2MIQA

Solution nmr structure of phd type 1 zinc finger domain 1 of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium (nesg) target fr824j
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
b'SHMSGGSPLATGTTANTRGASQKKGGEPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase lid
publication title Solution NMR Structure of PHD Type 1 Zinc Finger Domain 1 from Lysine-specific Demethylase Lid from Drosophila melanogaster, Northeast Structural Genomics Consortium (NESG) Target FR824J
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 8
structure length 94
sequence length 94
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2miqA00
2M85A 3VK6A 2K17A 5H9MA 2KWNA 4YBSA 3N9QA 3T7LA 2LQ6A 4WZ3B 4L7XA 4L58A 4MSXA 4ZUXU 2VPDA 1U6GB 3FL2A 2ECTA 2G6QA 3U5MA 5KH3A 1T1HA 2ECNA 2QIZA 3HCUA 2MNZA 5B77A 1E4UA 5D1MB 3RTRB 4A4BA 4WZ2A 5D1LB 4YATA 2VJFA 3L11A 5AIUA 4AYCA 3O33A 3I2DA 1LDJB 2YU4A 3ZYQA 3ZPVE 4R7EA 5FEYA 4S3OC 4Q6FA 3MHHA 3NG2A 5B75A 1HYIA 2C2VS 2YW8A 3DPLR 5C11A 3SOUA 4P5OB 2HDPA 4WZ0A 2H0DA 5H1TA 2VJFB 1WESA 4AYCB 2XEUA 3M63A 2F42A 4GNGA 4BHWA 2L5UA 3O35A 3LQIA 2MD7B 2I50A 2RSDA 2YQLA 3N9LA 4LADB 2VP7A 5D1KB 2KGIA 3U5OA 1MM2A 1DVPA 3O7AA 3ZVZB 5TDRA 1F62A 4R2YA 2VJEB 2ECIA 4PPEA 1XWHA 3HCSA 1WEMA 4A0CD 1HYJA 5LKTA 5B8DA 4QF3A 2QJ0A 5G04B 2FUIA 1FP0A 1MM3A 1VYXA 2L43A 1WEWA 4IC2A 2LXHC 3KNVA 4TKPB 4CA1A 2KGGA 2KWKA 4ZQLA 4YAXA 4PTBA 4LK9A 5EYAF 1WEUA 2YHOA 4GNDA 4I7BA 1Z60A 4FO9A 5H1UA 4I7DA 2LDRA 2NAAA 3PURA 3L1ZB 1Z2QA 3IHPA 4YC9A 2M1RA 2MA5A 2ZETC 1VD4A 3ASLA 3DQVR 4YBMA 2JRJA 3QZVA 1WE9A 3KV5A 4LKAA 1CHCA 3O37A 2KR4A 1X4IA 1WEQA 2CKLA 3KQIA 4N3WA 3HCTA 1ZBDB 2FSAA 3SOWA 3EB5A 2KFTA 2YYRA 1JM7A 1WEVA 2D8SA 1WIMA 3HTKC 2BAYA 5FERA 2LGLA 5KH7A 4A49A 2MD8C 2LV9A 2K4DA 2IDAA 2CKLB 5B79A 2LXPC 5KH9A 1X4UA 4C9ZA 2ECJA 3O34A 5I3LA 4WA6A 2DX8A 3O36A 2L0BA 3SHBA 3RPGB 4FIPA 2ECVA 1WFKA 2G43A 4ZDTA 3C5KA 4A4CA 2E6RA 4W4UA 2JMJA 2E6SA 2XB1A 4V3LC 5LKZA 2L75A 2LGVA 1WEOA 2MNYA 2KE1A 4YBTA 2LGKA 1V87A 1IYMA 2K1JA 5DINA 3L1XA 2H0DB 3EB6A 2HYED 4GB0A 1FBVA 5LKUA 4X3GA 4AP4A 1RMDA 2KYUA 3N9PA 4AVXA 4F52B 2ECWA 3RPGC 5TABA 1WGMA 2EODA 2YQMA 2KIZA 5B78A 2EA6A 3SOXA 3N9MA 3KV6A 3N9NA 2JMIA 4V3KC 2CSYA 3ZTGA 2CT2A 3ZNIA 2PNXA 5H1VA 3LQJA 3LQHA 1X4JA 1G25A 2Y1NA 3PHDA 2MA6A 2CSZA 2KWJA 4I7CA 5FB0A 2LRIC 2YUCA 4FK5A 4BBQA 4S3OB 1WEPA 1LDKC 5AITA 3MHSA 4MVTA 2RI7A 4UP0A 5TBNA 5G0FA 2M6MA 2F6JA 4B86C 4UI9B 4NN2A 2AN6A 5DKAA 2K16A 5TDWA 2EGPA 2MUMA 2QICA 2YT5A 1BORA 1JM7B 1N87A 5LKXA 5FB1A 2KU3A 2FUUA 4IC3A 4QF2A 5B76A 2LN0A 2LGGA 1VFYA 2YREA 2L80A 4AUQB 2MIQA 5JG6A 2YHNA 3LRQA 5G05B 3U5PA 4YADA 4GNFA 2Y43A 2VJEA 2MT5A 2UZGA 1JOCA 5C13A 4N4FA 3U5NA 2VNFA 3V43A 2Y1MA 5J3XA 1WILA 2ECGA 2KWOA 2YSMA 4B7YC 3C6WA 2YURA 3N9OA 3ZVYA 1Z6UA 3PUQA 1WENA 3GL6A 4CCGX 3M99A 2YSJA 2OXQC 2M3HA 3ZPV1 2C2LA 4FJCA 5TRBA 4O64A 1K2FA 2VPEA 5LCWB 2VPBA 2G45A 4GNEA 2VPGA 2KREA 4R8PK 4LLBA 3T6RA 2F6NA 3GV4A 4XI1A 1WEEA 4YABA 2JMDA 4LJNA 4UP5A 3M62A 2PUYA 3O70A
chains in the Genus database with same CATH superfamily
2M85A 3VK6A 2K17A 5H9MA 5SVIA 2KWNA 5K3QA 3N9QA 4YBSA 3T7LA 2LQ6A 4WZ3B 4L7XA 4L58A 4MSXA 4OGEA 4ZUXU 2VPDA 1U6GB 3FL2A 2ECTA 3LVQE 2G6QA 3U5MA 5KH3A 1T1HA 2ECNA 2QIZA 3HCUA 5SVXA 2MNZA 5B77A 1E4UA 5D1MB 3RTRB 3DDTA 2XOZA 4A4BA 4WZ2A 2FD4A 5D1LB 4YATA 2VJFA 3L11A 5AIUA 4AYCA 3O33A 3I2DA 1LDJB 2YU4A 3ZYQA 2FFWA 3ZPVE 3FANA 4R7EA 5FEYA 4S3OC 4Q6FA 3MHHA 3NG2A 5B75A 1HYIA 2C2VS 2YW8A 3DPLR 3LJUX 5C11A 3DWDA 3SOUA 4P5OB 3FJUB 2HDPA 4WZ0A 2H0DA 5H1TA 4Z0OA 2VJFB 1WESA 4AYCB 2XEUA 2D8UA 3M63A 2F42A 4GNGA 4BHWA 2L5UA 2CONA 3O35A 3LQIA 2MD7B 2I50A 2RSDA 2YVRA 2YQLA 3N9LA 4LADB 2VP7A 4OGCA 5D1KB 3LDYA 2KGIA 3U5OA 3KDEC 1MM2A 1DVPA 3O7AA 3ZVZB 2XP0A 5TDRA 1F62A 4R2YA 2VJEB 2ECIA 2JM3A 4PPEA 1XWHA 3HCSA 1WEMA 4A0CD 1HYJA 5LKTA 5B8DA 4QF3A 2QJ0A 5G04B 2FUIA 1FP0A 1MM3A 1VYXA 2L43A 1WEWA 4IC2A 2LXHC 3KNVA 4TKPB 4CA1A 2KGGA 2KWKA 4ZQLA 4YAXA 4PTBA 4LK9A 5EYAF 1WEUA 2YHOA 4GNDA 4I7BA 1Z60A 4FO9A 5H1UA 4I7DA 2LDRA 2NAAA 2CSVA 3PURA 3L1ZB 1Z2QA 3IHPA 4YC9A 3H7HA 2M1RA 2MA5A 2ZETC 1VD4A 2RR4A 3ASLA 3DQVR 4YBMA 2JRJA 3QZVA 1WE9A 3KV5A 4LKAA 1CHCA 3O37A 2EGMA 2KR4A 1X4IA 1WEQA 2CKLA 3KQIA 5SVIB 4N3WA 2KKXA 3HCTA 1ZBDB 2FSAA 3SOWA 3EB5A 3O47A 2KFTA 2YYRA 1JM7A 1WEVA 2D8SA 1WIMA 2E61A 3LVRE 3HTKC 2BAYA 2EXUA 5FERA 2LGLA 5KH7A 4A49A 2MD8C 2LV9A 3FAOA 2K4DA 2IDAA 2CKLB 5B79A 2LXPC 5KH9A 1X4UA 4C9ZA 2ECJA 3O34A 5I3LA 4WA6A 2DX8A 2CRRA 3O36A 2L0BA 3SHBA 3RPGB 4FIPA 2ECVA 1WFKA 2G43A 4ZDTA 2LAUA 2M13A 3C5KA 4A4CA 2E6RA 4W4UA 2JMJA 2E6SA 2XB1A 4V3LC 5LKZA 2L75A 2LGVA 1WEOA 2MNYA 2KE1A 2P57A 4YBTA 2LGKA 1V87A 2B0OE 1IYMA 2K1JA 5DINA 3L1XA 2H0DB 3EB6A 2HYED 4GB0A 1FBVA 5LKUA 4X3GA 4AP4A 3E2DA 1RMDA 2KYUA 3N9PA 4AVXA 4F52B 3Q1DA 2ECWA 3RPGC 5TABA 1WGMA 2EODA 2YQMA 2KIZA 5B78A 2EA6A 4H9DA 3JUEA 3SOXA 3N9MA 3KV6A 3N9NA 2JMIA 4V3KC 2CSYA 3ZTGA 3T9KA 2CT2A 3ZNIA 2PNXA 5H1VA 3LQJA 3LQHA 1X4JA 1G25A 2CRWA 2Y1NA 3PLWA 3PHDA 2MKEA 2MA6A 2CSZA 2KWJA 4I7CA 5FB0A 2LRIC 2YUCA 4FK5A 4BBQA 2DJAA 4S3OB 1WEPA 1LDKC 5AITA 3MHSA 4MVTA 2RI7A 4UP0A 5TBNA 5G0FA 2M6MA 2F6JA 4B86C 4UI9B 4NN2A 1DCQA 2AN6A 2DSMA 2XOCA 5SVYA 5DKAA 2JUNA 2K16A 5TDWA 2EGPA 2OWAA 2MUMA 2QICA 2YT5A 4O62A 1BORA 1JM7B 1N87A 5LKXA 2L7PA 3MDBC 5FB1A 2KU3A 1MBMA 2FUUA 4IC3A 4QF2A 5B76A 2LN0A 2LGGA 1VFYA 2YREA 3M7KA 3SUBA 2L80A 4AUQB 2MIQA 5JG6A 2YHNA 3LRQA 4QQ4A 5G05B 2IQJA 3U5PA 4YADA 4GNFA 2Y43A 2VJEA 2MT5A 2UZGA 1JOCA 5C13A 4N4FA 3U5NA 3FM8C 2VNFA 3V43A 2Y1MA 5J3XA 1WILA 2ECGA 2KKYA 2KWOA 2YSMA 4B7YC 3C6WA 2YURA 3N9OA 4F1PA 3ZVYA 1Z6UA 3PUQA 1WENA 3GL6A 4CCGX 3M99A 2YSJA 2OXQC 3FEHA 2M3HA 3ZPV1 2C2LA 4FJCA 5TRBA 4Z0RA 4O64A 1K2FA 2VPEA 5LCWB 2VPBA 2G45A 4GNEA 2XOYA 2VPGA 2KREA 4R8PK 4LLBA 3T6RA 2F6NA 3GV4A 4XI1A 1WEEA 4YABA 2JMDA 4LJNA 4UP5A 3M62A 2PUYA 3O70A
chains in the Genus database with same CATH topology
2M85A 3VK6A 2K17A 5H9MA 2KWNA 4YBSA 3N9QA 3T7LA 2LQ6A 4WZ3B 4L7XA 4L58A 4MSXA 4ZUXU 2VPDA 1U6GB 3FL2A 2ECTA 2G6QA 3U5MA 5KH3A 1T1HA 2ECNA 2QIZA 3HCUA 2MNZA 5B77A 1E4UA 5D1MB 3RTRB 4A4BA 4WZ2A 5D1LB 4YATA 2VJFA 3L11A 5AIUA 4AYCA 3O33A 3I2DA 1LDJB 2YU4A 3ZYQA 3ZPVE 4R7EA 5FEYA 4S3OC 4Q6FA 3MHHA 3NG2A 5B75A 1HYIA 2C2VS 2YW8A 3DPLR 5C11A 3SOUA 4P5OB 2HDPA 4WZ0A 2H0DA 5H1TA 2VJFB 1WESA 4AYCB 2XEUA 3M63A 2F42A 4GNGA 4BHWA 2L5UA 3O35A 3LQIA 2MD7B 2I50A 2RSDA 2YQLA 3N9LA 4LADB 2VP7A 5D1KB 2KGIA 3U5OA 1MM2A 1DVPA 3O7AA 3ZVZB 5TDRA 1F62A 4R2YA 2VJEB 2ECIA 4PPEA 1XWHA 3HCSA 1WEMA 4A0CD 1HYJA 5LKTA 5B8DA 4QF3A 2QJ0A 5G04B 2FUIA 1FP0A 1MM3A 1VYXA 2L43A 1WEWA 4IC2A 2LXHC 3KNVA 4TKPB 4CA1A 2KGGA 2KWKA 4ZQLA 4YAXA 4PTBA 4LK9A 5EYAF 1WEUA 2YHOA 4GNDA 4I7BA 1Z60A 4FO9A 5H1UA 4I7DA 2LDRA 2NAAA 3PURA 3L1ZB 1Z2QA 3IHPA 4YC9A 2M1RA 2MA5A 2ZETC 1VD4A 3ASLA 3DQVR 4YBMA 2JRJA 3QZVA 1WE9A 3KV5A 4LKAA 1CHCA 3O37A 2KR4A 1X4IA 1WEQA 2CKLA 3KQIA 4N3WA 3HCTA 1ZBDB 2FSAA 3SOWA 3EB5A 2KFTA 2YYRA 1JM7A 1WEVA 2D8SA 1WIMA 3HTKC 2BAYA 5FERA 2LGLA 5KH7A 4A49A 2MD8C 2LV9A 2K4DA 2IDAA 2CKLB 5B79A 2LXPC 5KH9A 1X4UA 4C9ZA 2ECJA 3O34A 5I3LA 4WA6A 2DX8A 3O36A 2L0BA 3SHBA 3RPGB 4FIPA 2ECVA 1WFKA 2G43A 4ZDTA 3C5KA 4A4CA 2E6RA 4W4UA 2JMJA 2E6SA 2XB1A 4V3LC 5LKZA 2L75A 2LGVA 1WEOA 2MNYA 2KE1A 4YBTA 2LGKA 1V87A 1IYMA 2K1JA 5DINA 3L1XA 2H0DB 3EB6A 2HYED 4GB0A 1FBVA 5LKUA 4X3GA 4AP4A 1RMDA 2KYUA 3N9PA 4AVXA 4F52B 2ECWA 3RPGC 5TABA 1WGMA 2EODA 2YQMA 2KIZA 5B78A 2EA6A 3SOXA 3N9MA 3KV6A 3N9NA 2JMIA 4V3KC 2CSYA 3ZTGA 2CT2A 3ZNIA 2PNXA 5H1VA 3LQJA 3LQHA 1X4JA 1G25A 2Y1NA 3PHDA 2MA6A 2CSZA 2KWJA 4I7CA 5FB0A 2LRIC 2YUCA 4FK5A 4BBQA 4S3OB 1WEPA 1LDKC 5AITA 3MHSA 4MVTA 2RI7A 4UP0A 5TBNA 5G0FA 2M6MA 2F6JA 4B86C 4UI9B 4NN2A 2AN6A 5DKAA 2K16A 5TDWA 2EGPA 2MUMA 2QICA 2YT5A 1BORA 1JM7B 1N87A 5LKXA 5FB1A 2KU3A 2FUUA 4IC3A 4QF2A 5B76A 2LN0A 2LGGA 1VFYA 2YREA 2L80A 4AUQB 2MIQA 5JG6A 2YHNA 3LRQA 5G05B 3U5PA 4YADA 4GNFA 2Y43A 2VJEA 2MT5A 2UZGA 1JOCA 5C13A 4N4FA 3U5NA 2VNFA 3V43A 2Y1MA 5J3XA 1WILA 2ECGA 2KWOA 2YSMA 4B7YC 3C6WA 2YURA 3N9OA 3ZVYA 1Z6UA 3PUQA 1WENA 3GL6A 4CCGX 3M99A 2YSJA 2OXQC 2M3HA 3ZPV1 2C2LA 4FJCA 5TRBA 4O64A 1K2FA 2VPEA 5LCWB 2VPBA 2G45A 4GNEA 2VPGA 2KREA 4R8PK 4LLBA 3T6RA 2F6NA 3GV4A 4XI1A 1WEEA 4YABA 2JMDA 4LJNA 4UP5A 3M62A 2PUYA 3O70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M85 A;  3VK6 A;  2K17 A;  5H9M A;  2KWN A;  4YBS A;  3N9Q A;  3T7L A;  2LQ6 A;  4WZ3 B;  4L7X A;  4L58 A;  4MSX A;  4ZUX U;  2VPD A;  1U6G B;  3FL2 A;  2ECT A;  2G6Q A;  3U5M A;  5KH3 A;  1T1H A;  2ECN A;  2QIZ A;  3HCU A;  2MNZ A;  5B77 A;  1E4U A;  5D1M B;  3RTR B;  4A4B A;  4WZ2 A;  5D1L B;  4YAT A;  2VJF A;  3L11 A;  5AIU A;  4AYC A;  3O33 A;  3I2D A;  1LDJ B;  2YU4 A;  3ZYQ A;  3ZPV E;  4R7E A;  5FEY A;  4S3O C;  4Q6F A;  3MHH A;  3NG2 A;  5B75 A;  1HYI A;  2C2V S;  2YW8 A;  3DPL R;  5C11 A;  3SOU A;  4P5O B;  2HDP A;  4WZ0 A;  2H0D A;  5H1T A;  2VJF B;  1WES A;  4AYC B;  2XEU A;  3M63 A;  2F42 A;  4GNG A;  4BHW A;  2L5U A;  3O35 A;  3LQI A;  2MD7 B;  2I50 A;  2RSD A;  2YQL A;  3N9L A;  4LAD B;  2VP7 A;  5D1K B;  2KGI A;  3U5O A;  1MM2 A;  1DVP A;  3O7A A;  3ZVZ B;  5TDR A;  1F62 A;  4R2Y A;  2VJE B;  2ECI A;  4PPE A;  1XWH A;  3HCS A;  1WEM A;  4A0C D;  1HYJ A;  5LKT A;  5B8D A;  4QF3 A;  2QJ0 A;  5G04 B;  2FUI A;  1FP0 A;  1MM3 A;  1VYX A;  2L43 A;  1WEW A;  4IC2 A;  2LXH C;  3KNV A;  4TKP B;  4CA1 A;  2KGG A;  2KWK A;  4ZQL A;  4YAX A;  4PTB A;  4LK9 A;  5EYA F;  1WEU A;  2YHO A;  4GND A;  4I7B A;  1Z60 A;  4FO9 A;  5H1U A;  4I7D A;  2LDR A;  2NAA A;  3PUR A;  3L1Z B;  1Z2Q A;  3IHP A;  4YC9 A;  2M1R A;  2MA5 A;  2ZET C;  1VD4 A;  3ASL A;  3DQV R;  4YBM A;  2JRJ A;  3QZV A;  1WE9 A;  3KV5 A;  4LKA A;  1CHC A;  3O37 A;  2KR4 A;  1X4I A;  1WEQ A;  2CKL A;  3KQI A;  4N3W A;  3HCT A;  1ZBD B;  2FSA A;  3SOW A;  3EB5 A;  2KFT A;  2YYR A;  1JM7 A;  1WEV A;  2D8S A;  1WIM A;  3HTK C;  2BAY A;  5FER A;  2LGL A;  5KH7 A;  4A49 A;  2MD8 C;  2LV9 A;  2K4D A;  2IDA A;  2CKL B;  5B79 A;  2LXP C;  5KH9 A;  1X4U A;  4C9Z A;  2ECJ A;  3O34 A;  5I3L A;  4WA6 A;  2DX8 A;  3O36 A;  2L0B A;  3SHB A;  3RPG B;  4FIP A;  2ECV A;  1WFK A;  2G43 A;  4ZDT A;  3C5K A;  4A4C A;  2E6R A;  4W4U A;  2JMJ A;  2E6S A;  2XB1 A;  4V3L C;  5LKZ A;  2L75 A;  2LGV A;  1WEO A;  2MNY A;  2KE1 A;  4YBT A;  2LGK A;  1V87 A;  1IYM A;  2K1J A;  5DIN A;  3L1X A;  2H0D B;  3EB6 A;  2HYE D;  4GB0 A;  1FBV A;  5LKU A;  4X3G A;  4AP4 A;  1RMD A;  2KYU A;  3N9P A;  4AVX A;  4F52 B;  2ECW A;  3RPG C;  5TAB A;  1WGM A;  2EOD A;  2YQM A;  2KIZ A;  5B78 A;  2EA6 A;  3SOX A;  3N9M A;  3KV6 A;  3N9N A;  2JMI A;  4V3K C;  2CSY A;  3ZTG A;  2CT2 A;  3ZNI A;  2PNX A;  5H1V A;  3LQJ A;  3LQH A;  1X4J A;  1G25 A;  2Y1N A;  3PHD A;  2MA6 A;  2CSZ A;  2KWJ A;  4I7C A;  5FB0 A;  2LRI C;  2YUC A;  4FK5 A;  4BBQ A;  4S3O B;  1WEP A;  1LDK C;  5AIT A;  3MHS A;  4MVT A;  2RI7 A;  4UP0 A;  5TBN A;  5G0F A;  2M6M A;  2F6J A;  4B86 C;  4UI9 B;  4NN2 A;  2AN6 A;  5DKA A;  2K16 A;  5TDW A;  2EGP A;  2MUM A;  2QIC A;  2YT5 A;  1BOR A;  1JM7 B;  1N87 A;  5LKX A;  5FB1 A;  2KU3 A;  2FUU A;  4IC3 A;  4QF2 A;  5B76 A;  2LN0 A;  2LGG A;  1VFY A;  2YRE A;  2L80 A;  4AUQ B;  2MIQ A;  5JG6 A;  2YHN A;  3LRQ A;  5G05 B;  3U5P A;  4YAD A;  4GNF A;  2Y43 A;  2VJE A;  2MT5 A;  2UZG A;  1JOC A;  5C13 A;  4N4F A;  3U5N A;  2VNF A;  3V43 A;  2Y1M A;  5J3X A;  1WIL A;  2ECG A;  2KWO A;  2YSM A;  4B7Y C;  3C6W A;  2YUR A;  3N9O A;  3ZVY A;  1Z6U A;  3PUQ A;  1WEN A;  3GL6 A;  4CCG X;  3M99 A;  2YSJ A;  2OXQ C;  2M3H A;  3ZPV 1;  2C2L A;  4FJC A;  5TRB A;  4O64 A;  1K2F A;  2VPE A;  5LCW B;  2VPB A;  2G45 A;  4GNE A;  2VPG A;  2KRE A;  4R8P K;  4LLB A;  3T6R A;  2F6N A;  3GV4 A;  4XI1 A;  1WEE A;  4YAB A;  2JMD A;  4LJN A;  4UP5 A;  3M62 A;  2PUY A;  3O70 A; 
#chains in the Genus database with same CATH topology
 2M85 A;  3VK6 A;  2K17 A;  5H9M A;  5SVI A;  2KWN A;  5K3Q A;  3N9Q A;  4YBS A;  3T7L A;  2LQ6 A;  4WZ3 B;  4L7X A;  4L58 A;  4MSX A;  4OGE A;  4ZUX U;  2VPD A;  1U6G B;  3FL2 A;  2ECT A;  3LVQ E;  2G6Q A;  3U5M A;  5KH3 A;  1T1H A;  2ECN A;  2QIZ A;  3HCU A;  5SVX A;  2MNZ A;  5B77 A;  1E4U A;  5D1M B;  3RTR B;  3DDT A;  2XOZ A;  4A4B A;  4WZ2 A;  2FD4 A;  5D1L B;  4YAT A;  2VJF A;  3L11 A;  5AIU A;  4AYC A;  3O33 A;  3I2D A;  1LDJ B;  2YU4 A;  3ZYQ A;  2FFW A;  3ZPV E;  3FAN A;  4R7E A;  5FEY A;  4S3O C;  4Q6F A;  3MHH A;  3NG2 A;  5B75 A;  1HYI A;  2C2V S;  2YW8 A;  3DPL R;  3LJU X;  5C11 A;  3DWD A;  3SOU A;  4P5O B;  3FJU B;  2HDP A;  4WZ0 A;  2H0D A;  5H1T A;  4Z0O A;  2VJF B;  1WES A;  4AYC B;  2XEU A;  2D8U A;  3M63 A;  2F42 A;  4GNG A;  4BHW A;  2L5U A;  2CON A;  3O35 A;  3LQI A;  2MD7 B;  2I50 A;  2RSD A;  2YVR A;  2YQL A;  3N9L A;  4LAD B;  2VP7 A;  4OGC A;  5D1K B;  3LDY A;  2KGI A;  3U5O A;  3KDE C;  1MM2 A;  1DVP A;  3O7A A;  3ZVZ B;  2XP0 A;  5TDR A;  1F62 A;  4R2Y A;  2VJE B;  2ECI A;  2JM3 A;  4PPE A;  1XWH A;  3HCS A;  1WEM A;  4A0C D;  1HYJ A;  5LKT A;  5B8D A;  4QF3 A;  2QJ0 A;  5G04 B;  2FUI A;  1FP0 A;  1MM3 A;  1VYX A;  2L43 A;  1WEW A;  4IC2 A;  2LXH C;  3KNV A;  4TKP B;  4CA1 A;  2KGG A;  2KWK A;  4ZQL A;  4YAX A;  4PTB A;  4LK9 A;  5EYA F;  1WEU A;  2YHO A;  4GND A;  4I7B A;  1Z60 A;  4FO9 A;  5H1U A;  4I7D A;  2LDR A;  2NAA A;  2CSV A;  3PUR A;  3L1Z B;  1Z2Q A;  3IHP A;  4YC9 A;  3H7H A;  2M1R A;  2MA5 A;  2ZET C;  1VD4 A;  2RR4 A;  3ASL A;  3DQV R;  4YBM A;  2JRJ A;  3QZV A;  1WE9 A;  3KV5 A;  4LKA A;  1CHC A;  3O37 A;  2EGM A;  2KR4 A;  1X4I A;  1WEQ A;  2CKL A;  3KQI A;  5SVI B;  4N3W A;  2KKX A;  3HCT A;  1ZBD B;  2FSA A;  3SOW A;  3EB5 A;  3O47 A;  2KFT A;  2YYR A;  1JM7 A;  1WEV A;  2D8S A;  1WIM A;  2E61 A;  3LVR E;  3HTK C;  2BAY A;  2EXU A;  5FER A;  2LGL A;  5KH7 A;  4A49 A;  2MD8 C;  2LV9 A;  3FAO A;  2K4D A;  2IDA A;  2CKL B;  5B79 A;  2LXP C;  5KH9 A;  1X4U A;  4C9Z A;  2ECJ A;  3O34 A;  5I3L A;  4WA6 A;  2DX8 A;  2CRR A;  3O36 A;  2L0B A;  3SHB A;  3RPG B;  4FIP A;  2ECV A;  1WFK A;  2G43 A;  4ZDT A;  2LAU A;  2M13 A;  3C5K A;  4A4C A;  2E6R A;  4W4U A;  2JMJ A;  2E6S A;  2XB1 A;  4V3L C;  5LKZ A;  2L75 A;  2LGV A;  1WEO A;  2MNY A;  2KE1 A;  2P57 A;  4YBT A;  2LGK A;  1V87 A;  2B0O E;  1IYM A;  2K1J A;  5DIN A;  3L1X A;  2H0D B;  3EB6 A;  2HYE D;  4GB0 A;  1FBV A;  5LKU A;  4X3G A;  4AP4 A;  3E2D A;  1RMD A;  2KYU A;  3N9P A;  4AVX A;  4F52 B;  3Q1D A;  2ECW A;  3RPG C;  5TAB A;  1WGM A;  2EOD A;  2YQM A;  2KIZ A;  5B78 A;  2EA6 A;  4H9D A;  3JUE A;  3SOX A;  3N9M A;  3KV6 A;  3N9N A;  2JMI A;  4V3K C;  2CSY A;  3ZTG A;  3T9K A;  2CT2 A;  3ZNI A;  2PNX A;  5H1V A;  3LQJ A;  3LQH A;  1X4J A;  1G25 A;  2CRW A;  2Y1N A;  3PLW A;  3PHD A;  2MKE A;  2MA6 A;  2CSZ A;  2KWJ A;  4I7C A;  5FB0 A;  2LRI C;  2YUC A;  4FK5 A;  4BBQ A;  2DJA A;  4S3O B;  1WEP A;  1LDK C;  5AIT A;  3MHS A;  4MVT A;  2RI7 A;  4UP0 A;  5TBN A;  5G0F A;  2M6M A;  2F6J A;  4B86 C;  4UI9 B;  4NN2 A;  1DCQ A;  2AN6 A;  2DSM A;  2XOC A;  5SVY A;  5DKA A;  2JUN A;  2K16 A;  5TDW A;  2EGP A;  2OWA A;  2MUM A;  2QIC A;  2YT5 A;  4O62 A;  1BOR A;  1JM7 B;  1N87 A;  5LKX A;  2L7P A;  3MDB C;  5FB1 A;  2KU3 A;  1MBM A;  2FUU A;  4IC3 A;  4QF2 A;  5B76 A;  2LN0 A;  2LGG A;  1VFY A;  2YRE A;  3M7K A;  3SUB A;  2L80 A;  4AUQ B;  2MIQ A;  5JG6 A;  2YHN A;  3LRQ A;  4QQ4 A;  5G05 B;  2IQJ A;  3U5P A;  4YAD A;  4GNF A;  2Y43 A;  2VJE A;  2MT5 A;  2UZG A;  1JOC A;  5C13 A;  4N4F A;  3U5N A;  3FM8 C;  2VNF A;  3V43 A;  2Y1M A;  5J3X A;  1WIL A;  2ECG A;  2KKY A;  2KWO A;  2YSM A;  4B7Y C;  3C6W A;  2YUR A;  3N9O A;  4F1P A;  3ZVY A;  1Z6U A;  3PUQ A;  1WEN A;  3GL6 A;  4CCG X;  3M99 A;  2YSJ A;  2OXQ C;  3FEH A;  2M3H A;  3ZPV 1;  2C2L A;  4FJC A;  5TRB A;  4Z0R A;  4O64 A;  1K2F A;  2VPE A;  5LCW B;  2VPB A;  2G45 A;  4GNE A;  2XOY A;  2VPG A;  2KRE A;  4R8P K;  4LLB A;  3T6R A;  2F6N A;  3GV4 A;  4XI1 A;  1WEE A;  4YAB A;  2JMD A;  4LJN A;  4UP5 A;  3M62 A;  2PUY A;  3O70 A; 
#chains in the Genus database with same CATH homology
 2M85 A;  3VK6 A;  2K17 A;  5H9M A;  2KWN A;  4YBS A;  3N9Q A;  3T7L A;  2LQ6 A;  4WZ3 B;  4L7X A;  4L58 A;  4MSX A;  4ZUX U;  2VPD A;  1U6G B;  3FL2 A;  2ECT A;  2G6Q A;  3U5M A;  5KH3 A;  1T1H A;  2ECN A;  2QIZ A;  3HCU A;  2MNZ A;  5B77 A;  1E4U A;  5D1M B;  3RTR B;  4A4B A;  4WZ2 A;  5D1L B;  4YAT A;  2VJF A;  3L11 A;  5AIU A;  4AYC A;  3O33 A;  3I2D A;  1LDJ B;  2YU4 A;  3ZYQ A;  3ZPV E;  4R7E A;  5FEY A;  4S3O C;  4Q6F A;  3MHH A;  3NG2 A;  5B75 A;  1HYI A;  2C2V S;  2YW8 A;  3DPL R;  5C11 A;  3SOU A;  4P5O B;  2HDP A;  4WZ0 A;  2H0D A;  5H1T A;  2VJF B;  1WES A;  4AYC B;  2XEU A;  3M63 A;  2F42 A;  4GNG A;  4BHW A;  2L5U A;  3O35 A;  3LQI A;  2MD7 B;  2I50 A;  2RSD A;  2YQL A;  3N9L A;  4LAD B;  2VP7 A;  5D1K B;  2KGI A;  3U5O A;  1MM2 A;  1DVP A;  3O7A A;  3ZVZ B;  5TDR A;  1F62 A;  4R2Y A;  2VJE B;  2ECI A;  4PPE A;  1XWH A;  3HCS A;  1WEM A;  4A0C D;  1HYJ A;  5LKT A;  5B8D A;  4QF3 A;  2QJ0 A;  5G04 B;  2FUI A;  1FP0 A;  1MM3 A;  1VYX A;  2L43 A;  1WEW A;  4IC2 A;  2LXH C;  3KNV A;  4TKP B;  4CA1 A;  2KGG A;  2KWK A;  4ZQL A;  4YAX A;  4PTB A;  4LK9 A;  5EYA F;  1WEU A;  2YHO A;  4GND A;  4I7B A;  1Z60 A;  4FO9 A;  5H1U A;  4I7D A;  2LDR A;  2NAA A;  3PUR A;  3L1Z B;  1Z2Q A;  3IHP A;  4YC9 A;  2M1R A;  2MA5 A;  2ZET C;  1VD4 A;  3ASL A;  3DQV R;  4YBM A;  2JRJ A;  3QZV A;  1WE9 A;  3KV5 A;  4LKA A;  1CHC A;  3O37 A;  2KR4 A;  1X4I A;  1WEQ A;  2CKL A;  3KQI A;  4N3W A;  3HCT A;  1ZBD B;  2FSA A;  3SOW A;  3EB5 A;  2KFT A;  2YYR A;  1JM7 A;  1WEV A;  2D8S A;  1WIM A;  3HTK C;  2BAY A;  5FER A;  2LGL A;  5KH7 A;  4A49 A;  2MD8 C;  2LV9 A;  2K4D A;  2IDA A;  2CKL B;  5B79 A;  2LXP C;  5KH9 A;  1X4U A;  4C9Z A;  2ECJ A;  3O34 A;  5I3L A;  4WA6 A;  2DX8 A;  3O36 A;  2L0B A;  3SHB A;  3RPG B;  4FIP A;  2ECV A;  1WFK A;  2G43 A;  4ZDT A;  3C5K A;  4A4C A;  2E6R A;  4W4U A;  2JMJ A;  2E6S A;  2XB1 A;  4V3L C;  5LKZ A;  2L75 A;  2LGV A;  1WEO A;  2MNY A;  2KE1 A;  4YBT A;  2LGK A;  1V87 A;  1IYM A;  2K1J A;  5DIN A;  3L1X A;  2H0D B;  3EB6 A;  2HYE D;  4GB0 A;  1FBV A;  5LKU A;  4X3G A;  4AP4 A;  1RMD A;  2KYU A;  3N9P A;  4AVX A;  4F52 B;  2ECW A;  3RPG C;  5TAB A;  1WGM A;  2EOD A;  2YQM A;  2KIZ A;  5B78 A;  2EA6 A;  3SOX A;  3N9M A;  3KV6 A;  3N9N A;  2JMI A;  4V3K C;  2CSY A;  3ZTG A;  2CT2 A;  3ZNI A;  2PNX A;  5H1V A;  3LQJ A;  3LQH A;  1X4J A;  1G25 A;  2Y1N A;  3PHD A;  2MA6 A;  2CSZ A;  2KWJ A;  4I7C A;  5FB0 A;  2LRI C;  2YUC A;  4FK5 A;  4BBQ A;  4S3O B;  1WEP A;  1LDK C;  5AIT A;  3MHS A;  4MVT A;  2RI7 A;  4UP0 A;  5TBN A;  5G0F A;  2M6M A;  2F6J A;  4B86 C;  4UI9 B;  4NN2 A;  2AN6 A;  5DKA A;  2K16 A;  5TDW A;  2EGP A;  2MUM A;  2QIC A;  2YT5 A;  1BOR A;  1JM7 B;  1N87 A;  5LKX A;  5FB1 A;  2KU3 A;  2FUU A;  4IC3 A;  4QF2 A;  5B76 A;  2LN0 A;  2LGG A;  1VFY A;  2YRE A;  2L80 A;  4AUQ B;  2MIQ A;  5JG6 A;  2YHN A;  3LRQ A;  5G05 B;  3U5P A;  4YAD A;  4GNF A;  2Y43 A;  2VJE A;  2MT5 A;  2UZG A;  1JOC A;  5C13 A;  4N4F A;  3U5N A;  2VNF A;  3V43 A;  2Y1M A;  5J3X A;  1WIL A;  2ECG A;  2KWO A;  2YSM A;  4B7Y C;  3C6W A;  2YUR A;  3N9O A;  3ZVY A;  1Z6U A;  3PUQ A;  1WEN A;  3GL6 A;  4CCG X;  3M99 A;  2YSJ A;  2OXQ C;  2M3H A;  3ZPV 1;  2C2L A;  4FJC A;  5TRB A;  4O64 A;  1K2F A;  2VPE A;  5LCW B;  2VPB A;  2G45 A;  4GNE A;  2VPG A;  2KRE A;  4R8P K;  4LLB A;  3T6R A;  2F6N A;  3GV4 A;  4XI1 A;  1WEE A;  4YAB A;  2JMD A;  4LJN A;  4UP5 A;  3M62 A;  2PUY A;  3O70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...