87A 4LJNA 1HYIA 4LK9A 5H1TA 5B76A 3PHDA 2UZGA 2KWNA 4YABA 3LQJA 1DVPA 4I7CA 4QF3A 3ASLA 4IC3A 4O64A 4YADA 2QIZA 4YBSA 2LDRA 3O36A 1XWHA 3KNVA 3LQHA 5J3XA 2CSZA 2YSMA 2LQ6A 2HDPA 4FO9A 1WEUA 2E6SA 4ZUXU 3RTRB 2L43A 2RI7A 2G45A 3M63A 5LKUA 1X4UA 5DKAA 2XEUA 3U5NA 3N9OA 3LQIA 5B8DA 2JMDA 4FIPA 2QICA 5FEYA 2MIQA 2L5UA 3N9QA 2VJEB 3DPLR 4GB0A 3SOXA 4ZQLA 3SOWA 4AVXA 1WEEA 2L0BA 3O33A 3ZPV1 5H9MA 2EODA 2VPGA 2FSAA 2D8SA 5G0FA 2YT5A 2G43A 3LRQA 5AITA 4YBTA 1JM7A 4UP5A 2YREA 4YAXA 2ZETC 3EB5A 3N9MA 2YUCA 1F62A 2KREA 3ZVZB 4A4BA 2K17A 2Y43A 4WA6A 1WIMA 4TKPB 2ECTA 2LN0A 2YHNA 5EYAF 4PPEA 5KH9A 4F52B 5FERA 4UI9B 2H0DB 5B77A 2KWOA 4ZDTA 2MT5A 1U6GB 3V43A 4V3KC
chains in the Genus database with same CATH superfamily
2JMIA 3NG2A 5KH7A 1Z6UA 1T1HA 3KV6A 1X4IA 3PURA 2KWJA 2VJEA 5FB0A 3HCTA 2RSDA 1MBMA 2YU4A 1DCQA 2F6JA 3HCSA 4AYCA 3MDBC 2LXHC 2YW8A 1IYMA 3O7AA 3PUQA 1WFKA 1LDKC 4I7DA 2E6RA 5SVIB 2MNZA 4AUQB 5C13A 1JM7B 2XB1A 2DX8A 4X3GA 2KR4A 2M13A 2OXQC 2AN6A 2KFTA 4B86C 4R8PK 2YYRA 2MA6A 2K16A 3RPGB 2I50A 1WEOA 2VJFB 1VYXA 2MUMA 3DQVR 2KIZA 4YC9A 1K2FA 5H1UA 4N4FA 1WENA 4GNEA 2F6NA 4I7BA 2EGMA 2H0DA 2P57A 4B7YC 1X4JA 4IC2A 2CRRA 4WZ3B 2KGIA 3HTKC 2MNYA 5H1VA 5LCWB 2CSYA 2KKYA 4N3WA 4FJCA 5LKXA 2RR4A 2VPDA 1WE9A 4AYCB 2NAAA 5D1KB 2EA6A 2Y1MA 4QQ4A 3FAOA 5SVYA 1MM2A 3JUEA 2DJAA 5TDRA 2ECIA 2M1RA 2VPBA 3ZYQA 1RMDA 4Q6FA 3I2DA 5B75A 2JUNA 3O35A 2C2LA 2KE1A 3O47A 1FBVA 2LGVA 5B79A 2LXPC 2KGGA 2ECGA 2CONA 1CHCA 2KWKA 3IHPA 2LGGA 2VJFA 4CCGX 5AIUA 3E2DA 4LKAA 3KQIA 2VP7A 5TABA 1VFYA 3LDYA 4MSXA 5JG6A 3L1XA 2PUYA 1WILA 3L1ZB 4XI1A 2L75A 3U5MA 2LGLA 5G05B 2ECWA 2MD7B 4W4UA 5D1MB 3O34A 5DINA 3RPGC 2M6MA 3VK6A 1WEWA 2IQJA 4H9DA 3U5OA 4LADB 2CKLA 4A4CA 2XOCA 4BBQA 5KH3A 3SHBA 2LAUA 2G6QA 2KU3A 5TBNA 2LV9A 2MA5A 3ZPVE 3ZNIA 1WEMA 2FUIA 3C5KA 3DDTA 2MD8C 2ECVA 2YHOA 5LKZA 3M99A 1JOCA 3M62A 2YSJA 3LVQE 2JRJA 3FM8C 5B78A 3GV4A 3KV5A 1ZBDB 4BHWA 4AP4A 3O37A 3SOUA 2JM3A 4FK5A 3DWDA 4A0CD 4C9ZA 3N9NA 2M3HA 2K1JA 1HYJA 4S3OC 1WESA 2YQLA 4YATA 3ZVYA 3FL2A 3LJUX 2EGPA 2DSMA 1WEVA 2YVRA 4GNDA 2MKEA 4Z0RA 4UP0A 2HYED 4YBMA 3MHHA 2VPEA 4L7XA 5C11A 2BAYA 2C2VS 3O70A 5LKTA 3N9LA 1WEPA 2CKLB 5D1LB 4A49A 2QJ0A 4MVTA 4R2YA 4CA1A 2VNFA 3C6WA 3MHSA 4GNFA 1VD4A 3HCUA 4GNGA 1WEQA 4WZ2A 4V3LC 1BORA 3LVRE 2CT2A 3U5PA 2K4DA 2YURA 2ECJA 2KYUA 2IDAA 5TRBA 4S3OB 3EB6A 1G25A 3QZVA 1Z60A 2JMJA 3ZTGA 4P5OB 4L58A 4WZ0A 1E4UA 1N87A 4OGCA 2F42A 4QF2A 2LRIC 1WGMA 5TDWA 2M85A 3N9PA 2Y1NA 4NN2A 2KKXA 1Z2QA 2YQMA 3T7LA 5K3QA 4LLBA 3L11A 3T6RA 2CRWA 2ECNA 1MM3A 2FUUA 2LGKA 3GL6A 2L80A 5G04B 1FP0A 5FB1A 4R7EA 2L7PA 5SVXA 4PTBA 1LDJB 5I3LA 2PNXA 1V87A 4LJNA 1HYIA 4LK9A 5H1TA 5B76A 3PHDA 2UZGA 2KWNA 4YABA 3LQJA 1DVPA 4I7CA 3T9KA 4QF3A 3ASLA 4IC3A 4O64A 4YADA 4F1PA 2QIZA 4Z0OA 4YBSA 2LDRA 3O36A 2FFWA 1XWHA 3KNVA 3LQHA 5J3XA 2CSZA 2YSMA 2LQ6A 2HDPA 4FO9A 3FJUB 1WEUA 2E6SA 4ZUXU 3RTRB 2L43A 2RI7A 2G45A 3Q1DA 3M63A 5LKUA 1X4UA 2XP0A 5DKAA 3FEHA 2XEUA 3U5NA 4O62A 3N9OA 3LQIA 5B8DA 3SUBA 2JMDA 4FIPA 2QICA 5FEYA 2MIQA 2L5UA 3N9QA 2VJEB 3DPLR 4GB0A 3SOXA 2EXUA 4ZQLA 2B0OE 3SOWA 4AVXA 1WEEA 2L0BA 3O33A 3ZPV1 5H9MA 2EODA 2VPGA 2FSAA 2D8SA 5G0FA 2YT5A 5SVIA 2G43A 3PLWA 3LRQA 5AITA 4YBTA 1JM7A 4UP5A 2YREA 4YAXA 2ZETC 2D8UA 3EB5A 3M7KA 3KDEC 2FD4A 3N9MA 2YUCA 1F62A 2KREA 3ZVZB 4A4BA 2E61A 2K17A 2Y43A 2CSVA 4WA6A 1WIMA 3FANA 4TKPB 2XOZA 2ECTA 2LN0A 2OWAA 2YHNA 5EYAF 4PPEA 4OGEA 5KH9A 3H7HA 4F52B 5FERA 4UI9B 2H0DB 5B77A 2XOYA 2KWOA 4ZDTA 2MT5A 1U6GB 3V43A 4V3KC
chains in the Genus database with same CATH topology
2JMIA 3NG2A 5KH7A 1Z6UA 1T1HA 3KV6A 1X4IA 3PURA 2KWJA 2VJEA 5FB0A 3HCTA 2RSDA 2YU4A 2F6JA 3HCSA 4AYCA 2LXHC 2YW8A 1IYMA 3O7AA 3PUQA 1WFKA 1LDKC 4I7DA 2E6RA 2MNZA 4AUQB 5C13A 1JM7B 2XB1A 2DX8A 4X3GA 2KR4A 2OXQC 2AN6A 2KFTA 4B86C 4R8PK 2YYRA 2MA6A 2K16A 3RPGB 2I50A 1WEOA 2VJFB 1VYXA 2MUMA 3DQVR 2KIZA 4YC9A 1K2FA 5H1UA 4N4FA 1WENA 4GNEA 2F6NA 4I7BA 2H0DA 4B7YC 1X4JA 4IC2A 4WZ3B 2KGIA 3HTKC 2MNYA 5H1VA 5LCWB 2CSYA 4N3WA 4FJCA 5LKXA 2VPDA 1WE9A 4AYCB 2NAAA 5D1KB 2EA6A 2Y1MA 1MM2A 5TDRA 2ECIA 2M1RA 2VPBA 3ZYQA 1RMDA 4Q6FA 3I2DA 5B75A 3O35A 2C2LA 2KE1A 1FBVA 2LGVA 5B79A 2LXPC 2KGGA 2ECGA 1CHCA 2KWKA 3IHPA 2LGGA 2VJFA 4CCGX 5AIUA 4LKAA 3KQIA 2VP7A 5TABA 1VFYA 4MSXA 5JG6A 3L1XA 2PUYA 1WILA 3L1ZB 4XI1A 2L75A 3U5MA 2LGLA 5G05B 2ECWA 2MD7B 4W4UA 5D1MB 3O34A 5DINA 3RPGC 2M6MA 3VK6A 1WEWA 3U5OA 4LADB 2CKLA 4A4CA 5KH3A 4BBQA 3SHBA 2G6QA 2KU3A 5TBNA 2LV9A 2MA5A 3ZPVE 3ZNIA 1WEMA 2FUIA 3C5KA 2MD8C 2ECVA 2YHOA 5LKZA 3M99A 1JOCA 3M62A 2YSJA 2JRJA 5B78A 3GV4A 3KV5A 1ZBDB 4BHWA 4AP4A 3O37A 3SOUA 4FK5A 4A0CD 4C9ZA 3N9NA 2M3HA 2K1JA 1HYJA 4S3OC 1WESA 2YQLA 4YATA 3ZVYA 3FL2A 2EGPA 1WEVA 4GNDA 4UP0A 2HYED 4YBMA 3MHHA 2VPEA 4L7XA 5C11A 2BAYA 2C2VS 3O70A 5LKTA 3N9LA 1WEPA 2CKLB 5D1LB 4A49A 2QJ0A 4MVTA 4R2YA 4CA1A 2VNFA 3C6WA 3MHSA 4GNFA 1VD4A 3HCUA 4GNGA 1WEQA 4WZ2A 4V3LC 1BORA 2CT2A 3U5PA 2K4DA 2YURA 2ECJA 2KYUA 2IDAA 5TRBA 4S3OB 3EB6A 1G25A 3QZVA 1Z60A 2JMJA 3ZTGA 4P5OB 4L58A 4WZ0A 1E4UA 1N87A 2F42A 4QF2A 2LRIC 1WGMA 5TDWA 2M85A 3N9PA 2Y1NA 4NN2A 1Z2QA 2YQMA 3T7LA 4LLBA 3L11A 3T6RA 2FUUA 2ECNA 1MM3A 3GL6A 2LGKA 2L80A 5G04B 1FP0A 5FB1A 4R7EA 4PTBA 1LDJB 5I3LA 2PNXA 1V87A 4LJNA 1HYIA 4LK9A 5H1TA 5B76A 3PHDA 2UZGA 2KWNA 4YABA 3LQJA 1DVPA 4I7CA 4QF3A 3ASLA 4IC3A 4O64A 4YADA 2QIZA 4YBSA 2LDRA 3O36A 1XWHA 3KNVA 3LQHA 5J3XA 2CSZA 2YSMA 2LQ6A 2HDPA 4FO9A 1WEUA 2E6SA 4ZUXU 3RTRB 2L43A 2RI7A 2G45A 3M63A 5LKUA 1X4UA 5DKAA 2XEUA 3U5NA 3N9OA 3LQIA 5B8DA 2JMDA 4FIPA 2QICA 5FEYA 2MIQA 2L5UA 3N9QA 2VJEB 3DPLR 4GB0A 3SOXA 4ZQLA 3SOWA 4AVXA 1WEEA 2L0BA 3O33A 3ZPV1 5H9MA 2EODA 2VPGA 2FSAA 2D8SA 5G0FA 2YT5A 2G43A 3LRQA 5AITA 4YBTA 1JM7A 4UP5A 2YREA 4YAXA 2ZETC 3EB5A 3N9MA 2YUCA 1F62A 2KREA 3ZVZB 4A4BA 2K17A 2Y43A 4WA6A 1WIMA 4TKPB 2ECTA 2LN0A 2YHNA 5EYAF 4PPEA 5KH9A 4F52B 5FERA 4UI9B 2H0DB 5B77A 2KWOA 4ZDTA 2MT5A 1U6GB 3V43A 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMI A;  3NG2 A;  5KH7 A;  1Z6U A;  1T1H A;  3KV6 A;  1X4I A;  3PUR A;  2KWJ A;  2VJE A;  5FB0 A;  3HCT A;  2RSD A;  2YU4 A;  2F6J A;  3HCS A;  4AYC A;  2LXH C;  2YW8 A;  1IYM A;  3O7A A;  3PUQ A;  1WFK A;  1LDK C;  4I7D A;  2E6R A;  2MNZ A;  4AUQ B;  5C13 A;  1JM7 B;  2XB1 A;  2DX8 A;  4X3G A;  2KR4 A;  2OXQ C;  2AN6 A;  2KFT A;  4B86 C;  4R8P K;  2YYR A;  2MA6 A;  2K16 A;  3RPG B;  2I50 A;  1WEO A;  2VJF B;  1VYX A;  2MUM A;  3DQV R;  2KIZ A;  4YC9 A;  1K2F A;  5H1U A;  4N4F A;  1WEN A;  4GNE A;  2F6N A;  4I7B A;  2H0D A;  4B7Y C;  1X4J A;  4IC2 A;  4WZ3 B;  2KGI A;  3HTK C;  2MNY A;  5H1V A;  5LCW B;  2CSY A;  4N3W A;  4FJC A;  5LKX A;  2VPD A;  1WE9 A;  4AYC B;  2NAA A;  5D1K B;  2EA6 A;  2Y1M A;  1MM2 A;  5TDR A;  2ECI A;  2M1R A;  2VPB A;  3ZYQ A;  1RMD A;  4Q6F A;  3I2D A;  5B75 A;  3O35 A;  2C2L A;  2KE1 A;  1FBV A;  2LGV A;  5B79 A;  2LXP C;  2KGG A;  2ECG A;  1CHC A;  2KWK A;  3IHP A;  2LGG A;  2VJF A;  4CCG X;  5AIU A;  4LKA A;  3KQI A;  2VP7 A;  5TAB A;  1VFY A;  4MSX A;  5JG6 A;  3L1X A;  2PUY A;  1WIL A;  3L1Z B;  4XI1 A;  2L75 A;  3U5M A;  2LGL A;  5G05 B;  2ECW A;  2MD7 B;  4W4U A;  5D1M B;  3O34 A;  5DIN A;  3RPG C;  2M6M A;  3VK6 A;  1WEW A;  3U5O A;  4LAD B;  2CKL A;  4A4C A;  5KH3 A;  4BBQ A;  3SHB A;  2G6Q A;  2KU3 A;  5TBN A;  2LV9 A;  2MA5 A;  3ZPV E;  3ZNI A;  1WEM A;  2FUI A;  3C5K A;  2MD8 C;  2ECV A;  2YHO A;  5LKZ A;  3M99 A;  1JOC A;  3M62 A;  2YSJ A;  2JRJ A;  5B78 A;  3GV4 A;  3KV5 A;  1ZBD B;  4BHW A;  4AP4 A;  3O37 A;  3SOU A;  4FK5 A;  4A0C D;  4C9Z A;  3N9N A;  2M3H A;  2K1J A;  1HYJ A;  4S3O C;  1WES A;  2YQL A;  4YAT A;  3ZVY A;  3FL2 A;  2EGP A;  1WEV A;  4GND A;  4UP0 A;  2HYE D;  4YBM A;  3MHH A;  2VPE A;  4L7X A;  5C11 A;  2BAY A;  2C2V S;  3O70 A;  5LKT A;  3N9L A;  1WEP A;  2CKL B;  5D1L B;  4A49 A;  2QJ0 A;  4MVT A;  4R2Y A;  4CA1 A;  2VNF A;  3C6W A;  3MHS A;  4GNF A;  1VD4 A;  3HCU A;  4GNG A;  1WEQ A;  4WZ2 A;  4V3L C;  1BOR A;  2CT2 A;  3U5P A;  2K4D A;  2YUR A;  2ECJ A;  2KYU A;  2IDA A;  5TRB A;  4S3O B;  3EB6 A;  1G25 A;  3QZV A;  1Z60 A;  2JMJ A;  3ZTG A;  4P5O B;  4L58 A;  4WZ0 A;  1E4U A;  1N87 A;  2F42 A;  4QF2 A;  2LRI C;  1WGM A;  5TDW A;  2M85 A;  3N9P A;  2Y1N A;  4NN2 A;  1Z2Q A;  2YQM A;  3T7L A;  4LLB A;  3L11 A;  3T6R A;  2FUU A;  2ECN A;  1MM3 A;  3GL6 A;  2LGK A;  2L80 A;  5G04 B;  1FP0 A;  5FB1 A;  4R7E A;  4PTB A;  1LDJ B;  5I3L A;  2PNX A;  1V87 A;  4LJN A;  1HYI A;  4LK9 A;  5H1T A;  5B76 A;  3PHD A;  2UZG A;  2KWN A;  4YAB A;  3LQJ A;  1DVP A;  4I7C A;  4QF3 A;  3ASL A;  4IC3 A;  4O64 A;  4YAD A;  2QIZ A;  4YBS A;  2LDR A;  3O36 A;  1XWH A;  3KNV A;  3LQH A;  5J3X A;  2CSZ A;  2YSM A;  2LQ6 A;  2HDP A;  4FO9 A;  1WEU A;  2E6S A;  4ZUX U;  3RTR B;  2L43 A;  2RI7 A;  2G45 A;  3M63 A;  5LKU A;  1X4U A;  5DKA A;  2XEU A;  3U5N A;  3N9O A;  3LQI A;  5B8D A;  2JMD A;  4FIP A;  2QIC A;  5FEY A;  2MIQ A;  2L5U A;  3N9Q A;  2VJE B;  3DPL R;  4GB0 A;  3SOX A;  4ZQL A;  3SOW A;  4AVX A;  1WEE A;  2L0B A;  3O33 A;  3ZPV 1;  5H9M A;  2EOD A;  2VPG A;  2FSA A;  2D8S A;  5G0F A;  2YT5 A;  2G43 A;  3LRQ A;  5AIT A;  4YBT A;  1JM7 A;  4UP5 A;  2YRE A;  4YAX A;  2ZET C;  3EB5 A;  3N9M A;  2YUC A;  1F62 A;  2KRE A;  3ZVZ B;  4A4B A;  2K17 A;  2Y43 A;  4WA6 A;  1WIM A;  4TKP B;  2ECT A;  2LN0 A;  2YHN A;  5EYA F;  4PPE A;  5KH9 A;  4F52 B;  5FER A;  4UI9 B;  2H0D B;  5B77 A;  2KWO A;  4ZDT A;  2MT5 A;  1U6G B;  3V43 A;  4V3K C; 
#chains in the Genus database with same CATH topology
 2JMI A;  3NG2 A;  5KH7 A;  1Z6U A;  1T1H A;  3KV6 A;  1X4I A;  3PUR A;  2KWJ A;  2VJE A;  5FB0 A;  3HCT A;  2RSD A;  1MBM A;  2YU4 A;  1DCQ A;  2F6J A;  3HCS A;  4AYC A;  3MDB C;  2LXH C;  2YW8 A;  1IYM A;  3O7A A;  3PUQ A;  1WFK A;  1LDK C;  4I7D A;  2E6R A;  5SVI B;  2MNZ A;  4AUQ B;  5C13 A;  1JM7 B;  2XB1 A;  2DX8 A;  4X3G A;  2KR4 A;  2M13 A;  2OXQ C;  2AN6 A;  2KFT A;  4B86 C;  4R8P K;  2YYR A;  2MA6 A;  2K16 A;  3RPG B;  2I50 A;  1WEO A;  2VJF B;  1VYX A;  2MUM A;  3DQV R;  2KIZ A;  4YC9 A;  1K2F A;  5H1U A;  4N4F A;  1WEN A;  4GNE A;  2F6N A;  4I7B A;  2EGM A;  2H0D A;  2P57 A;  4B7Y C;  1X4J A;  4IC2 A;  2CRR A;  4WZ3 B;  2KGI A;  3HTK C;  2MNY A;  5H1V A;  5LCW B;  2CSY A;  2KKY A;  4N3W A;  4FJC A;  5LKX A;  2RR4 A;  2VPD A;  1WE9 A;  4AYC B;  2NAA A;  5D1K B;  2EA6 A;  2Y1M A;  4QQ4 A;  3FAO A;  5SVY A;  1MM2 A;  3JUE A;  2DJA A;  5TDR A;  2ECI A;  2M1R A;  2VPB A;  3ZYQ A;  1RMD A;  4Q6F A;  3I2D A;  5B75 A;  2JUN A;  3O35 A;  2C2L A;  2KE1 A;  3O47 A;  1FBV A;  2LGV A;  5B79 A;  2LXP C;  2KGG A;  2ECG A;  2CON A;  1CHC A;  2KWK A;  3IHP A;  2LGG A;  2VJF A;  4CCG X;  5AIU A;  3E2D A;  4LKA A;  3KQI A;  2VP7 A;  5TAB A;  1VFY A;  3LDY A;  4MSX A;  5JG6 A;  3L1X A;  2PUY A;  1WIL A;  3L1Z B;  4XI1 A;  2L75 A;  3U5M A;  2LGL A;  5G05 B;  2ECW A;  2MD7 B;  4W4U A;  5D1M B;  3O34 A;  5DIN A;  3RPG C;  2M6M A;  3VK6 A;  1WEW A;  2IQJ A;  4H9D A;  3U5O A;  4LAD B;  2CKL A;  4A4C A;  2XOC A;  4BBQ A;  5KH3 A;  3SHB A;  2LAU A;  2G6Q A;  2KU3 A;  5TBN A;  2LV9 A;  2MA5 A;  3ZPV E;  3ZNI A;  1WEM A;  2FUI A;  3C5K A;  3DDT A;  2MD8 C;  2ECV A;  2YHO A;  5LKZ A;  3M99 A;  1JOC A;  3M62 A;  2YSJ A;  3LVQ E;  2JRJ A;  3FM8 C;  5B78 A;  3GV4 A;  3KV5 A;  1ZBD B;  4BHW A;  4AP4 A;  3O37 A;  3SOU A;  2JM3 A;  4FK5 A;  3DWD A;  4A0C D;  4C9Z A;  3N9N A;  2M3H A;  2K1J A;  1HYJ A;  4S3O C;  1WES A;  2YQL A;  4YAT A;  3ZVY A;  3FL2 A;  3LJU X;  2EGP A;  2DSM A;  1WEV A;  2YVR A;  4GND A;  2MKE A;  4Z0R A;  4UP0 A;  2HYE D;  4YBM A;  3MHH A;  2VPE A;  4L7X A;  5C11 A;  2BAY A;  2C2V S;  3O70 A;  5LKT A;  3N9L A;  1WEP A;  2CKL B;  5D1L B;  4A49 A;  2QJ0 A;  4MVT A;  4R2Y A;  4CA1 A;  2VNF A;  3C6W A;  3MHS A;  4GNF A;  1VD4 A;  3HCU A;  4GNG A;  1WEQ A;  4WZ2 A;  4V3L C;  1BOR A;  3LVR E;  2CT2 A;  3U5P A;  2K4D A;  2YUR A;  2ECJ A;  2KYU A;  2IDA A;  5TRB A;  4S3O B;  3EB6 A;  1G25 A;  3QZV A;  1Z60 A;  2JMJ A;  3ZTG A;  4P5O B;  4L58 A;  4WZ0 A;  1E4U A;  1N87 A;  4OGC A;  2F42 A;  4QF2 A;  2LRI C;  1WGM A;  5TDW A;  2M85 A;  3N9P A;  2Y1N A;  4NN2 A;  2KKX A;  1Z2Q A;  2YQM A;  3T7L A;  5K3Q A;  4LLB A;  3L11 A;  3T6R A;  2CRW A;  2ECN A;  1MM3 A;  2FUU A;  2LGK A;  3GL6 A;  2L80 A;  5G04 B;  1FP0 A;  5FB1 A;  4R7E A;  2L7P A;  5SVX A;  4PTB A;  1LDJ B;  5I3L A;  2PNX A;  1V87 A;  4LJN A;  1HYI A;  4LK9 A;  5H1T A;  5B76 A;  3PHD A;  2UZG A;  2KWN A;  4YAB A;  3LQJ A;  1DVP A;  4I7C A;  3T9K A;  4QF3 A;  3ASL A;  4IC3 A;  4O64 A;  4YAD A;  4F1P A;  2QIZ A;  4Z0O A;  4YBS A;  2LDR A;  3O36 A;  2FFW A;  1XWH A;  3KNV A;  3LQH A;  5J3X A;  2CSZ A;  2YSM A;  2LQ6 A;  2HDP A;  4FO9 A;  3FJU B;  1WEU A;  2E6S A;  4ZUX U;  3RTR B;  2L43 A;  2RI7 A;  2G45 A;  3Q1D A;  3M63 A;  5LKU A;  1X4U A;  2XP0 A;  5DKA A;  3FEH A;  2XEU A;  3U5N A;  4O62 A;  3N9O A;  3LQI A;  5B8D A;  3SUB A;  2JMD A;  4FIP A;  2QIC A;  5FEY A;  2MIQ A;  2L5U A;  3N9Q A;  2VJE B;  3DPL R;  4GB0 A;  3SOX A;  2EXU A;  4ZQL A;  2B0O E;  3SOW A;  4AVX A;  1WEE A;  2L0B A;  3O33 A;  3ZPV 1;  5H9M A;  2EOD A;  2VPG A;  2FSA A;  2D8S A;  5G0F A;  2YT5 A;  5SVI A;  2G43 A;  3PLW A;  3LRQ A;  5AIT A;  4YBT A;  1JM7 A;  4UP5 A;  2YRE A;  4YAX A;  2ZET C;  2D8U A;  3EB5 A;  3M7K A;  3KDE C;  2FD4 A;  3N9M A;  2YUC A;  1F62 A;  2KRE A;  3ZVZ B;  4A4B A;  2E61 A;  2K17 A;  2Y43 A;  2CSV A;  4WA6 A;  1WIM A;  3FAN A;  4TKP B;  2XOZ A;  2ECT A;  2LN0 A;  2OWA A;  2YHN A;  5EYA F;  4PPE A;  4OGE A;  5KH9 A;  3H7H A;  4F52 B;  5FER A;  4UI9 B;  2H0D B;  5B77 A;  2XOY A;  2KWO A;  4ZDT A;  2MT5 A;  1U6G B;  3V43 A;  4V3K C; 
#chains in the Genus database with same CATH homology
 2JMI A;  3NG2 A;  5KH7 A;  1Z6U A;  1T1H A;  3KV6 A;  1X4I A;  3PUR A;  2KWJ A;  2VJE A;  5FB0 A;  3HCT A;  2RSD A;  2YU4 A;  2F6J A;  3HCS A;  4AYC A;  2LXH C;  2YW8 A;  1IYM A;  3O7A A;  3PUQ A;  1WFK A;  1LDK C;  4I7D A;  2E6R A;  2MNZ A;  4AUQ B;  5C13 A;  1JM7 B;  2XB1 A;  2DX8 A;  4X3G A;  2KR4 A;  2OXQ C;  2AN6 A;  2KFT A;  4B86 C;  4R8P K;  2YYR A;  2MA6 A;  2K16 A;  3RPG B;  2I50 A;  1WEO A;  2VJF B;  1VYX A;  2MUM A;  3DQV R;  2KIZ A;  4YC9 A;  1K2F A;  5H1U A;  4N4F A;  1WEN A;  4GNE A;  2F6N A;  4I7B A;  2H0D A;  4B7Y C;  1X4J A;  4IC2 A;  4WZ3 B;  2KGI A;  3HTK C;  2MNY A;  5H1V A;  5LCW B;  2CSY A;  4N3W A;  4FJC A;  5LKX A;  2VPD A;  1WE9 A;  4AYC B;  2NAA A;  5D1K B;  2EA6 A;  2Y1M A;  1MM2 A;  5TDR A;  2ECI A;  2M1R A;  2VPB A;  3ZYQ A;  1RMD A;  4Q6F A;  3I2D A;  5B75 A;  3O35 A;  2C2L A;  2KE1 A;  1FBV A;  2LGV A;  5B79 A;  2LXP C;  2KGG A;  2ECG A;  1CHC A;  2KWK A;  3IHP A;  2LGG A;  2VJF A;  4CCG X;  5AIU A;  4LKA A;  3KQI A;  2VP7 A;  5TAB A;  1VFY A;  4MSX A;  5JG6 A;  3L1X A;  2PUY A;  1WIL A;  3L1Z B;  4XI1 A;  2L75 A;  3U5M A;  2LGL A;  5G05 B;  2ECW A;  2MD7 B;  4W4U A;  5D1M B;  3O34 A;  5DIN A;  3RPG C;  2M6M A;  3VK6 A;  1WEW A;  3U5O A;  4LAD B;  2CKL A;  4A4C A;  5KH3 A;  4BBQ A;  3SHB A;  2G6Q A;  2KU3 A;  5TBN A;  2LV9 A;  2MA5 A;  3ZPV E;  3ZNI A;  1WEM A;  2FUI A;  3C5K A;  2MD8 C;  2ECV A;  2YHO A;  5LKZ A;  3M99 A;  1JOC A;  3M62 A;  2YSJ A;  2JRJ A;  5B78 A;  3GV4 A;  3KV5 A;  1ZBD B;  4BHW A;  4AP4 A;  3O37 A;  3SOU A;  4FK5 A;  4A0C D;  4C9Z A;  3N9N A;  2M3H A;  2K1J A;  1HYJ A;  4S3O C;  1WES A;  2YQL A;  4YAT A;  3ZVY A;  3FL2 A;  2EGP A;  1WEV A;  4GND A;  4UP0 A;  2HYE D;  4YBM A;  3MHH A;  2VPE A;  4L7X A;  5C11 A;  2BAY A;  2C2V S;  3O70 A;  5LKT A;  3N9L A;  1WEP A;  2CKL B;  5D1L B;  4A49 A;  2QJ0 A;  4MVT A;  4R2Y A;  4CA1 A;  2VNF A;  3C6W A;  3MHS A;  4GNF A;  1VD4 A;  3HCU A;  4GNG A;  1WEQ A;  4WZ2 A;  4V3L C;  1BOR A;  2CT2 A;  3U5P A;  2K4D A;  2YUR A;  2ECJ A;  2KYU A;  2IDA A;  5TRB A;  4S3O B;  3EB6 A;  1G25 A;  3QZV A;  1Z60 A;  2JMJ A;  3ZTG A;  4P5O B;  4L58 A;  4WZ0 A;  1E4U A;  1N87 A;  2F42 A;  4QF2 A;  2LRI C;  1WGM A;  5TDW A;  2M85 A;  3N9P A;  2Y1N A;  4NN2 A;  1Z2Q A;  2YQM A;  3T7L A;  4LLB A;  3L11 A;  3T6R A;  2FUU A;  2ECN A;  1MM3 A;  3GL6 A;  2LGK A;  2L80 A;  5G04 B;  1FP0 A;  5FB1 A;  4R7E A;  4PTB A;  1LDJ B;  5I3L A;  2PNX A;  1V87 A;  4LJN A;  1HYI A;  4LK9 A;  5H1T A;  5B76 A;  3PHD A;  2UZG A;  2KWN A;  4YAB A;  3LQJ A;  1DVP A;  4I7C A;  4QF3 A;  3ASL A;  4IC3 A;  4O64 A;  4YAD A;  2QIZ A;  4YBS A;  2LDR A;  3O36 A;  1XWH A;  3KNV A;  3LQH A;  5J3X A;  2CSZ A;  2YSM A;  2LQ6 A;  2HDP A;  4FO9 A;  1WEU A;  2E6S A;  4ZUX U;  3RTR B;  2L43 A;  2RI7 A;  2G45 A;  3M63 A;  5LKU A;  1X4U A;  5DKA A;  2XEU A;  3U5N A;  3N9O A;  3LQI A;  5B8D A;  2JMD A;  4FIP A;  2QIC A;  5FEY A;  2MIQ A;  2L5U A;  3N9Q A;  2VJE B;  3DPL R;  4GB0 A;  3SOX A;  4ZQL A;  3SOW A;  4AVX A;  1WEE A;  2L0B A;  3O33 A;  3ZPV 1;  5H9M A;  2EOD A;  2VPG A;  2FSA A;  2D8S A;  5G0F A;  2YT5 A;  2G43 A;  3LRQ A;  5AIT A;  4YBT A;  1JM7 A;  4UP5 A;  2YRE A;  4YAX A;  2ZET C;  3EB5 A;  3N9M A;  2YUC A;  1F62 A;  2KRE A;  3ZVZ B;  4A4B A;  2K17 A;  2Y43 A;  4WA6 A;  1WIM A;  4TKP B;  2ECT A;  2LN0 A;  2YHN A;  5EYA F;  4PPE A;  5KH9 A;  4F52 B;  5FER A;  4UI9 B;  2H0D B;  5B77 A;  2KWO A;  4ZDT A;  2MT5 A;  1U6G B;  3V43 A;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...