2MIQA

Solution nmr structure of phd type 1 zinc finger domain 1 of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium (nesg) target fr824j
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
SHMSGGSPLATGTTANTRGASQKKGGEPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of PHD Type 1 Zinc Finger Domain 1 from Lysine-specific Demethylase Lid from Drosophila melanogaster, Northeast Structural Genomics Consortium (NESG) Target FR824J
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase lid
total genus 8
structure length 94
sequence length 94
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2miqA00
1VFYA 2VPDA 5FEYA 4BHWA 4I7DA 4YATA 2K1JA 3GL6A 1WEMA 2XEUA 3PHDA 2YQLA 1VD4A 4R7EA 3FL2A 5C13A 2F42A 1WEUA 4XI1A 5FERA 2VJEB 2DX8A 1F62A 3EB5A 2RI7A 2L0BA 3O34A 2VJFB 3LQHA 2CKLB 3DPLR 1MM2A 3HCUA 4FO9A 3RTRB 1LDJB 1G25A 1WEOA 4CCGX 4CA1A 4UI9B 2KIZA 1JOCA 2KWKA 2LXHC 5G0FA 2MIQA 1E4UA 5KH9A 3C5KA 2ECVA 3NG2A 5AIUA 1WENA 4A4BA 3LQJA 3SHBA 4YADA 4WA6A 3ZVYA 2K16A 4AYCA 4AUQB 4FIPA 2E6RA 2MD7B 4GNEA 4WZ3B 3GV4A 2Y43A 3U5PA 2KYUA 2M85A 2KFTA 3N9LA 2YYRA 4UP0A 4V3LC 1WEVA 1U6GB 3PUQA 2CSYA 2YQMA 2QIZA 2FUIA 2QJ0A 4W4UA 1HYJA 3C6WA 2YU4A 3ZTGA 5B8DA 1WIMA 4LJNA 2PNXA 2YSMA 1DVPA 3KV6A 4O64A 3N9OA 4AVXA 2EODA 2KE1A 5B77A 2KU3A 3N9PA 4L58A 5DINA 2ECGA 2F6NA 3KV5A 2G6QA 4I7CA 5EYAF 4A4CA 4LLBA 2ECJA 4YABA 2C2LA 4IC3A 2QICA 3HCSA 4GNFA 2RSDA 2I50A 2EA6A 1V87A 3O33A 3LQIA 3O7AA 1N87A 2KREA 3SOXA 2VP7A 3IHPA 2MT5A 5G04B 2K4DA 2LQ6A 2VNFA 3N9MA 4L7XA 2L5UA 4QF3A 3LRQA 4ZQLA 3I2DA 4WZ0A 4YBMA 2MA5A 1X4UA 1X4JA 5H1UA 3ZYQA 4PPEA 4MVTA 1BORA 2L80A 4TKPB 2JRJA 2E6SA 2OXQC 2PUYA 2MUMA 5D1MB 5LKUA 2BAYA 2LDRA 1WEEA 2YW8A 5H9MA 1JM7B 3N9NA 1HYIA 2LGKA 2ECWA 3QZVA 3T7LA 5FB0A 1IYMA 2KR4A 2MNZA 5KH3A 3L1ZB 3ZPV1 1Z6UA 5B76A 2Y1NA 2ZETC 2XB1A 2KGIA 3MHSA 4X3GA 3N9QA 2H0DB 4P5OB 4ZDTA 3U5NA 2LGVA 4S3OB 3KNVA 5TDWA 2KWJA 4UP5A 1WILA 4GNDA 3ZPVE 4V3KC 2M6MA 3EB6A 4AP4A 2ECNA 3MHHA 1WEQA 3O70A 4GB0A 3O36A 2FUUA 4YBTA 3SOWA 4S3OC 2VPEA 1K2FA 1LDKC 2LN0A 1WFKA 3RPGB 1WE9A 2C2VS 2G45A 2YT5A 5B79A 2MNYA 1Z60A 2ECIA 3KQIA 4A49A 2VJFA 4ZUXU 2KGGA 1WGMA 2CSZA 4NN2A 4YAXA 2D8SA 3O37A 5TDRA 3M62A 4A0CD 4WZ2A 2MA6A 4MSXA 2KWNA 5G05B 3M99A 2JMIA 4I7BA 4IC2A 4FJCA 3L11A 4B7YC 4LK9A 4C9ZA 1MM3A 4BBQA 4LADB 1RMDA 2VPBA 5H1VA 4N4FA 2YURA 2KWOA 2EGPA 2YHOA 5B75A 4AYCB 5D1LB 2HDPA 2CKLA 2YREA 5LKXA 2F6JA 1ZBDB 3ASLA 4R8PK 2M3HA 1FP0A 3O35A 4LKAA 2CT2A 2ECTA 2K17A 5JG6A 4PTBA 1WEPA 2L75A 3PURA 4YC9A 3ZVZB 2IDAA 2FSAA 2M1RA 1FBVA 3SOUA 3U5MA 2Y1MA 2HYED 2LGGA 1CHCA 5LCWB 2LRIC 2VJEA 4FK5A 2L43A 5FB1A 3VK6A 3M63A 1JM7A 5C11A 5D1KB 2LGLA 1WESA 2UZGA 5KH7A 2LXPC 1T1HA 5J3XA 5H1TA 1Z2QA 2VPGA 4N3WA 2MD8C 3T6RA 3U5OA 3HCTA 5LKTA 2YSJA 4Q6FA 3RPGC 2JMDA 2NAAA 1WEWA 5TRBA 5B78A 5I3LA 4R2YA 5TABA 4QF2A 4YBSA 3DQVR 1VYXA 4B86C 2AN6A 5AITA 2LV9A 2G43A 3HTKC 2YUCA 3L1XA 1XWHA 5TBNA 4F52B 5DKAA 3ZNIA 5LKZA 2JMJA 2H0DA 4GNGA 3V43A 2YHNA 1X4IA
chains in the Genus database with same CATH superfamily
2CONA 1VFYA 2VPDA 3FEHA 3DDTA 5FEYA 4BHWA 3FANA 4I7DA 4YATA 2K1JA 3GL6A 2DJAA 2B0OE 1WEMA 2XEUA 5K3QA 3PHDA 2YQLA 1VD4A 4R7EA 3FL2A 5C13A 2F42A 1WEUA 4XI1A 5FERA 2VJEB 2DX8A 1F62A 4QQ4A 3EB5A 2RI7A 2L0BA 3O34A 2VJFB 3LQHA 2CKLB 3DPLR 1MM2A 3HCUA 4FO9A 3RTRB 1LDJB 1G25A 1WEOA 4CCGX 3FM8C 4CA1A 4UI9B 2KIZA 1JOCA 2KWKA 2LXHC 5G0FA 2MIQA 1E4UA 5KH9A 3C5KA 2ECVA 3NG2A 5AIUA 1WENA 4A4BA 3LQJA 3SHBA 4YADA 4WA6A 2FD4A 3ZVYA 2K16A 2P57A 4AYCA 4AUQB 2CSVA 4FIPA 2E6RA 2MD7B 3JUEA 3E2DA 4GNEA 4WZ3B 3GV4A 2YVRA 2Y43A 3U5PA 2KYUA 2M85A 2KFTA 3N9LA 2YYRA 4UP0A 4V3LC 1WEVA 3LVQE 2JUNA 1U6GB 3PUQA 2CSYA 2YQMA 2QIZA 2FUIA 2QJ0A 4W4UA 1HYJA 3C6WA 2YU4A 3ZTGA 5B8DA 1WIMA 4LJNA 2PNXA 2YSMA 4Z0OA 1MBMA 1DVPA 3KV6A 4O64A 3N9OA 4AVXA 2EODA 2L7PA 2KE1A 5B77A 2KU3A 3N9PA 4L58A 5DINA 2ECGA 2F6NA 3KV5A 2G6QA 2LAUA 4I7CA 5EYAF 4A4CA 4LLBA 2ECJA 3O47A 4YABA 2C2LA 2XOCA 2XOZA 4IC3A 2QICA 3SUBA 3HCSA 4GNFA 2RSDA 2I50A 2EA6A 1V87A 3O33A 2OWAA 3LQIA 3O7AA 5SVYA 2MKEA 2KKXA 1N87A 2KREA 3Q1DA 3SOXA 2VP7A 3IHPA 3PLWA 2EXUA 2MT5A 5G04B 2K4DA 2LQ6A 2VNFA 3N9MA 4L7XA 2L5UA 4QF3A 3LRQA 4O62A 3I2DA 4WZ0A 4ZQLA 3DWDA 4YBMA 2MA5A 3H7HA 1X4UA 1X4JA 5H1UA 3ZYQA 4PPEA 4MVTA 1BORA 2L80A 4TKPB 2JRJA 2E6SA 2OXQC 2PUYA 2MUMA 5D1MB 5LKUA 2BAYA 2LDRA 1WEEA 2YW8A 5H9MA 1JM7B 3N9NA 1HYIA 2LGKA 2ECWA 3QZVA 3T7LA 5FB0A 1IYMA 2KR4A 2MNZA 5KH3A 3L1ZB 3ZPV1 1Z6UA 5B76A 2Y1NA 2ZETC 2XB1A 2KGIA 3MHSA 4X3GA 3N9QA 2H0DB 4P5OB 4ZDTA 3U5NA 2LGVA 3T9KA 4S3OB 3KNVA 5TDWA 2KWJA 2M13A 3MDBC 4UP5A 1WILA 4GNDA 4V3KC 3ZPVE 2M6MA 3EB6A 4AP4A 4Z0RA 2ECNA 3MHHA 1WEQA 3O70A 4GB0A 3O36A 2FUUA 4YBTA 3SOWA 4S3OC 2VPEA 1K2FA 1LDKC 2LN0A 1WFKA 3RPGB 1WE9A 2C2VS 5SVIA 2G45A 2YT5A 5B79A 2MNYA 1Z60A 3LVRE 2ECIA 3KQIA 4A49A 2VJFA 4ZUXU 2KGGA 1WGMA 2CSZA 4NN2A 4YAXA 2D8SA 3O37A 5TDRA 3M62A 2E61A 4A0CD 4WZ2A 2IQJA 2MA6A 2KWNA 4MSXA 5G05B 3M99A 2XP0A 2JMIA 4I7BA 4IC2A 4FJCA 3L11A 4B7YC 4LK9A 4C9ZA 1MM3A 4BBQA 4LADB 1RMDA 2DSMA 2VPBA 5H1VA 2EGMA 4N4FA 2YURA 2XOYA 2KWOA 2EGPA 2YHOA 5B75A 5D1LB 2HDPA 4AYCB 2CKLA 2YREA 5LKXA 2F6JA 1ZBDB 3ASLA 4R8PK 2M3HA 3LDYA 4H9DA 1FP0A 3O35A 5SVXA 4LKAA 2KKYA 3M7KA 2CT2A 2ECTA 2K17A 5JG6A 4PTBA 1WEPA 3LJUX 2L75A 3PURA 4YC9A 3ZVZB 2IDAA 2FSAA 2M1RA 3KDEC 1FBVA 2CRRA 3SOUA 3U5MA 2Y1MA 2RR4A 2HYED 2LGGA 1CHCA 5LCWB 2LRIC 2VJEA 3FAOA 4FK5A 2L43A 5FB1A 3VK6A 3M63A 1JM7A 5C11A 5D1KB 2LGLA 1WESA 2UZGA 5KH7A 2LXPC 1T1HA 5J3XA 5H1TA 3FJUB 1Z2QA 2VPGA 4N3WA 2MD8C 2JM3A 3T6RA 3U5OA 3HCTA 5LKTA 2YSJA 4Q6FA 3RPGC 2JMDA 2NAAA 2FFWA 1WEWA 5TRBA 5B78A 5I3LA 4R2YA 5TABA 4OGCA 4QF2A 4YBSA 4F1PA 3DQVR 2D8UA 1VYXA 1DCQA 2AN6A 5AITA 4B86C 2LV9A 2G43A 3HTKC 2YUCA 3L1XA 5SVIB 2CRWA 4OGEA 1XWHA 5TBNA 4F52B 5DKAA 3ZNIA 5LKZA 2JMJA 2H0DA 4GNGA 3V43A 2YHNA 1X4IA
chains in the Genus database with same CATH topology
1VFYA 2VPDA 5FEYA 4BHWA 4I7DA 4YATA 2K1JA 3GL6A 1WEMA 2XEUA 3PHDA 2YQLA 1VD4A 4R7EA 3FL2A 5C13A 2F42A 1WEUA 4XI1A 5FERA 2VJEB 2DX8A 1F62A 3EB5A 2RI7A 2L0BA 3O34A 2VJFB 3LQHA 2CKLB 3DPLR 1MM2A 3HCUA 4FO9A 3RTRB 1LDJB 1G25A 1WEOA 4CCGX 4CA1A 4UI9B 2KIZA 1JOCA 2KWKA 2LXHC 5G0FA 2MIQA 1E4UA 5KH9A 3C5KA 2ECVA 3NG2A 5AIUA 1WENA 4A4BA 3LQJA 3SHBA 4YADA 4WA6A 3ZVYA 2K16A 4AYCA 4AUQB 4FIPA 2E6RA 2MD7B 4GNEA 4WZ3B 3GV4A 2Y43A 3U5PA 2KYUA 2M85A 2KFTA 3N9LA 2YYRA 4UP0A 4V3LC 1WEVA 1U6GB 3PUQA 2CSYA 2YQMA 2QIZA 2FUIA 2QJ0A 4W4UA 1HYJA 3C6WA 2YU4A 3ZTGA 5B8DA 1WIMA 4LJNA 2PNXA 2YSMA 1DVPA 3KV6A 4O64A 3N9OA 4AVXA 2EODA 2KE1A 5B77A 2KU3A 3N9PA 4L58A 5DINA 2ECGA 2F6NA 3KV5A 2G6QA 4I7CA 5EYAF 4A4CA 4LLBA 2ECJA 4YABA 2C2LA 4IC3A 2QICA 3HCSA 4GNFA 2RSDA 2I50A 2EA6A 1V87A 3O33A 3LQIA 3O7AA 1N87A 2KREA 3SOXA 2VP7A 3IHPA 2MT5A 5G04B 2K4DA 2LQ6A 2VNFA 3N9MA 4L7XA 2L5UA 4QF3A 3LRQA 4ZQLA 3I2DA 4WZ0A 4YBMA 2MA5A 1X4UA 1X4JA 5H1UA 3ZYQA 4PPEA 4MVTA 1BORA 2L80A 4TKPB 2JRJA 2E6SA 2OXQC 2PUYA 2MUMA 5D1MB 5LKUA 2BAYA 2LDRA 1WEEA 2YW8A 5H9MA 1JM7B 3N9NA 1HYIA 2LGKA 2ECWA 3QZVA 3T7LA 5FB0A 1IYMA 2KR4A 2MNZA 5KH3A 3L1ZB 3ZPV1 1Z6UA 5B76A 2Y1NA 2ZETC 2XB1A 2KGIA 3MHSA 4X3GA 3N9QA 2H0DB 4P5OB 4ZDTA 3U5NA 2LGVA 4S3OB 3KNVA 5TDWA 2KWJA 4UP5A 1WILA 4GNDA 3ZPVE 4V3KC 2M6MA 3EB6A 4AP4A 2ECNA 3MHHA 1WEQA 3O70A 4GB0A 3O36A 2FUUA 4YBTA 3SOWA 4S3OC 2VPEA 1K2FA 1LDKC 2LN0A 1WFKA 3RPGB 1WE9A 2C2VS 2G45A 2YT5A 5B79A 2MNYA 1Z60A 2ECIA 3KQIA 4A49A 2VJFA 4ZUXU 2KGGA 1WGMA 2CSZA 4NN2A 4YAXA 2D8SA 3O37A 5TDRA 3M62A 4A0CD 4WZ2A 2MA6A 4MSXA 2KWNA 5G05B 3M99A 2JMIA 4I7BA 4IC2A 4FJCA 3L11A 4B7YC 4LK9A 4C9ZA 1MM3A 4BBQA 4LADB 1RMDA 2VPBA 5H1VA 4N4FA 2YURA 2KWOA 2EGPA 2YHOA 5B75A 4AYCB 5D1LB 2HDPA 2CKLA 2YREA 5LKXA 2F6JA 1ZBDB 3ASLA 4R8PK 2M3HA 1FP0A 3O35A 4LKAA 2CT2A 2ECTA 2K17A 5JG6A 4PTBA 1WEPA 2L75A 3PURA 4YC9A 3ZVZB 2IDAA 2FSAA 2M1RA 1FBVA 3SOUA 3U5MA 2Y1MA 2HYED 2LGGA 1CHCA 5LCWB 2LRIC 2VJEA 4FK5A 2L43A 5FB1A 3VK6A 3M63A 1JM7A 5C11A 5D1KB 2LGLA 1WESA 2UZGA 5KH7A 2LXPC 1T1HA 5J3XA 5H1TA 1Z2QA 2VPGA 4N3WA 2MD8C 3T6RA 3U5OA 3HCTA 5LKTA 2YSJA 4Q6FA 3RPGC 2JMDA 2NAAA 1WEWA 5TRBA 5B78A 5I3LA 4R2YA 5TABA 4QF2A 4YBSA 3DQVR 1VYXA 4B86C 2AN6A 5AITA 2LV9A 2G43A 3HTKC 2YUCA 3L1XA 1XWHA 5TBNA 4F52B 5DKAA 3ZNIA 5LKZA 2JMJA 2H0DA 4GNGA 3V43A 2YHNA 1X4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFY A;  2VPD A;  5FEY A;  4BHW A;  4I7D A;  4YAT A;  2K1J A;  3GL6 A;  1WEM A;  2XEU A;  3PHD A;  2YQL A;  1VD4 A;  4R7E A;  3FL2 A;  5C13 A;  2F42 A;  1WEU A;  4XI1 A;  5FER A;  2VJE B;  2DX8 A;  1F62 A;  3EB5 A;  2RI7 A;  2L0B A;  3O34 A;  2VJF B;  3LQH A;  2CKL B;  3DPL R;  1MM2 A;  3HCU A;  4FO9 A;  3RTR B;  1LDJ B;  1G25 A;  1WEO A;  4CCG X;  4CA1 A;  4UI9 B;  2KIZ A;  1JOC A;  2KWK A;  2LXH C;  5G0F A;  2MIQ A;  1E4U A;  5KH9 A;  3C5K A;  2ECV A;  3NG2 A;  5AIU A;  1WEN A;  4A4B A;  3LQJ A;  3SHB A;  4YAD A;  4WA6 A;  3ZVY A;  2K16 A;  4AYC A;  4AUQ B;  4FIP A;  2E6R A;  2MD7 B;  4GNE A;  4WZ3 B;  3GV4 A;  2Y43 A;  3U5P A;  2KYU A;  2M85 A;  2KFT A;  3N9L A;  2YYR A;  4UP0 A;  4V3L C;  1WEV A;  1U6G B;  3PUQ A;  2CSY A;  2YQM A;  2QIZ A;  2FUI A;  2QJ0 A;  4W4U A;  1HYJ A;  3C6W A;  2YU4 A;  3ZTG A;  5B8D A;  1WIM A;  4LJN A;  2PNX A;  2YSM A;  1DVP A;  3KV6 A;  4O64 A;  3N9O A;  4AVX A;  2EOD A;  2KE1 A;  5B77 A;  2KU3 A;  3N9P A;  4L58 A;  5DIN A;  2ECG A;  2F6N A;  3KV5 A;  2G6Q A;  4I7C A;  5EYA F;  4A4C A;  4LLB A;  2ECJ A;  4YAB A;  2C2L A;  4IC3 A;  2QIC A;  3HCS A;  4GNF A;  2RSD A;  2I50 A;  2EA6 A;  1V87 A;  3O33 A;  3LQI A;  3O7A A;  1N87 A;  2KRE A;  3SOX A;  2VP7 A;  3IHP A;  2MT5 A;  5G04 B;  2K4D A;  2LQ6 A;  2VNF A;  3N9M A;  4L7X A;  2L5U A;  4QF3 A;  3LRQ A;  4ZQL A;  3I2D A;  4WZ0 A;  4YBM A;  2MA5 A;  1X4U A;  1X4J A;  5H1U A;  3ZYQ A;  4PPE A;  4MVT A;  1BOR A;  2L80 A;  4TKP B;  2JRJ A;  2E6S A;  2OXQ C;  2PUY A;  2MUM A;  5D1M B;  5LKU A;  2BAY A;  2LDR A;  1WEE A;  2YW8 A;  5H9M A;  1JM7 B;  3N9N A;  1HYI A;  2LGK A;  2ECW A;  3QZV A;  3T7L A;  5FB0 A;  1IYM A;  2KR4 A;  2MNZ A;  5KH3 A;  3L1Z B;  3ZPV 1;  1Z6U A;  5B76 A;  2Y1N A;  2ZET C;  2XB1 A;  2KGI A;  3MHS A;  4X3G A;  3N9Q A;  2H0D B;  4P5O B;  4ZDT A;  3U5N A;  2LGV A;  4S3O B;  3KNV A;  5TDW A;  2KWJ A;  4UP5 A;  1WIL A;  4GND A;  3ZPV E;  4V3K C;  2M6M A;  3EB6 A;  4AP4 A;  2ECN A;  3MHH A;  1WEQ A;  3O70 A;  4GB0 A;  3O36 A;  2FUU A;  4YBT A;  3SOW A;  4S3O C;  2VPE A;  1K2F A;  1LDK C;  2LN0 A;  1WFK A;  3RPG B;  1WE9 A;  2C2V S;  2G45 A;  2YT5 A;  5B79 A;  2MNY A;  1Z60 A;  2ECI A;  3KQI A;  4A49 A;  2VJF A;  4ZUX U;  2KGG A;  1WGM A;  2CSZ A;  4NN2 A;  4YAX A;  2D8S A;  3O37 A;  5TDR A;  3M62 A;  4A0C D;  4WZ2 A;  2MA6 A;  4MSX A;  2KWN A;  5G05 B;  3M99 A;  2JMI A;  4I7B A;  4IC2 A;  4FJC A;  3L11 A;  4B7Y C;  4LK9 A;  4C9Z A;  1MM3 A;  4BBQ A;  4LAD B;  1RMD A;  2VPB A;  5H1V A;  4N4F A;  2YUR A;  2KWO A;  2EGP A;  2YHO A;  5B75 A;  4AYC B;  5D1L B;  2HDP A;  2CKL A;  2YRE A;  5LKX A;  2F6J A;  1ZBD B;  3ASL A;  4R8P K;  2M3H A;  1FP0 A;  3O35 A;  4LKA A;  2CT2 A;  2ECT A;  2K17 A;  5JG6 A;  4PTB A;  1WEP A;  2L75 A;  3PUR A;  4YC9 A;  3ZVZ B;  2IDA A;  2FSA A;  2M1R A;  1FBV A;  3SOU A;  3U5M A;  2Y1M A;  2HYE D;  2LGG A;  1CHC A;  5LCW B;  2LRI C;  2VJE A;  4FK5 A;  2L43 A;  5FB1 A;  3VK6 A;  3M63 A;  1JM7 A;  5C11 A;  5D1K B;  2LGL A;  1WES A;  2UZG A;  5KH7 A;  2LXP C;  1T1H A;  5J3X A;  5H1T A;  1Z2Q A;  2VPG A;  4N3W A;  2MD8 C;  3T6R A;  3U5O A;  3HCT A;  5LKT A;  2YSJ A;  4Q6F A;  3RPG C;  2JMD A;  2NAA A;  1WEW A;  5TRB A;  5B78 A;  5I3L A;  4R2Y A;  5TAB A;  4QF2 A;  4YBS A;  3DQV R;  1VYX A;  4B86 C;  2AN6 A;  5AIT A;  2LV9 A;  2G43 A;  3HTK C;  2YUC A;  3L1X A;  1XWH A;  5TBN A;  4F52 B;  5DKA A;  3ZNI A;  5LKZ A;  2JMJ A;  2H0D A;  4GNG A;  3V43 A;  2YHN A;  1X4I A; 
#chains in the Genus database with same CATH topology
 2CON A;  1VFY A;  2VPD A;  3FEH A;  3DDT A;  5FEY A;  4BHW A;  3FAN A;  4I7D A;  4YAT A;  2K1J A;  3GL6 A;  2DJA A;  2B0O E;  1WEM A;  2XEU A;  5K3Q A;  3PHD A;  2YQL A;  1VD4 A;  4R7E A;  3FL2 A;  5C13 A;  2F42 A;  1WEU A;  4XI1 A;  5FER A;  2VJE B;  2DX8 A;  1F62 A;  4QQ4 A;  3EB5 A;  2RI7 A;  2L0B A;  3O34 A;  2VJF B;  3LQH A;  2CKL B;  3DPL R;  1MM2 A;  3HCU A;  4FO9 A;  3RTR B;  1LDJ B;  1G25 A;  1WEO A;  4CCG X;  3FM8 C;  4CA1 A;  4UI9 B;  2KIZ A;  1JOC A;  2KWK A;  2LXH C;  5G0F A;  2MIQ A;  1E4U A;  5KH9 A;  3C5K A;  2ECV A;  3NG2 A;  5AIU A;  1WEN A;  4A4B A;  3LQJ A;  3SHB A;  4YAD A;  4WA6 A;  2FD4 A;  3ZVY A;  2K16 A;  2P57 A;  4AYC A;  4AUQ B;  2CSV A;  4FIP A;  2E6R A;  2MD7 B;  3JUE A;  3E2D A;  4GNE A;  4WZ3 B;  3GV4 A;  2YVR A;  2Y43 A;  3U5P A;  2KYU A;  2M85 A;  2KFT A;  3N9L A;  2YYR A;  4UP0 A;  4V3L C;  1WEV A;  3LVQ E;  2JUN A;  1U6G B;  3PUQ A;  2CSY A;  2YQM A;  2QIZ A;  2FUI A;  2QJ0 A;  4W4U A;  1HYJ A;  3C6W A;  2YU4 A;  3ZTG A;  5B8D A;  1WIM A;  4LJN A;  2PNX A;  2YSM A;  4Z0O A;  1MBM A;  1DVP A;  3KV6 A;  4O64 A;  3N9O A;  4AVX A;  2EOD A;  2L7P A;  2KE1 A;  5B77 A;  2KU3 A;  3N9P A;  4L58 A;  5DIN A;  2ECG A;  2F6N A;  3KV5 A;  2G6Q A;  2LAU A;  4I7C A;  5EYA F;  4A4C A;  4LLB A;  2ECJ A;  3O47 A;  4YAB A;  2C2L A;  2XOC A;  2XOZ A;  4IC3 A;  2QIC A;  3SUB A;  3HCS A;  4GNF A;  2RSD A;  2I50 A;  2EA6 A;  1V87 A;  3O33 A;  2OWA A;  3LQI A;  3O7A A;  5SVY A;  2MKE A;  2KKX A;  1N87 A;  2KRE A;  3Q1D A;  3SOX A;  2VP7 A;  3IHP A;  3PLW A;  2EXU A;  2MT5 A;  5G04 B;  2K4D A;  2LQ6 A;  2VNF A;  3N9M A;  4L7X A;  2L5U A;  4QF3 A;  3LRQ A;  4O62 A;  3I2D A;  4WZ0 A;  4ZQL A;  3DWD A;  4YBM A;  2MA5 A;  3H7H A;  1X4U A;  1X4J A;  5H1U A;  3ZYQ A;  4PPE A;  4MVT A;  1BOR A;  2L80 A;  4TKP B;  2JRJ A;  2E6S A;  2OXQ C;  2PUY A;  2MUM A;  5D1M B;  5LKU A;  2BAY A;  2LDR A;  1WEE A;  2YW8 A;  5H9M A;  1JM7 B;  3N9N A;  1HYI A;  2LGK A;  2ECW A;  3QZV A;  3T7L A;  5FB0 A;  1IYM A;  2KR4 A;  2MNZ A;  5KH3 A;  3L1Z B;  3ZPV 1;  1Z6U A;  5B76 A;  2Y1N A;  2ZET C;  2XB1 A;  2KGI A;  3MHS A;  4X3G A;  3N9Q A;  2H0D B;  4P5O B;  4ZDT A;  3U5N A;  2LGV A;  3T9K A;  4S3O B;  3KNV A;  5TDW A;  2KWJ A;  2M13 A;  3MDB C;  4UP5 A;  1WIL A;  4GND A;  4V3K C;  3ZPV E;  2M6M A;  3EB6 A;  4AP4 A;  4Z0R A;  2ECN A;  3MHH A;  1WEQ A;  3O70 A;  4GB0 A;  3O36 A;  2FUU A;  4YBT A;  3SOW A;  4S3O C;  2VPE A;  1K2F A;  1LDK C;  2LN0 A;  1WFK A;  3RPG B;  1WE9 A;  2C2V S;  5SVI A;  2G45 A;  2YT5 A;  5B79 A;  2MNY A;  1Z60 A;  3LVR E;  2ECI A;  3KQI A;  4A49 A;  2VJF A;  4ZUX U;  2KGG A;  1WGM A;  2CSZ A;  4NN2 A;  4YAX A;  2D8S A;  3O37 A;  5TDR A;  3M62 A;  2E61 A;  4A0C D;  4WZ2 A;  2IQJ A;  2MA6 A;  2KWN A;  4MSX A;  5G05 B;  3M99 A;  2XP0 A;  2JMI A;  4I7B A;  4IC2 A;  4FJC A;  3L11 A;  4B7Y C;  4LK9 A;  4C9Z A;  1MM3 A;  4BBQ A;  4LAD B;  1RMD A;  2DSM A;  2VPB A;  5H1V A;  2EGM A;  4N4F A;  2YUR A;  2XOY A;  2KWO A;  2EGP A;  2YHO A;  5B75 A;  5D1L B;  2HDP A;  4AYC B;  2CKL A;  2YRE A;  5LKX A;  2F6J A;  1ZBD B;  3ASL A;  4R8P K;  2M3H A;  3LDY A;  4H9D A;  1FP0 A;  3O35 A;  5SVX A;  4LKA A;  2KKY A;  3M7K A;  2CT2 A;  2ECT A;  2K17 A;  5JG6 A;  4PTB A;  1WEP A;  3LJU X;  2L75 A;  3PUR A;  4YC9 A;  3ZVZ B;  2IDA A;  2FSA A;  2M1R A;  3KDE C;  1FBV A;  2CRR A;  3SOU A;  3U5M A;  2Y1M A;  2RR4 A;  2HYE D;  2LGG A;  1CHC A;  5LCW B;  2LRI C;  2VJE A;  3FAO A;  4FK5 A;  2L43 A;  5FB1 A;  3VK6 A;  3M63 A;  1JM7 A;  5C11 A;  5D1K B;  2LGL A;  1WES A;  2UZG A;  5KH7 A;  2LXP C;  1T1H A;  5J3X A;  5H1T A;  3FJU B;  1Z2Q A;  2VPG A;  4N3W A;  2MD8 C;  2JM3 A;  3T6R A;  3U5O A;  3HCT A;  5LKT A;  2YSJ A;  4Q6F A;  3RPG C;  2JMD A;  2NAA A;  2FFW A;  1WEW A;  5TRB A;  5B78 A;  5I3L A;  4R2Y A;  5TAB A;  4OGC A;  4QF2 A;  4YBS A;  4F1P A;  3DQV R;  2D8U A;  1VYX A;  1DCQ A;  2AN6 A;  5AIT A;  4B86 C;  2LV9 A;  2G43 A;  3HTK C;  2YUC A;  3L1X A;  5SVI B;  2CRW A;  4OGE A;  1XWH A;  5TBN A;  4F52 B;  5DKA A;  3ZNI A;  5LKZ A;  2JMJ A;  2H0D A;  4GNG A;  3V43 A;  2YHN A;  1X4I A; 
#chains in the Genus database with same CATH homology
 1VFY A;  2VPD A;  5FEY A;  4BHW A;  4I7D A;  4YAT A;  2K1J A;  3GL6 A;  1WEM A;  2XEU A;  3PHD A;  2YQL A;  1VD4 A;  4R7E A;  3FL2 A;  5C13 A;  2F42 A;  1WEU A;  4XI1 A;  5FER A;  2VJE B;  2DX8 A;  1F62 A;  3EB5 A;  2RI7 A;  2L0B A;  3O34 A;  2VJF B;  3LQH A;  2CKL B;  3DPL R;  1MM2 A;  3HCU A;  4FO9 A;  3RTR B;  1LDJ B;  1G25 A;  1WEO A;  4CCG X;  4CA1 A;  4UI9 B;  2KIZ A;  1JOC A;  2KWK A;  2LXH C;  5G0F A;  2MIQ A;  1E4U A;  5KH9 A;  3C5K A;  2ECV A;  3NG2 A;  5AIU A;  1WEN A;  4A4B A;  3LQJ A;  3SHB A;  4YAD A;  4WA6 A;  3ZVY A;  2K16 A;  4AYC A;  4AUQ B;  4FIP A;  2E6R A;  2MD7 B;  4GNE A;  4WZ3 B;  3GV4 A;  2Y43 A;  3U5P A;  2KYU A;  2M85 A;  2KFT A;  3N9L A;  2YYR A;  4UP0 A;  4V3L C;  1WEV A;  1U6G B;  3PUQ A;  2CSY A;  2YQM A;  2QIZ A;  2FUI A;  2QJ0 A;  4W4U A;  1HYJ A;  3C6W A;  2YU4 A;  3ZTG A;  5B8D A;  1WIM A;  4LJN A;  2PNX A;  2YSM A;  1DVP A;  3KV6 A;  4O64 A;  3N9O A;  4AVX A;  2EOD A;  2KE1 A;  5B77 A;  2KU3 A;  3N9P A;  4L58 A;  5DIN A;  2ECG A;  2F6N A;  3KV5 A;  2G6Q A;  4I7C A;  5EYA F;  4A4C A;  4LLB A;  2ECJ A;  4YAB A;  2C2L A;  4IC3 A;  2QIC A;  3HCS A;  4GNF A;  2RSD A;  2I50 A;  2EA6 A;  1V87 A;  3O33 A;  3LQI A;  3O7A A;  1N87 A;  2KRE A;  3SOX A;  2VP7 A;  3IHP A;  2MT5 A;  5G04 B;  2K4D A;  2LQ6 A;  2VNF A;  3N9M A;  4L7X A;  2L5U A;  4QF3 A;  3LRQ A;  4ZQL A;  3I2D A;  4WZ0 A;  4YBM A;  2MA5 A;  1X4U A;  1X4J A;  5H1U A;  3ZYQ A;  4PPE A;  4MVT A;  1BOR A;  2L80 A;  4TKP B;  2JRJ A;  2E6S A;  2OXQ C;  2PUY A;  2MUM A;  5D1M B;  5LKU A;  2BAY A;  2LDR A;  1WEE A;  2YW8 A;  5H9M A;  1JM7 B;  3N9N A;  1HYI A;  2LGK A;  2ECW A;  3QZV A;  3T7L A;  5FB0 A;  1IYM A;  2KR4 A;  2MNZ A;  5KH3 A;  3L1Z B;  3ZPV 1;  1Z6U A;  5B76 A;  2Y1N A;  2ZET C;  2XB1 A;  2KGI A;  3MHS A;  4X3G A;  3N9Q A;  2H0D B;  4P5O B;  4ZDT A;  3U5N A;  2LGV A;  4S3O B;  3KNV A;  5TDW A;  2KWJ A;  4UP5 A;  1WIL A;  4GND A;  3ZPV E;  4V3K C;  2M6M A;  3EB6 A;  4AP4 A;  2ECN A;  3MHH A;  1WEQ A;  3O70 A;  4GB0 A;  3O36 A;  2FUU A;  4YBT A;  3SOW A;  4S3O C;  2VPE A;  1K2F A;  1LDK C;  2LN0 A;  1WFK A;  3RPG B;  1WE9 A;  2C2V S;  2G45 A;  2YT5 A;  5B79 A;  2MNY A;  1Z60 A;  2ECI A;  3KQI A;  4A49 A;  2VJF A;  4ZUX U;  2KGG A;  1WGM A;  2CSZ A;  4NN2 A;  4YAX A;  2D8S A;  3O37 A;  5TDR A;  3M62 A;  4A0C D;  4WZ2 A;  2MA6 A;  4MSX A;  2KWN A;  5G05 B;  3M99 A;  2JMI A;  4I7B A;  4IC2 A;  4FJC A;  3L11 A;  4B7Y C;  4LK9 A;  4C9Z A;  1MM3 A;  4BBQ A;  4LAD B;  1RMD A;  2VPB A;  5H1V A;  4N4F A;  2YUR A;  2KWO A;  2EGP A;  2YHO A;  5B75 A;  4AYC B;  5D1L B;  2HDP A;  2CKL A;  2YRE A;  5LKX A;  2F6J A;  1ZBD B;  3ASL A;  4R8P K;  2M3H A;  1FP0 A;  3O35 A;  4LKA A;  2CT2 A;  2ECT A;  2K17 A;  5JG6 A;  4PTB A;  1WEP A;  2L75 A;  3PUR A;  4YC9 A;  3ZVZ B;  2IDA A;  2FSA A;  2M1R A;  1FBV A;  3SOU A;  3U5M A;  2Y1M A;  2HYE D;  2LGG A;  1CHC A;  5LCW B;  2LRI C;  2VJE A;  4FK5 A;  2L43 A;  5FB1 A;  3VK6 A;  3M63 A;  1JM7 A;  5C11 A;  5D1K B;  2LGL A;  1WES A;  2UZG A;  5KH7 A;  2LXP C;  1T1H A;  5J3X A;  5H1T A;  1Z2Q A;  2VPG A;  4N3W A;  2MD8 C;  3T6R A;  3U5O A;  3HCT A;  5LKT A;  2YSJ A;  4Q6F A;  3RPG C;  2JMD A;  2NAA A;  1WEW A;  5TRB A;  5B78 A;  5I3L A;  4R2Y A;  5TAB A;  4QF2 A;  4YBS A;  3DQV R;  1VYX A;  4B86 C;  2AN6 A;  5AIT A;  2LV9 A;  2G43 A;  3HTK C;  2YUC A;  3L1X A;  1XWH A;  5TBN A;  4F52 B;  5DKA A;  3ZNI A;  5LKZ A;  2JMJ A;  2H0D A;  4GNG A;  3V43 A;  2YHN A;  1X4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...