2MIQA

Solution nmr structure of phd type 1 zinc finger domain 1 of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium (nesg) target fr824j
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
SHMSGGSPLATGTTANTRGASQKKGGEPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of PHD Type 1 Zinc Finger Domain 1 from Lysine-specific Demethylase Lid from Drosophila melanogaster, Northeast Structural Genomics Consortium (NESG) Target FR824J
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase lid
total genus 8
structure length 94
sequence length 94
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2miqA00
4I7BA 2G45A 5LKXA 2YHOA 4CCGX 4FIPA 2JMDA 2VNFA 4GB0A 2ECGA 2G6QA 3PURA 3MHHA 2YYRA 4LADB 4P5OB 4A4BA 1LDJB 1V87A 2YT5A 1WESA 3DPLR 1WEWA 4I7DA 3IHPA 5C13A 4X3GA 4GNFA 2QJ0A 2YU4A 3FL2A 5JG6A 1X4JA 2CSZA 4AUQB 2LGLA 4FO9A 2D8SA 5TDWA 2MNYA 4R8PK 2MIQA 4AP4A 1WEEA 3HTKC 2CT2A 2LDRA 5TDRA 4A49A 5H1VA 4YC9A 3O34A 4PPEA 2CKLA 1WFKA 2YQLA 2QIZA 5FEYA 5LKUA 5C11A 2VPEA 2K17A 4FJCA 3L11A 4BHWA 1JM7B 2M3HA 4PTBA 4AVXA 2MD7B 2EA6A 4L58A 2VJFB 2DX8A 3N9OA 4UP0A 5KH9A 4O64A 1ZBDB 2YUCA 2ZETC 2EGPA 1XWHA 4GNGA 2OXQC 1IYMA 2ECWA 2QICA 3NG2A 3RPGB 5LCWB 2L43A 2YSJA 2MA5A 4FK5A 2K16A 5EYAF 3PHDA 4YAXA 2PNXA 4Q6FA 4AYCB 2VPDA 2VPBA 1WEPA 2MA6A 1HYJA 2KYUA 4ZDTA 5D1MB 5DKAA 2KREA 2K1JA 3ZPVE 3ZTGA 3VK6A 4C9ZA 3T7LA 1Z2QA 4QF2A 4YBTA 4ZQLA 2KWNA 2CKLB 3C6WA 5B77A 2VJEB 5KH3A 4BBQA 3GL6A 3T6RA 2F6JA 4S3OB 3HCSA 4IC2A 4WZ3B 2AN6A 4YBSA 2YREA 3L1XA 2YURA 1VYXA 3N9MA 5B78A 4I7CA 4R2YA 1K2FA 5FB0A 3M62A 2VP7A 4YADA 2F42A 3RPGC 3M63A 2G43A 2PUYA 2M85A 2FSAA 3KNVA 5B76A 2FUIA 5J3XA 4R7EA 4F52B 1WGMA 4QF3A 3EB6A 2VJFA 1Z6UA 1Z60A 5LKZA 4GNEA 2YQMA 2KFTA 2UZGA 3KV5A 3U5NA 2NAAA 2MNZA 3O36A 4MSXA 2HYED 1RMDA 2JMIA 3ZYQA 2L80A 1N87A 3HCUA 3ZVZB 4XI1A 2VJEA 2L75A 2MD8C 1E4UA 2I50A 4GNDA 4WA6A 5TABA 2LXPC 2H0DA 4UI9B 2JMJA 5I3LA 3V43A 4YATA 3I2DA 2L0BA 2VPGA 4YBMA 5H9MA 4N4FA 2LGGA 5B79A 3N9NA 2E6RA 3KQIA 1VFYA 2LGVA 3O33A 2ECJA 3MHSA 3GV4A 2KU3A 4B7YC 1LDKC 2LRIC 3C5KA 2BAYA 2KGGA 4A4CA 3SOXA 1WEQA 5KH7A 3SHBA 1WEVA 4V3KC 2C2LA 1X4IA 5G05B 5LKTA 1WILA 3LQHA 1WENA 2KIZA 3O37A 4WZ0A 3QZVA 2CSYA 1MM3A 3LRQA 5G04B 2KE1A 2LGKA 1FBVA 3RTRB 2JRJA 5H1UA 4AYCA 5B75A 3SOWA 4MVTA 4LJNA 3ASLA 4IC3A 3LQJA 3HCTA 4LLBA 4UP5A 3N9QA 1DVPA 2Y1NA 1X4UA 5FB1A 2KWKA 3U5OA 2H0DB 4A0CD 2KGIA 2YW8A 2L5UA 4L7XA 1WEUA 2KWOA 2KR4A 1CHCA 3O7AA 2FUUA 3SOUA 1WEOA 3ZNIA 5H1TA 1BORA 4CA1A 1G25A 2C2VS 5TRBA 3DQVR 5AITA 2E6SA 3KV6A 2LQ6A 2MUMA 5TBNA 4N3WA 2HDPA 5DINA 3U5PA 4WZ2A 2ECNA 3L1ZB 2YSMA 1WE9A 2LN0A 3M99A 2ECTA 2LV9A 2K4DA 4ZUXU 4B86C 2YHNA 2KWJA 2IDAA 4TKPB 1F62A 4LK9A 1FP0A 1MM2A 4W4UA 4LKAA 1WIMA 1VD4A 4S3OC 3PUQA 5B8DA 2Y43A 2F6NA 1HYIA 4YABA 3N9PA 2ECVA 2MT5A 2Y1MA 1T1HA 3ZVYA 1U6GB 2M6MA 5AIUA 3ZPV1 2LXHC 1WEMA 5D1KB 2M1RA 3LQIA 2RI7A 1JM7A 2RSDA 2ECIA 3O70A 4V3LC 2XB1A 1JOCA 2XEUA 3O35A 2EODA 3U5MA 5FERA 5D1LB 3N9LA 4NN2A 5G0FA 3EB5A
chains in the Genus database with same CATH superfamily
4I7BA 2YVRA 2G45A 5LKXA 2YHOA 4CCGX 4FIPA 2JMDA 2VNFA 4GB0A 2ECGA 2G6QA 3PURA 2OWAA 3MHHA 2YYRA 4LADB 4P5OB 4A4BA 1LDJB 1V87A 2YT5A 1WESA 3DPLR 1WEWA 4I7DA 3IHPA 5C13A 4X3GA 4GNFA 2QJ0A 2YU4A 3FL2A 5JG6A 1X4JA 2CSZA 4AUQB 2LGLA 4FO9A 2D8SA 5TDWA 2MNYA 4R8PK 2MIQA 4AP4A 1WEEA 3HTKC 2CT2A 2LDRA 5TDRA 5H1VA 4YC9A 4A49A 3O34A 4PPEA 3FANA 2JUNA 2B0OE 2CKLA 1WFKA 2YQLA 2QIZA 3MDBC 5FEYA 5LKUA 5C11A 2VPEA 2K17A 5K3QA 4Z0RA 4FJCA 4H9DA 3L11A 4BHWA 1JM7B 2M3HA 4PTBA 4AVXA 2MD7B 2EA6A 4L58A 2VJFB 2DX8A 3N9OA 4UP0A 5KH9A 4O64A 1ZBDB 2YUCA 2ZETC 2EGPA 1XWHA 4GNGA 2OXQC 1IYMA 3FAOA 2ECWA 2QICA 3NG2A 3RPGB 5LCWB 2L43A 2YSJA 2EXUA 2MA5A 4FK5A 2K16A 4OGCA 5EYAF 3PHDA 2XP0A 2DSMA 4YAXA 2PNXA 4Q6FA 4AYCB 3JUEA 2VPDA 2VPBA 1WEPA 2MA6A 1HYJA 2KYUA 4ZDTA 3SUBA 5D1MB 5DKAA 2KREA 2K1JA 3ZPVE 3ZTGA 3VK6A 2XOCA 4C9ZA 2LAUA 1Z2QA 3T7LA 4QF2A 4YBTA 2JM3A 5SVIB 4ZQLA 2KWNA 2CKLB 3H7HA 3C6WA 3M7KA 5B77A 4Z0OA 2VJEB 5KH3A 4BBQA 3GL6A 3T6RA 2F6JA 4S3OB 3HCSA 4IC2A 4WZ3B 2AN6A 4YBSA 2YREA 2XOYA 3L1XA 2YURA 1VYXA 3N9MA 5B78A 4I7CA 4R2YA 1K2FA 5FB0A 3M62A 2CRWA 2VP7A 4YADA 2L7PA 2F42A 3RPGC 3M63A 2G43A 2PUYA 2M85A 2FSAA 3KNVA 5B76A 2FUIA 5J3XA 4R7EA 4F52B 1WGMA 4QF3A 3EB6A 2VJFA 1Z6UA 2CONA 2EGMA 1Z60A 5LKZA 4GNEA 3O47A 2YQMA 2KFTA 3LDYA 2UZGA 3KV5A 3U5NA 2NAAA 2MNZA 3O36A 4MSXA 3LVRE 2HYED 1RMDA 2JMIA 3ZYQA 2L80A 1N87A 3HCUA 3LJUX 3ZVZB 3KDEC 4XI1A 2VJEA 2L75A 2MD8C 1E4UA 2I50A 2CRRA 2E61A 2KKYA 4GNDA 4WA6A 5TABA 2LXPC 2H0DA 4UI9B 2JMJA 5I3LA 3FEHA 3V43A 4YATA 3I2DA 3DDTA 2L0BA 2VPGA 2MKEA 5SVYA 4YBMA 5H9MA 4N4FA 2LGGA 5B79A 3N9NA 2E6RA 3KQIA 1VFYA 3PLWA 2LGVA 3O33A 2ECJA 3MHSA 3GV4A 2KU3A 3FJUB 1LDKC 2LRIC 3C5KA 4B7YC 2BAYA 2KGGA 4A4CA 3SOXA 1WEQA 5KH7A 2M13A 3SHBA 1WEVA 4V3KC 2C2LA 1X4IA 5G05B 2CSVA 5LKTA 1WILA 3LQHA 1WENA 2KIZA 3O37A 5SVXA 4WZ0A 3QZVA 2CSYA 1MM3A 3LRQA 5G04B 2KE1A 2LGKA 1FBVA 3RTRB 2JRJA 5H1UA 4AYCA 5B75A 3SOWA 4MVTA 4LJNA 3ASLA 4IC3A 2DJAA 3LQJA 3HCTA 4LLBA 4UP5A 3N9QA 1DVPA 2Y1NA 1DCQA 1X4UA 2FFWA 5FB1A 2KWKA 3U5OA 2XOZA 2H0DB 4A0CD 2FD4A 2KGIA 2D8UA 2YW8A 2L5UA 4L7XA 1WEUA 2KWOA 2KR4A 1CHCA 3O7AA 2FUUA 3SOUA 1WEOA 3ZNIA 5H1TA 1BORA 4CA1A 1G25A 2C2VS 2P57A 3DWDA 3FM8C 5TRBA 3DQVR 5AITA 2E6SA 3KV6A 1MBMA 2LQ6A 2MUMA 5TBNA 3Q1DA 4N3WA 2HDPA 5DINA 3U5PA 4WZ2A 2ECNA 3L1ZB 2YSMA 1WE9A 2LN0A 3M99A 2ECTA 2LV9A 2K4DA 4ZUXU 4OGEA 4B86C 5SVIA 2YHNA 2KWJA 2KKXA 2IDAA 4TKPB 1F62A 3E2DA 4LK9A 1FP0A 1MM2A 4W4UA 4LKAA 1WIMA 1VD4A 4S3OC 3PUQA 5B8DA 2Y43A 2F6NA 1HYIA 4YABA 3N9PA 2RR4A 2ECVA 2MT5A 2Y1MA 1T1HA 3T9KA 3ZVYA 1U6GB 2M6MA 5AIUA 3ZPV1 2LXHC 3LVQE 1WEMA 5D1KB 2M1RA 3LQIA 2RI7A 4O62A 1JM7A 2RSDA 2ECIA 4QQ4A 3O70A 4V3LC 4F1PA 2XB1A 1JOCA 2XEUA 3O35A 2EODA 3U5MA 5FERA 5D1LB 3N9LA 4NN2A 5G0FA 2IQJA 3EB5A
chains in the Genus database with same CATH topology
4I7BA 2G45A 5LKXA 2YHOA 4CCGX 4FIPA 2JMDA 2VNFA 4GB0A 2ECGA 2G6QA 3PURA 3MHHA 2YYRA 4LADB 4P5OB 4A4BA 1LDJB 1V87A 2YT5A 1WESA 3DPLR 1WEWA 4I7DA 3IHPA 5C13A 4X3GA 4GNFA 2QJ0A 2YU4A 3FL2A 5JG6A 1X4JA 2CSZA 4AUQB 2LGLA 4FO9A 2D8SA 5TDWA 2MNYA 4R8PK 2MIQA 4AP4A 1WEEA 3HTKC 2CT2A 2LDRA 5TDRA 4A49A 5H1VA 4YC9A 3O34A 4PPEA 2CKLA 1WFKA 2YQLA 2QIZA 5FEYA 5LKUA 5C11A 2VPEA 2K17A 4FJCA 3L11A 4BHWA 1JM7B 2M3HA 4PTBA 4AVXA 2MD7B 2EA6A 4L58A 2VJFB 2DX8A 3N9OA 4UP0A 5KH9A 4O64A 1ZBDB 2YUCA 2ZETC 2EGPA 1XWHA 4GNGA 2OXQC 1IYMA 2ECWA 2QICA 3NG2A 3RPGB 5LCWB 2L43A 2YSJA 2MA5A 4FK5A 2K16A 5EYAF 3PHDA 4YAXA 2PNXA 4Q6FA 4AYCB 2VPDA 2VPBA 1WEPA 2MA6A 1HYJA 2KYUA 4ZDTA 5D1MB 5DKAA 2KREA 2K1JA 3ZPVE 3ZTGA 3VK6A 4C9ZA 3T7LA 1Z2QA 4QF2A 4YBTA 4ZQLA 2KWNA 2CKLB 3C6WA 5B77A 2VJEB 5KH3A 4BBQA 3GL6A 3T6RA 2F6JA 4S3OB 3HCSA 4IC2A 4WZ3B 2AN6A 4YBSA 2YREA 3L1XA 2YURA 1VYXA 3N9MA 5B78A 4I7CA 4R2YA 1K2FA 5FB0A 3M62A 2VP7A 4YADA 2F42A 3RPGC 3M63A 2G43A 2PUYA 2M85A 2FSAA 3KNVA 5B76A 2FUIA 5J3XA 4R7EA 4F52B 1WGMA 4QF3A 3EB6A 2VJFA 1Z6UA 1Z60A 5LKZA 4GNEA 2YQMA 2KFTA 2UZGA 3KV5A 3U5NA 2NAAA 2MNZA 3O36A 4MSXA 2HYED 1RMDA 2JMIA 3ZYQA 2L80A 1N87A 3HCUA 3ZVZB 4XI1A 2VJEA 2L75A 2MD8C 1E4UA 2I50A 4GNDA 4WA6A 5TABA 2LXPC 2H0DA 4UI9B 2JMJA 5I3LA 3V43A 4YATA 3I2DA 2L0BA 2VPGA 4YBMA 5H9MA 4N4FA 2LGGA 5B79A 3N9NA 2E6RA 3KQIA 1VFYA 2LGVA 3O33A 2ECJA 3MHSA 3GV4A 2KU3A 4B7YC 1LDKC 2LRIC 3C5KA 2BAYA 2KGGA 4A4CA 3SOXA 1WEQA 5KH7A 3SHBA 1WEVA 4V3KC 2C2LA 1X4IA 5G05B 5LKTA 1WILA 3LQHA 1WENA 2KIZA 3O37A 4WZ0A 3QZVA 2CSYA 1MM3A 3LRQA 5G04B 2KE1A 2LGKA 1FBVA 3RTRB 2JRJA 5H1UA 4AYCA 5B75A 3SOWA 4MVTA 4LJNA 3ASLA 4IC3A 3LQJA 3HCTA 4LLBA 4UP5A 3N9QA 1DVPA 2Y1NA 1X4UA 5FB1A 2KWKA 3U5OA 2H0DB 4A0CD 2KGIA 2YW8A 2L5UA 4L7XA 1WEUA 2KWOA 2KR4A 1CHCA 3O7AA 2FUUA 3SOUA 1WEOA 3ZNIA 5H1TA 1BORA 4CA1A 1G25A 2C2VS 5TRBA 3DQVR 5AITA 2E6SA 3KV6A 2LQ6A 2MUMA 5TBNA 4N3WA 2HDPA 5DINA 3U5PA 4WZ2A 2ECNA 3L1ZB 2YSMA 1WE9A 2LN0A 3M99A 2ECTA 2LV9A 2K4DA 4ZUXU 4B86C 2YHNA 2KWJA 2IDAA 4TKPB 1F62A 4LK9A 1FP0A 1MM2A 4W4UA 4LKAA 1WIMA 1VD4A 4S3OC 3PUQA 5B8DA 2Y43A 2F6NA 1HYIA 4YABA 3N9PA 2ECVA 2MT5A 2Y1MA 1T1HA 3ZVYA 1U6GB 2M6MA 5AIUA 3ZPV1 2LXHC 1WEMA 5D1KB 2M1RA 3LQIA 2RI7A 1JM7A 2RSDA 2ECIA 3O70A 4V3LC 2XB1A 1JOCA 2XEUA 3O35A 2EODA 3U5MA 5FERA 5D1LB 3N9LA 4NN2A 5G0FA 3EB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7B A;  2G45 A;  5LKX A;  2YHO A;  4CCG X;  4FIP A;  2JMD A;  2VNF A;  4GB0 A;  2ECG A;  2G6Q A;  3PUR A;  3MHH A;  2YYR A;  4LAD B;  4P5O B;  4A4B A;  1LDJ B;  1V87 A;  2YT5 A;  1WES A;  3DPL R;  1WEW A;  4I7D A;  3IHP A;  5C13 A;  4X3G A;  4GNF A;  2QJ0 A;  2YU4 A;  3FL2 A;  5JG6 A;  1X4J A;  2CSZ A;  4AUQ B;  2LGL A;  4FO9 A;  2D8S A;  5TDW A;  2MNY A;  4R8P K;  2MIQ A;  4AP4 A;  1WEE A;  3HTK C;  2CT2 A;  2LDR A;  5TDR A;  4A49 A;  5H1V A;  4YC9 A;  3O34 A;  4PPE A;  2CKL A;  1WFK A;  2YQL A;  2QIZ A;  5FEY A;  5LKU A;  5C11 A;  2VPE A;  2K17 A;  4FJC A;  3L11 A;  4BHW A;  1JM7 B;  2M3H A;  4PTB A;  4AVX A;  2MD7 B;  2EA6 A;  4L58 A;  2VJF B;  2DX8 A;  3N9O A;  4UP0 A;  5KH9 A;  4O64 A;  1ZBD B;  2YUC A;  2ZET C;  2EGP A;  1XWH A;  4GNG A;  2OXQ C;  1IYM A;  2ECW A;  2QIC A;  3NG2 A;  3RPG B;  5LCW B;  2L43 A;  2YSJ A;  2MA5 A;  4FK5 A;  2K16 A;  5EYA F;  3PHD A;  4YAX A;  2PNX A;  4Q6F A;  4AYC B;  2VPD A;  2VPB A;  1WEP A;  2MA6 A;  1HYJ A;  2KYU A;  4ZDT A;  5D1M B;  5DKA A;  2KRE A;  2K1J A;  3ZPV E;  3ZTG A;  3VK6 A;  4C9Z A;  3T7L A;  1Z2Q A;  4QF2 A;  4YBT A;  4ZQL A;  2KWN A;  2CKL B;  3C6W A;  5B77 A;  2VJE B;  5KH3 A;  4BBQ A;  3GL6 A;  3T6R A;  2F6J A;  4S3O B;  3HCS A;  4IC2 A;  4WZ3 B;  2AN6 A;  4YBS A;  2YRE A;  3L1X A;  2YUR A;  1VYX A;  3N9M A;  5B78 A;  4I7C A;  4R2Y A;  1K2F A;  5FB0 A;  3M62 A;  2VP7 A;  4YAD A;  2F42 A;  3RPG C;  3M63 A;  2G43 A;  2PUY A;  2M85 A;  2FSA A;  3KNV A;  5B76 A;  2FUI A;  5J3X A;  4R7E A;  4F52 B;  1WGM A;  4QF3 A;  3EB6 A;  2VJF A;  1Z6U A;  1Z60 A;  5LKZ A;  4GNE A;  2YQM A;  2KFT A;  2UZG A;  3KV5 A;  3U5N A;  2NAA A;  2MNZ A;  3O36 A;  4MSX A;  2HYE D;  1RMD A;  2JMI A;  3ZYQ A;  2L80 A;  1N87 A;  3HCU A;  3ZVZ B;  4XI1 A;  2VJE A;  2L75 A;  2MD8 C;  1E4U A;  2I50 A;  4GND A;  4WA6 A;  5TAB A;  2LXP C;  2H0D A;  4UI9 B;  2JMJ A;  5I3L A;  3V43 A;  4YAT A;  3I2D A;  2L0B A;  2VPG A;  4YBM A;  5H9M A;  4N4F A;  2LGG A;  5B79 A;  3N9N A;  2E6R A;  3KQI A;  1VFY A;  2LGV A;  3O33 A;  2ECJ A;  3MHS A;  3GV4 A;  2KU3 A;  4B7Y C;  1LDK C;  2LRI C;  3C5K A;  2BAY A;  2KGG A;  4A4C A;  3SOX A;  1WEQ A;  5KH7 A;  3SHB A;  1WEV A;  4V3K C;  2C2L A;  1X4I A;  5G05 B;  5LKT A;  1WIL A;  3LQH A;  1WEN A;  2KIZ A;  3O37 A;  4WZ0 A;  3QZV A;  2CSY A;  1MM3 A;  3LRQ A;  5G04 B;  2KE1 A;  2LGK A;  1FBV A;  3RTR B;  2JRJ A;  5H1U A;  4AYC A;  5B75 A;  3SOW A;  4MVT A;  4LJN A;  3ASL A;  4IC3 A;  3LQJ A;  3HCT A;  4LLB A;  4UP5 A;  3N9Q A;  1DVP A;  2Y1N A;  1X4U A;  5FB1 A;  2KWK A;  3U5O A;  2H0D B;  4A0C D;  2KGI A;  2YW8 A;  2L5U A;  4L7X A;  1WEU A;  2KWO A;  2KR4 A;  1CHC A;  3O7A A;  2FUU A;  3SOU A;  1WEO A;  3ZNI A;  5H1T A;  1BOR A;  4CA1 A;  1G25 A;  2C2V S;  5TRB A;  3DQV R;  5AIT A;  2E6S A;  3KV6 A;  2LQ6 A;  2MUM A;  5TBN A;  4N3W A;  2HDP A;  5DIN A;  3U5P A;  4WZ2 A;  2ECN A;  3L1Z B;  2YSM A;  1WE9 A;  2LN0 A;  3M99 A;  2ECT A;  2LV9 A;  2K4D A;  4ZUX U;  4B86 C;  2YHN A;  2KWJ A;  2IDA A;  4TKP B;  1F62 A;  4LK9 A;  1FP0 A;  1MM2 A;  4W4U A;  4LKA A;  1WIM A;  1VD4 A;  4S3O C;  3PUQ A;  5B8D A;  2Y43 A;  2F6N A;  1HYI A;  4YAB A;  3N9P A;  2ECV A;  2MT5 A;  2Y1M A;  1T1H A;  3ZVY A;  1U6G B;  2M6M A;  5AIU A;  3ZPV 1;  2LXH C;  1WEM A;  5D1K B;  2M1R A;  3LQI A;  2RI7 A;  1JM7 A;  2RSD A;  2ECI A;  3O70 A;  4V3L C;  2XB1 A;  1JOC A;  2XEU A;  3O35 A;  2EOD A;  3U5M A;  5FER A;  5D1L B;  3N9L A;  4NN2 A;  5G0F A;  3EB5 A; 
#chains in the Genus database with same CATH topology
 4I7B A;  2YVR A;  2G45 A;  5LKX A;  2YHO A;  4CCG X;  4FIP A;  2JMD A;  2VNF A;  4GB0 A;  2ECG A;  2G6Q A;  3PUR A;  2OWA A;  3MHH A;  2YYR A;  4LAD B;  4P5O B;  4A4B A;  1LDJ B;  1V87 A;  2YT5 A;  1WES A;  3DPL R;  1WEW A;  4I7D A;  3IHP A;  5C13 A;  4X3G A;  4GNF A;  2QJ0 A;  2YU4 A;  3FL2 A;  5JG6 A;  1X4J A;  2CSZ A;  4AUQ B;  2LGL A;  4FO9 A;  2D8S A;  5TDW A;  2MNY A;  4R8P K;  2MIQ A;  4AP4 A;  1WEE A;  3HTK C;  2CT2 A;  2LDR A;  5TDR A;  5H1V A;  4YC9 A;  4A49 A;  3O34 A;  4PPE A;  3FAN A;  2JUN A;  2B0O E;  2CKL A;  1WFK A;  2YQL A;  2QIZ A;  3MDB C;  5FEY A;  5LKU A;  5C11 A;  2VPE A;  2K17 A;  5K3Q A;  4Z0R A;  4FJC A;  4H9D A;  3L11 A;  4BHW A;  1JM7 B;  2M3H A;  4PTB A;  4AVX A;  2MD7 B;  2EA6 A;  4L58 A;  2VJF B;  2DX8 A;  3N9O A;  4UP0 A;  5KH9 A;  4O64 A;  1ZBD B;  2YUC A;  2ZET C;  2EGP A;  1XWH A;  4GNG A;  2OXQ C;  1IYM A;  3FAO A;  2ECW A;  2QIC A;  3NG2 A;  3RPG B;  5LCW B;  2L43 A;  2YSJ A;  2EXU A;  2MA5 A;  4FK5 A;  2K16 A;  4OGC A;  5EYA F;  3PHD A;  2XP0 A;  2DSM A;  4YAX A;  2PNX A;  4Q6F A;  4AYC B;  3JUE A;  2VPD A;  2VPB A;  1WEP A;  2MA6 A;  1HYJ A;  2KYU A;  4ZDT A;  3SUB A;  5D1M B;  5DKA A;  2KRE A;  2K1J A;  3ZPV E;  3ZTG A;  3VK6 A;  2XOC A;  4C9Z A;  2LAU A;  1Z2Q A;  3T7L A;  4QF2 A;  4YBT A;  2JM3 A;  5SVI B;  4ZQL A;  2KWN A;  2CKL B;  3H7H A;  3C6W A;  3M7K A;  5B77 A;  4Z0O A;  2VJE B;  5KH3 A;  4BBQ A;  3GL6 A;  3T6R A;  2F6J A;  4S3O B;  3HCS A;  4IC2 A;  4WZ3 B;  2AN6 A;  4YBS A;  2YRE A;  2XOY A;  3L1X A;  2YUR A;  1VYX A;  3N9M A;  5B78 A;  4I7C A;  4R2Y A;  1K2F A;  5FB0 A;  3M62 A;  2CRW A;  2VP7 A;  4YAD A;  2L7P A;  2F42 A;  3RPG C;  3M63 A;  2G43 A;  2PUY A;  2M85 A;  2FSA A;  3KNV A;  5B76 A;  2FUI A;  5J3X A;  4R7E A;  4F52 B;  1WGM A;  4QF3 A;  3EB6 A;  2VJF A;  1Z6U A;  2CON A;  2EGM A;  1Z60 A;  5LKZ A;  4GNE A;  3O47 A;  2YQM A;  2KFT A;  3LDY A;  2UZG A;  3KV5 A;  3U5N A;  2NAA A;  2MNZ A;  3O36 A;  4MSX A;  3LVR E;  2HYE D;  1RMD A;  2JMI A;  3ZYQ A;  2L80 A;  1N87 A;  3HCU A;  3LJU X;  3ZVZ B;  3KDE C;  4XI1 A;  2VJE A;  2L75 A;  2MD8 C;  1E4U A;  2I50 A;  2CRR A;  2E61 A;  2KKY A;  4GND A;  4WA6 A;  5TAB A;  2LXP C;  2H0D A;  4UI9 B;  2JMJ A;  5I3L A;  3FEH A;  3V43 A;  4YAT A;  3I2D A;  3DDT A;  2L0B A;  2VPG A;  2MKE A;  5SVY A;  4YBM A;  5H9M A;  4N4F A;  2LGG A;  5B79 A;  3N9N A;  2E6R A;  3KQI A;  1VFY A;  3PLW A;  2LGV A;  3O33 A;  2ECJ A;  3MHS A;  3GV4 A;  2KU3 A;  3FJU B;  1LDK C;  2LRI C;  3C5K A;  4B7Y C;  2BAY A;  2KGG A;  4A4C A;  3SOX A;  1WEQ A;  5KH7 A;  2M13 A;  3SHB A;  1WEV A;  4V3K C;  2C2L A;  1X4I A;  5G05 B;  2CSV A;  5LKT A;  1WIL A;  3LQH A;  1WEN A;  2KIZ A;  3O37 A;  5SVX A;  4WZ0 A;  3QZV A;  2CSY A;  1MM3 A;  3LRQ A;  5G04 B;  2KE1 A;  2LGK A;  1FBV A;  3RTR B;  2JRJ A;  5H1U A;  4AYC A;  5B75 A;  3SOW A;  4MVT A;  4LJN A;  3ASL A;  4IC3 A;  2DJA A;  3LQJ A;  3HCT A;  4LLB A;  4UP5 A;  3N9Q A;  1DVP A;  2Y1N A;  1DCQ A;  1X4U A;  2FFW A;  5FB1 A;  2KWK A;  3U5O A;  2XOZ A;  2H0D B;  4A0C D;  2FD4 A;  2KGI A;  2D8U A;  2YW8 A;  2L5U A;  4L7X A;  1WEU A;  2KWO A;  2KR4 A;  1CHC A;  3O7A A;  2FUU A;  3SOU A;  1WEO A;  3ZNI A;  5H1T A;  1BOR A;  4CA1 A;  1G25 A;  2C2V S;  2P57 A;  3DWD A;  3FM8 C;  5TRB A;  3DQV R;  5AIT A;  2E6S A;  3KV6 A;  1MBM A;  2LQ6 A;  2MUM A;  5TBN A;  3Q1D A;  4N3W A;  2HDP A;  5DIN A;  3U5P A;  4WZ2 A;  2ECN A;  3L1Z B;  2YSM A;  1WE9 A;  2LN0 A;  3M99 A;  2ECT A;  2LV9 A;  2K4D A;  4ZUX U;  4OGE A;  4B86 C;  5SVI A;  2YHN A;  2KWJ A;  2KKX A;  2IDA A;  4TKP B;  1F62 A;  3E2D A;  4LK9 A;  1FP0 A;  1MM2 A;  4W4U A;  4LKA A;  1WIM A;  1VD4 A;  4S3O C;  3PUQ A;  5B8D A;  2Y43 A;  2F6N A;  1HYI A;  4YAB A;  3N9P A;  2RR4 A;  2ECV A;  2MT5 A;  2Y1M A;  1T1H A;  3T9K A;  3ZVY A;  1U6G B;  2M6M A;  5AIU A;  3ZPV 1;  2LXH C;  3LVQ E;  1WEM A;  5D1K B;  2M1R A;  3LQI A;  2RI7 A;  4O62 A;  1JM7 A;  2RSD A;  2ECI A;  4QQ4 A;  3O70 A;  4V3L C;  4F1P A;  2XB1 A;  1JOC A;  2XEU A;  3O35 A;  2EOD A;  3U5M A;  5FER A;  5D1L B;  3N9L A;  4NN2 A;  5G0F A;  2IQJ A;  3EB5 A; 
#chains in the Genus database with same CATH homology
 4I7B A;  2G45 A;  5LKX A;  2YHO A;  4CCG X;  4FIP A;  2JMD A;  2VNF A;  4GB0 A;  2ECG A;  2G6Q A;  3PUR A;  3MHH A;  2YYR A;  4LAD B;  4P5O B;  4A4B A;  1LDJ B;  1V87 A;  2YT5 A;  1WES A;  3DPL R;  1WEW A;  4I7D A;  3IHP A;  5C13 A;  4X3G A;  4GNF A;  2QJ0 A;  2YU4 A;  3FL2 A;  5JG6 A;  1X4J A;  2CSZ A;  4AUQ B;  2LGL A;  4FO9 A;  2D8S A;  5TDW A;  2MNY A;  4R8P K;  2MIQ A;  4AP4 A;  1WEE A;  3HTK C;  2CT2 A;  2LDR A;  5TDR A;  4A49 A;  5H1V A;  4YC9 A;  3O34 A;  4PPE A;  2CKL A;  1WFK A;  2YQL A;  2QIZ A;  5FEY A;  5LKU A;  5C11 A;  2VPE A;  2K17 A;  4FJC A;  3L11 A;  4BHW A;  1JM7 B;  2M3H A;  4PTB A;  4AVX A;  2MD7 B;  2EA6 A;  4L58 A;  2VJF B;  2DX8 A;  3N9O A;  4UP0 A;  5KH9 A;  4O64 A;  1ZBD B;  2YUC A;  2ZET C;  2EGP A;  1XWH A;  4GNG A;  2OXQ C;  1IYM A;  2ECW A;  2QIC A;  3NG2 A;  3RPG B;  5LCW B;  2L43 A;  2YSJ A;  2MA5 A;  4FK5 A;  2K16 A;  5EYA F;  3PHD A;  4YAX A;  2PNX A;  4Q6F A;  4AYC B;  2VPD A;  2VPB A;  1WEP A;  2MA6 A;  1HYJ A;  2KYU A;  4ZDT A;  5D1M B;  5DKA A;  2KRE A;  2K1J A;  3ZPV E;  3ZTG A;  3VK6 A;  4C9Z A;  3T7L A;  1Z2Q A;  4QF2 A;  4YBT A;  4ZQL A;  2KWN A;  2CKL B;  3C6W A;  5B77 A;  2VJE B;  5KH3 A;  4BBQ A;  3GL6 A;  3T6R A;  2F6J A;  4S3O B;  3HCS A;  4IC2 A;  4WZ3 B;  2AN6 A;  4YBS A;  2YRE A;  3L1X A;  2YUR A;  1VYX A;  3N9M A;  5B78 A;  4I7C A;  4R2Y A;  1K2F A;  5FB0 A;  3M62 A;  2VP7 A;  4YAD A;  2F42 A;  3RPG C;  3M63 A;  2G43 A;  2PUY A;  2M85 A;  2FSA A;  3KNV A;  5B76 A;  2FUI A;  5J3X A;  4R7E A;  4F52 B;  1WGM A;  4QF3 A;  3EB6 A;  2VJF A;  1Z6U A;  1Z60 A;  5LKZ A;  4GNE A;  2YQM A;  2KFT A;  2UZG A;  3KV5 A;  3U5N A;  2NAA A;  2MNZ A;  3O36 A;  4MSX A;  2HYE D;  1RMD A;  2JMI A;  3ZYQ A;  2L80 A;  1N87 A;  3HCU A;  3ZVZ B;  4XI1 A;  2VJE A;  2L75 A;  2MD8 C;  1E4U A;  2I50 A;  4GND A;  4WA6 A;  5TAB A;  2LXP C;  2H0D A;  4UI9 B;  2JMJ A;  5I3L A;  3V43 A;  4YAT A;  3I2D A;  2L0B A;  2VPG A;  4YBM A;  5H9M A;  4N4F A;  2LGG A;  5B79 A;  3N9N A;  2E6R A;  3KQI A;  1VFY A;  2LGV A;  3O33 A;  2ECJ A;  3MHS A;  3GV4 A;  2KU3 A;  4B7Y C;  1LDK C;  2LRI C;  3C5K A;  2BAY A;  2KGG A;  4A4C A;  3SOX A;  1WEQ A;  5KH7 A;  3SHB A;  1WEV A;  4V3K C;  2C2L A;  1X4I A;  5G05 B;  5LKT A;  1WIL A;  3LQH A;  1WEN A;  2KIZ A;  3O37 A;  4WZ0 A;  3QZV A;  2CSY A;  1MM3 A;  3LRQ A;  5G04 B;  2KE1 A;  2LGK A;  1FBV A;  3RTR B;  2JRJ A;  5H1U A;  4AYC A;  5B75 A;  3SOW A;  4MVT A;  4LJN A;  3ASL A;  4IC3 A;  3LQJ A;  3HCT A;  4LLB A;  4UP5 A;  3N9Q A;  1DVP A;  2Y1N A;  1X4U A;  5FB1 A;  2KWK A;  3U5O A;  2H0D B;  4A0C D;  2KGI A;  2YW8 A;  2L5U A;  4L7X A;  1WEU A;  2KWO A;  2KR4 A;  1CHC A;  3O7A A;  2FUU A;  3SOU A;  1WEO A;  3ZNI A;  5H1T A;  1BOR A;  4CA1 A;  1G25 A;  2C2V S;  5TRB A;  3DQV R;  5AIT A;  2E6S A;  3KV6 A;  2LQ6 A;  2MUM A;  5TBN A;  4N3W A;  2HDP A;  5DIN A;  3U5P A;  4WZ2 A;  2ECN A;  3L1Z B;  2YSM A;  1WE9 A;  2LN0 A;  3M99 A;  2ECT A;  2LV9 A;  2K4D A;  4ZUX U;  4B86 C;  2YHN A;  2KWJ A;  2IDA A;  4TKP B;  1F62 A;  4LK9 A;  1FP0 A;  1MM2 A;  4W4U A;  4LKA A;  1WIM A;  1VD4 A;  4S3O C;  3PUQ A;  5B8D A;  2Y43 A;  2F6N A;  1HYI A;  4YAB A;  3N9P A;  2ECV A;  2MT5 A;  2Y1M A;  1T1H A;  3ZVY A;  1U6G B;  2M6M A;  5AIU A;  3ZPV 1;  2LXH C;  1WEM A;  5D1K B;  2M1R A;  3LQI A;  2RI7 A;  1JM7 A;  2RSD A;  2ECI A;  3O70 A;  4V3L C;  2XB1 A;  1JOC A;  2XEU A;  3O35 A;  2EOD A;  3U5M A;  5FER A;  5D1L B;  3N9L A;  4NN2 A;  5G0F A;  3EB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...