2LRIC

Nmr structure of the second phd finger of aire (aire-phd2)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
GAMEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoimmune regulator
publication title AIRE-PHD fingers are structural hubs to maintain the integrity of chromatin-associated interactome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lriC00
2LV9A 2ECTA 4WA6A 5AITA 4AYCA 2G45A 5JG6A 3O7AA 2K17A 2MNZA 1MM2A 3DPLR 2RI7A 4Q6FA 1WILA 1Z6UA 4A4BA 2EA6A 2YYRA 4MVTA 2MD8C 1WENA 2JMDA 5EYAF 2QICA 1K2FA 2XB1A 2VPDA 2LQ6A 2VP7A 4A0CD 4LLBA 4AVXA 2YREA 4AYCB 5D1MB 2E6RA 5FB1A 3LQIA 3ASLA 5B79A 1WEWA 4YBMA 2VJEA 4B86C 1WEMA 2LN0A 2MD7B 2YSMA 5KH3A 1LDJB 3MHSA 2I50A 3ZVZB 4GNEA 1F62A 2K4DA 2Y43A 4GNGA 3M62A 4QF2A 2MA6A 2C2LA 2Y1MA 2KGGA 1MM3A 2LGKA 2L43A 4A49A 4V3LC 1LDKC 2L80A 3ZPVE 5TDWA 2AN6A 2VJEB 2KWKA 3O35A 2QIZA 1Z2QA 3KNVA 2NAAA 3GV4A 1X4IA 3V43A 2M6MA 1HYJA 1WGMA 1HYIA 3ZYQA 3O34A 4ZQLA 4I7DA 1N87A 3SOXA 1T1HA 2H0DA 4UI9B 2VPBA 2VPGA 5J3XA 3LRQA 4R7EA 2L5UA 3C6WA 4LJNA 2KYUA 1FBVA 2M1RA 4LK9A 4YABA 2ECJA 2VJFA 2XEUA 2KE1A 4AUQB 2MNYA 2QJ0A 3FL2A 3GL6A 5G0FA 2ECIA 4NN2A 4YATA 2LGLA 3O70A 2G6QA 4YBTA 4I7BA 3VK6A 4F52B 3N9MA 1V87A 2KWOA 3SOUA 5B75A 2YURA 3ZVYA 3HTKC 2K16A 3LQJA 5TABA 3L1XA 2H0DB 1IYMA 4LKAA 3IHPA 4IC2A 4FK5A 2CSZA 2HYED 4CCGX 1WE9A 2LRIC 5TBNA 1DVPA 2VJFB 2EODA 3ZTGA 2G43A 4N3WA 2JMJA 1JOCA 4XI1A 1WEPA 3SHBA 5B77A 2KREA 2PNXA 3U5NA 1RMDA 2OXQC 2RSDA 1BORA 3N9QA 5DINA 1VFYA 2YUCA 3MHHA 5H1UA 5H1TA 2ECGA 2D8SA 2E6SA 2C2VS 2DX8A 1ZBDB 3N9OA 3PHDA 2LGVA 4IC3A 4FO9A 4AP4A 5H9MA 3U5OA 2CT2A 2CSYA 2FSAA 5D1KB 2MA5A 2K1JA 5H1VA 3M63A 4PTBA 3PUQA 4TKPB 4ZDTA 4YBSA 1WFKA 4N4FA 5LCWB 5KH9A 3M99A 3KQIA 2BAYA 2JRJA 4FIPA 2VPEA 1E4UA 4R8PK 3N9LA 5B76A 3EB5A 2KWNA 2IDAA 3DQVR 4V3KC 4O64A 2FUUA 2MUMA 4LADB 2YQMA 2F6NA 4PPEA 2LXHC 5AIUA 2YHNA 5LKXA 2F42A 1WEOA 2HDPA 4L7XA 2M3HA 3KV6A 3ZNIA 2MIQA 4X3GA 2LDRA 1X4JA 3O36A 3RTRB 4CA1A 2LXPC 2PUYA 2M85A 2YSJA 1Z60A 1CHCA 5D1LB 2ZETC 5C11A 2CKLA 3PURA 5TRBA 3N9NA 5G05B 3EB6A 4YC9A 3U5PA 2MT5A 5B8DA 2KFTA 1U6GB 2EGPA 2YU4A 1VD4A 1WESA 4B7YC 2L0BA 2ECVA 3NG2A 4S3OC 2YW8A 2LGGA 2YQLA 4YADA 4YAXA 3RPGC 2UZGA 4S3OB 3RPGB 2ECNA 4I7CA 3SOWA 2L75A 2YHOA 4P5OB 2CKLB 1WIMA 4QF3A 5C13A 4C9ZA 3KV5A 4R2YA 4W4UA 2YT5A 2ECWA 4WZ0A 5G04B 1JM7A 3HCUA 2JMIA 1WEQA 4GNFA 3HCTA 3O33A 2KGIA 5KH7A 4GB0A 3I2DA 4A4CA 4ZUXU 1WEVA 1WEUA 2Y1NA 3C5KA 4BHWA 5TDRA 3N9PA 5FEYA 4GNDA 5FERA 1FP0A 4WZ3B 4L58A 3T6RA 4FJCA 2VNFA 3U5MA 2KWJA 3O37A 5LKUA 3T7LA 1JM7B 4WZ2A 3L11A 2KU3A 4BBQA 1G25A 5DKAA 4MSXA 3ZPV1 1WEEA 3L1ZB 4UP0A 1VYXA 2F6JA 5B78A 5LKTA 4UP5A 5LKZA 5FB0A 2FUIA 2KR4A 3QZVA 1XWHA 3HCSA 1X4UA 2KIZA 3LQHA 5I3LA
chains in the Genus database with same CATH superfamily
2LV9A 2ECTA 4WA6A 5AITA 4AYCA 2G45A 4OGCA 3JUEA 2OWAA 5JG6A 3O7AA 2K17A 3LVRE 2DJAA 2MNZA 1MM2A 3DPLR 2RI7A 4Q6FA 1WILA 1Z6UA 4A4BA 2EA6A 2YYRA 4MVTA 2MD8C 1WENA 2JMDA 5EYAF 2QICA 1K2FA 3FM8C 2CRWA 2XB1A 2VPDA 2LQ6A 2JM3A 2VP7A 4A0CD 4LLBA 4AVXA 2YREA 3T9KA 4AYCB 5D1MB 2E6RA 4Z0RA 5FB1A 3LQIA 3ASLA 5B79A 1WEWA 2CONA 4YBMA 2VJEA 3DWDA 4B86C 1WEMA 2LN0A 1DCQA 2MD7B 2XOZA 2YSMA 5KH3A 1LDJB 3MHSA 3Q1DA 2I50A 3ZVZB 4GNEA 1F62A 2K4DA 2Y43A 4GNGA 3M62A 4QF2A 2MA6A 2C2LA 2Y1MA 2KGGA 1MM3A 2LGKA 2L43A 4A49A 4V3LC 1LDKC 2L80A 3ZPVE 5TDWA 2AN6A 2VJEB 2XOYA 2KWKA 3O47A 3O35A 2QIZA 1Z2QA 3KNVA 2NAAA 3GV4A 1X4IA 3V43A 2L7PA 2M6MA 1HYJA 1WGMA 1HYIA 3ZYQA 3O34A 4ZQLA 4I7DA 1N87A 3SOXA 3SUBA 1T1HA 2RR4A 5SVXA 2H0DA 4UI9B 2VPBA 2VPGA 5J3XA 3LRQA 4R7EA 2L5UA 3C6WA 4LJNA 2KYUA 2D8UA 1FBVA 2KKXA 2FFWA 2M1RA 4LK9A 1MBMA 4YABA 2ECJA 2VJFA 2XEUA 2KE1A 4AUQB 2MNYA 2QJ0A 3FL2A 3GL6A 5G0FA 2ECIA 4NN2A 4YATA 2LGLA 3O70A 2G6QA 4YBTA 4I7BA 3VK6A 4F52B 4Z0OA 3N9MA 1V87A 2KWOA 3SOUA 5B75A 2EGMA 2YURA 3ZVYA 2FD4A 3HTKC 3PLWA 2K16A 3LQJA 5TABA 3L1XA 2H0DB 2JUNA 1IYMA 4LKAA 3IHPA 4IC2A 4FK5A 2CSZA 2HYED 4CCGX 1WE9A 3M7KA 2LRIC 5TBNA 1DVPA 2VJFB 2EODA 3ZTGA 2G43A 2DSMA 4N3WA 2JMJA 3H7HA 1JOCA 4XI1A 1WEPA 3SHBA 2IQJA 5B77A 2KREA 2PNXA 3U5NA 1RMDA 2OXQC 2RSDA 1BORA 3N9QA 5DINA 1VFYA 2YUCA 3MHHA 5H1UA 5H1TA 2ECGA 5K3QA 2D8SA 2E6SA 2C2VS 2DX8A 1ZBDB 3N9OA 3PHDA 2LGVA 4IC3A 4FO9A 4AP4A 5H9MA 3U5OA 2CT2A 2CSYA 2FSAA 5D1KB 2MA5A 2K1JA 5H1VA 3M63A 3FAOA 4PTBA 3PUQA 4TKPB 4ZDTA 4YBSA 1WFKA 4QQ4A 2E61A 4F1PA 4N4FA 5LCWB 5KH9A 2CRRA 5SVYA 3M99A 3KQIA 2BAYA 2JRJA 4FIPA 2VPEA 1E4UA 4R8PK 3N9LA 5B76A 3EB5A 2KWNA 2IDAA 3DQVR 2XOCA 4V3KC 4O64A 2FUUA 2MUMA 4LADB 2YQMA 2F6NA 4PPEA 2LXHC 5AIUA 2YHNA 5LKXA 2F42A 1WEOA 2HDPA 2YVRA 4L7XA 2M3HA 3LVQE 3FANA 3KV6A 3ZNIA 2MIQA 4X3GA 2LDRA 4O62A 2B0OE 1X4JA 3O36A 3RTRB 4CA1A 2LXPC 2PUYA 2M85A 2YSJA 2MKEA 1Z60A 1CHCA 5D1LB 2KKYA 2ZETC 5C11A 2CKLA 3PURA 5SVIA 5TRBA 3N9NA 5G05B 4H9DA 4OGEA 3EB6A 3LDYA 4YC9A 3U5PA 2MT5A 5B8DA 2KFTA 1U6GB 2EGPA 3E2DA 2YU4A 1VD4A 1WESA 4B7YC 2L0BA 2ECVA 3NG2A 4S3OC 2YW8A 2LGGA 2YQLA 4YADA 4YAXA 3RPGC 2UZGA 4S3OB 2P57A 3RPGB 2ECNA 4I7CA 2LAUA 3SOWA 2L75A 2YHOA 4P5OB 2CKLB 5SVIB 1WIMA 3FJUB 4QF3A 5C13A 4C9ZA 3KV5A 4R2YA 4W4UA 2YT5A 2ECWA 4WZ0A 5G04B 3KDEC 1JM7A 3HCUA 2JMIA 1WEQA 4GNFA 3HCTA 3O33A 2KGIA 5KH7A 2M13A 4GB0A 3I2DA 4A4CA 2EXUA 4ZUXU 1WEVA 3DDTA 1WEUA 2Y1NA 3C5KA 3LJUX 4BHWA 5TDRA 3N9PA 5FEYA 4GNDA 5FERA 1FP0A 4WZ3B 4L58A 3T6RA 4FJCA 2VNFA 3U5MA 2KWJA 3O37A 5LKUA 3T7LA 1JM7B 4WZ2A 3L11A 2KU3A 4BBQA 1G25A 5DKAA 4MSXA 3ZPV1 1WEEA 3L1ZB 4UP0A 1VYXA 2F6JA 3FEHA 2CSVA 5B78A 3MDBC 5LKTA 4UP5A 5LKZA 5FB0A 2FUIA 2KR4A 3QZVA 1XWHA 3HCSA 1X4UA 2KIZA 2XP0A 3LQHA 5I3LA
chains in the Genus database with same CATH topology
2LV9A 2ECTA 4WA6A 5AITA 4AYCA 2G45A 5JG6A 3O7AA 2K17A 2MNZA 1MM2A 3DPLR 2RI7A 4Q6FA 1WILA 1Z6UA 4A4BA 2EA6A 2YYRA 4MVTA 2MD8C 1WENA 2JMDA 5EYAF 2QICA 1K2FA 2XB1A 2VPDA 2LQ6A 2VP7A 4A0CD 4LLBA 4AVXA 2YREA 4AYCB 5D1MB 2E6RA 5FB1A 3LQIA 3ASLA 5B79A 1WEWA 4YBMA 2VJEA 4B86C 1WEMA 2LN0A 2MD7B 2YSMA 5KH3A 1LDJB 3MHSA 2I50A 3ZVZB 4GNEA 1F62A 2K4DA 2Y43A 4GNGA 3M62A 4QF2A 2MA6A 2C2LA 2Y1MA 2KGGA 1MM3A 2LGKA 2L43A 4A49A 4V3LC 1LDKC 2L80A 3ZPVE 5TDWA 2AN6A 2VJEB 2KWKA 3O35A 2QIZA 1Z2QA 3KNVA 2NAAA 3GV4A 1X4IA 3V43A 2M6MA 1HYJA 1WGMA 1HYIA 3ZYQA 3O34A 4ZQLA 4I7DA 1N87A 3SOXA 1T1HA 2H0DA 4UI9B 2VPBA 2VPGA 5J3XA 3LRQA 4R7EA 2L5UA 3C6WA 4LJNA 2KYUA 1FBVA 2M1RA 4LK9A 4YABA 2ECJA 2VJFA 2XEUA 2KE1A 4AUQB 2MNYA 2QJ0A 3FL2A 3GL6A 5G0FA 2ECIA 4NN2A 4YATA 2LGLA 3O70A 2G6QA 4YBTA 4I7BA 3VK6A 4F52B 3N9MA 1V87A 2KWOA 3SOUA 5B75A 2YURA 3ZVYA 3HTKC 2K16A 3LQJA 5TABA 3L1XA 2H0DB 1IYMA 4LKAA 3IHPA 4IC2A 4FK5A 2CSZA 2HYED 4CCGX 1WE9A 2LRIC 5TBNA 1DVPA 2VJFB 2EODA 3ZTGA 2G43A 4N3WA 2JMJA 1JOCA 4XI1A 1WEPA 3SHBA 5B77A 2KREA 2PNXA 3U5NA 1RMDA 2OXQC 2RSDA 1BORA 3N9QA 5DINA 1VFYA 2YUCA 3MHHA 5H1UA 5H1TA 2ECGA 2D8SA 2E6SA 2C2VS 2DX8A 1ZBDB 3N9OA 3PHDA 2LGVA 4IC3A 4FO9A 4AP4A 5H9MA 3U5OA 2CT2A 2CSYA 2FSAA 5D1KB 2MA5A 2K1JA 5H1VA 3M63A 4PTBA 3PUQA 4TKPB 4ZDTA 4YBSA 1WFKA 4N4FA 5LCWB 5KH9A 3M99A 3KQIA 2BAYA 2JRJA 4FIPA 2VPEA 1E4UA 4R8PK 3N9LA 5B76A 3EB5A 2KWNA 2IDAA 3DQVR 4V3KC 4O64A 2FUUA 2MUMA 4LADB 2YQMA 2F6NA 4PPEA 2LXHC 5AIUA 2YHNA 5LKXA 2F42A 1WEOA 2HDPA 4L7XA 2M3HA 3KV6A 3ZNIA 2MIQA 4X3GA 2LDRA 1X4JA 3O36A 3RTRB 4CA1A 2LXPC 2PUYA 2M85A 2YSJA 1Z60A 1CHCA 5D1LB 2ZETC 5C11A 2CKLA 3PURA 5TRBA 3N9NA 5G05B 3EB6A 4YC9A 3U5PA 2MT5A 5B8DA 2KFTA 1U6GB 2EGPA 2YU4A 1VD4A 1WESA 4B7YC 2L0BA 2ECVA 3NG2A 4S3OC 2YW8A 2LGGA 2YQLA 4YADA 4YAXA 3RPGC 2UZGA 4S3OB 3RPGB 2ECNA 4I7CA 3SOWA 2L75A 2YHOA 4P5OB 2CKLB 1WIMA 4QF3A 5C13A 4C9ZA 3KV5A 4R2YA 4W4UA 2YT5A 2ECWA 4WZ0A 5G04B 1JM7A 3HCUA 2JMIA 1WEQA 4GNFA 3HCTA 3O33A 2KGIA 5KH7A 4GB0A 3I2DA 4A4CA 4ZUXU 1WEVA 1WEUA 2Y1NA 3C5KA 4BHWA 5TDRA 3N9PA 5FEYA 4GNDA 5FERA 1FP0A 4WZ3B 4L58A 3T6RA 4FJCA 2VNFA 3U5MA 2KWJA 3O37A 5LKUA 3T7LA 1JM7B 4WZ2A 3L11A 2KU3A 4BBQA 1G25A 5DKAA 4MSXA 3ZPV1 1WEEA 3L1ZB 4UP0A 1VYXA 2F6JA 5B78A 5LKTA 4UP5A 5LKZA 5FB0A 2FUIA 2KR4A 3QZVA 1XWHA 3HCSA 1X4UA 2KIZA 3LQHA 5I3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV9 A;  2ECT A;  4WA6 A;  5AIT A;  4AYC A;  2G45 A;  5JG6 A;  3O7A A;  2K17 A;  2MNZ A;  1MM2 A;  3DPL R;  2RI7 A;  4Q6F A;  1WIL A;  1Z6U A;  4A4B A;  2EA6 A;  2YYR A;  4MVT A;  2MD8 C;  1WEN A;  2JMD A;  5EYA F;  2QIC A;  1K2F A;  2XB1 A;  2VPD A;  2LQ6 A;  2VP7 A;  4A0C D;  4LLB A;  4AVX A;  2YRE A;  4AYC B;  5D1M B;  2E6R A;  5FB1 A;  3LQI A;  3ASL A;  5B79 A;  1WEW A;  4YBM A;  2VJE A;  4B86 C;  1WEM A;  2LN0 A;  2MD7 B;  2YSM A;  5KH3 A;  1LDJ B;  3MHS A;  2I50 A;  3ZVZ B;  4GNE A;  1F62 A;  2K4D A;  2Y43 A;  4GNG A;  3M62 A;  4QF2 A;  2MA6 A;  2C2L A;  2Y1M A;  2KGG A;  1MM3 A;  2LGK A;  2L43 A;  4A49 A;  4V3L C;  1LDK C;  2L80 A;  3ZPV E;  5TDW A;  2AN6 A;  2VJE B;  2KWK A;  3O35 A;  2QIZ A;  1Z2Q A;  3KNV A;  2NAA A;  3GV4 A;  1X4I A;  3V43 A;  2M6M A;  1HYJ A;  1WGM A;  1HYI A;  3ZYQ A;  3O34 A;  4ZQL A;  4I7D A;  1N87 A;  3SOX A;  1T1H A;  2H0D A;  4UI9 B;  2VPB A;  2VPG A;  5J3X A;  3LRQ A;  4R7E A;  2L5U A;  3C6W A;  4LJN A;  2KYU A;  1FBV A;  2M1R A;  4LK9 A;  4YAB A;  2ECJ A;  2VJF A;  2XEU A;  2KE1 A;  4AUQ B;  2MNY A;  2QJ0 A;  3FL2 A;  3GL6 A;  5G0F A;  2ECI A;  4NN2 A;  4YAT A;  2LGL A;  3O70 A;  2G6Q A;  4YBT A;  4I7B A;  3VK6 A;  4F52 B;  3N9M A;  1V87 A;  2KWO A;  3SOU A;  5B75 A;  2YUR A;  3ZVY A;  3HTK C;  2K16 A;  3LQJ A;  5TAB A;  3L1X A;  2H0D B;  1IYM A;  4LKA A;  3IHP A;  4IC2 A;  4FK5 A;  2CSZ A;  2HYE D;  4CCG X;  1WE9 A;  2LRI C;  5TBN A;  1DVP A;  2VJF B;  2EOD A;  3ZTG A;  2G43 A;  4N3W A;  2JMJ A;  1JOC A;  4XI1 A;  1WEP A;  3SHB A;  5B77 A;  2KRE A;  2PNX A;  3U5N A;  1RMD A;  2OXQ C;  2RSD A;  1BOR A;  3N9Q A;  5DIN A;  1VFY A;  2YUC A;  3MHH A;  5H1U A;  5H1T A;  2ECG A;  2D8S A;  2E6S A;  2C2V S;  2DX8 A;  1ZBD B;  3N9O A;  3PHD A;  2LGV A;  4IC3 A;  4FO9 A;  4AP4 A;  5H9M A;  3U5O A;  2CT2 A;  2CSY A;  2FSA A;  5D1K B;  2MA5 A;  2K1J A;  5H1V A;  3M63 A;  4PTB A;  3PUQ A;  4TKP B;  4ZDT A;  4YBS A;  1WFK A;  4N4F A;  5LCW B;  5KH9 A;  3M99 A;  3KQI A;  2BAY A;  2JRJ A;  4FIP A;  2VPE A;  1E4U A;  4R8P K;  3N9L A;  5B76 A;  3EB5 A;  2KWN A;  2IDA A;  3DQV R;  4V3K C;  4O64 A;  2FUU A;  2MUM A;  4LAD B;  2YQM A;  2F6N A;  4PPE A;  2LXH C;  5AIU A;  2YHN A;  5LKX A;  2F42 A;  1WEO A;  2HDP A;  4L7X A;  2M3H A;  3KV6 A;  3ZNI A;  2MIQ A;  4X3G A;  2LDR A;  1X4J A;  3O36 A;  3RTR B;  4CA1 A;  2LXP C;  2PUY A;  2M85 A;  2YSJ A;  1Z60 A;  1CHC A;  5D1L B;  2ZET C;  5C11 A;  2CKL A;  3PUR A;  5TRB A;  3N9N A;  5G05 B;  3EB6 A;  4YC9 A;  3U5P A;  2MT5 A;  5B8D A;  2KFT A;  1U6G B;  2EGP A;  2YU4 A;  1VD4 A;  1WES A;  4B7Y C;  2L0B A;  2ECV A;  3NG2 A;  4S3O C;  2YW8 A;  2LGG A;  2YQL A;  4YAD A;  4YAX A;  3RPG C;  2UZG A;  4S3O B;  3RPG B;  2ECN A;  4I7C A;  3SOW A;  2L75 A;  2YHO A;  4P5O B;  2CKL B;  1WIM A;  4QF3 A;  5C13 A;  4C9Z A;  3KV5 A;  4R2Y A;  4W4U A;  2YT5 A;  2ECW A;  4WZ0 A;  5G04 B;  1JM7 A;  3HCU A;  2JMI A;  1WEQ A;  4GNF A;  3HCT A;  3O33 A;  2KGI A;  5KH7 A;  4GB0 A;  3I2D A;  4A4C A;  4ZUX U;  1WEV A;  1WEU A;  2Y1N A;  3C5K A;  4BHW A;  5TDR A;  3N9P A;  5FEY A;  4GND A;  5FER A;  1FP0 A;  4WZ3 B;  4L58 A;  3T6R A;  4FJC A;  2VNF A;  3U5M A;  2KWJ A;  3O37 A;  5LKU A;  3T7L A;  1JM7 B;  4WZ2 A;  3L11 A;  2KU3 A;  4BBQ A;  1G25 A;  5DKA A;  4MSX A;  3ZPV 1;  1WEE A;  3L1Z B;  4UP0 A;  1VYX A;  2F6J A;  5B78 A;  5LKT A;  4UP5 A;  5LKZ A;  5FB0 A;  2FUI A;  2KR4 A;  3QZV A;  1XWH A;  3HCS A;  1X4U A;  2KIZ A;  3LQH A;  5I3L A; 
#chains in the Genus database with same CATH topology
 2LV9 A;  2ECT A;  4WA6 A;  5AIT A;  4AYC A;  2G45 A;  4OGC A;  3JUE A;  2OWA A;  5JG6 A;  3O7A A;  2K17 A;  3LVR E;  2DJA A;  2MNZ A;  1MM2 A;  3DPL R;  2RI7 A;  4Q6F A;  1WIL A;  1Z6U A;  4A4B A;  2EA6 A;  2YYR A;  4MVT A;  2MD8 C;  1WEN A;  2JMD A;  5EYA F;  2QIC A;  1K2F A;  3FM8 C;  2CRW A;  2XB1 A;  2VPD A;  2LQ6 A;  2JM3 A;  2VP7 A;  4A0C D;  4LLB A;  4AVX A;  2YRE A;  3T9K A;  4AYC B;  5D1M B;  2E6R A;  4Z0R A;  5FB1 A;  3LQI A;  3ASL A;  5B79 A;  1WEW A;  2CON A;  4YBM A;  2VJE A;  3DWD A;  4B86 C;  1WEM A;  2LN0 A;  1DCQ A;  2MD7 B;  2XOZ A;  2YSM A;  5KH3 A;  1LDJ B;  3MHS A;  3Q1D A;  2I50 A;  3ZVZ B;  4GNE A;  1F62 A;  2K4D A;  2Y43 A;  4GNG A;  3M62 A;  4QF2 A;  2MA6 A;  2C2L A;  2Y1M A;  2KGG A;  1MM3 A;  2LGK A;  2L43 A;  4A49 A;  4V3L C;  1LDK C;  2L80 A;  3ZPV E;  5TDW A;  2AN6 A;  2VJE B;  2XOY A;  2KWK A;  3O47 A;  3O35 A;  2QIZ A;  1Z2Q A;  3KNV A;  2NAA A;  3GV4 A;  1X4I A;  3V43 A;  2L7P A;  2M6M A;  1HYJ A;  1WGM A;  1HYI A;  3ZYQ A;  3O34 A;  4ZQL A;  4I7D A;  1N87 A;  3SOX A;  3SUB A;  1T1H A;  2RR4 A;  5SVX A;  2H0D A;  4UI9 B;  2VPB A;  2VPG A;  5J3X A;  3LRQ A;  4R7E A;  2L5U A;  3C6W A;  4LJN A;  2KYU A;  2D8U A;  1FBV A;  2KKX A;  2FFW A;  2M1R A;  4LK9 A;  1MBM A;  4YAB A;  2ECJ A;  2VJF A;  2XEU A;  2KE1 A;  4AUQ B;  2MNY A;  2QJ0 A;  3FL2 A;  3GL6 A;  5G0F A;  2ECI A;  4NN2 A;  4YAT A;  2LGL A;  3O70 A;  2G6Q A;  4YBT A;  4I7B A;  3VK6 A;  4F52 B;  4Z0O A;  3N9M A;  1V87 A;  2KWO A;  3SOU A;  5B75 A;  2EGM A;  2YUR A;  3ZVY A;  2FD4 A;  3HTK C;  3PLW A;  2K16 A;  3LQJ A;  5TAB A;  3L1X A;  2H0D B;  2JUN A;  1IYM A;  4LKA A;  3IHP A;  4IC2 A;  4FK5 A;  2CSZ A;  2HYE D;  4CCG X;  1WE9 A;  3M7K A;  2LRI C;  5TBN A;  1DVP A;  2VJF B;  2EOD A;  3ZTG A;  2G43 A;  2DSM A;  4N3W A;  2JMJ A;  3H7H A;  1JOC A;  4XI1 A;  1WEP A;  3SHB A;  2IQJ A;  5B77 A;  2KRE A;  2PNX A;  3U5N A;  1RMD A;  2OXQ C;  2RSD A;  1BOR A;  3N9Q A;  5DIN A;  1VFY A;  2YUC A;  3MHH A;  5H1U A;  5H1T A;  2ECG A;  5K3Q A;  2D8S A;  2E6S A;  2C2V S;  2DX8 A;  1ZBD B;  3N9O A;  3PHD A;  2LGV A;  4IC3 A;  4FO9 A;  4AP4 A;  5H9M A;  3U5O A;  2CT2 A;  2CSY A;  2FSA A;  5D1K B;  2MA5 A;  2K1J A;  5H1V A;  3M63 A;  3FAO A;  4PTB A;  3PUQ A;  4TKP B;  4ZDT A;  4YBS A;  1WFK A;  4QQ4 A;  2E61 A;  4F1P A;  4N4F A;  5LCW B;  5KH9 A;  2CRR A;  5SVY A;  3M99 A;  3KQI A;  2BAY A;  2JRJ A;  4FIP A;  2VPE A;  1E4U A;  4R8P K;  3N9L A;  5B76 A;  3EB5 A;  2KWN A;  2IDA A;  3DQV R;  2XOC A;  4V3K C;  4O64 A;  2FUU A;  2MUM A;  4LAD B;  2YQM A;  2F6N A;  4PPE A;  2LXH C;  5AIU A;  2YHN A;  5LKX A;  2F42 A;  1WEO A;  2HDP A;  2YVR A;  4L7X A;  2M3H A;  3LVQ E;  3FAN A;  3KV6 A;  3ZNI A;  2MIQ A;  4X3G A;  2LDR A;  4O62 A;  2B0O E;  1X4J A;  3O36 A;  3RTR B;  4CA1 A;  2LXP C;  2PUY A;  2M85 A;  2YSJ A;  2MKE A;  1Z60 A;  1CHC A;  5D1L B;  2KKY A;  2ZET C;  5C11 A;  2CKL A;  3PUR A;  5SVI A;  5TRB A;  3N9N A;  5G05 B;  4H9D A;  4OGE A;  3EB6 A;  3LDY A;  4YC9 A;  3U5P A;  2MT5 A;  5B8D A;  2KFT A;  1U6G B;  2EGP A;  3E2D A;  2YU4 A;  1VD4 A;  1WES A;  4B7Y C;  2L0B A;  2ECV A;  3NG2 A;  4S3O C;  2YW8 A;  2LGG A;  2YQL A;  4YAD A;  4YAX A;  3RPG C;  2UZG A;  4S3O B;  2P57 A;  3RPG B;  2ECN A;  4I7C A;  2LAU A;  3SOW A;  2L75 A;  2YHO A;  4P5O B;  2CKL B;  5SVI B;  1WIM A;  3FJU B;  4QF3 A;  5C13 A;  4C9Z A;  3KV5 A;  4R2Y A;  4W4U A;  2YT5 A;  2ECW A;  4WZ0 A;  5G04 B;  3KDE C;  1JM7 A;  3HCU A;  2JMI A;  1WEQ A;  4GNF A;  3HCT A;  3O33 A;  2KGI A;  5KH7 A;  2M13 A;  4GB0 A;  3I2D A;  4A4C A;  2EXU A;  4ZUX U;  1WEV A;  3DDT A;  1WEU A;  2Y1N A;  3C5K A;  3LJU X;  4BHW A;  5TDR A;  3N9P A;  5FEY A;  4GND A;  5FER A;  1FP0 A;  4WZ3 B;  4L58 A;  3T6R A;  4FJC A;  2VNF A;  3U5M A;  2KWJ A;  3O37 A;  5LKU A;  3T7L A;  1JM7 B;  4WZ2 A;  3L11 A;  2KU3 A;  4BBQ A;  1G25 A;  5DKA A;  4MSX A;  3ZPV 1;  1WEE A;  3L1Z B;  4UP0 A;  1VYX A;  2F6J A;  3FEH A;  2CSV A;  5B78 A;  3MDB C;  5LKT A;  4UP5 A;  5LKZ A;  5FB0 A;  2FUI A;  2KR4 A;  3QZV A;  1XWH A;  3HCS A;  1X4U A;  2KIZ A;  2XP0 A;  3LQH A;  5I3L A; 
#chains in the Genus database with same CATH homology
 2LV9 A;  2ECT A;  4WA6 A;  5AIT A;  4AYC A;  2G45 A;  5JG6 A;  3O7A A;  2K17 A;  2MNZ A;  1MM2 A;  3DPL R;  2RI7 A;  4Q6F A;  1WIL A;  1Z6U A;  4A4B A;  2EA6 A;  2YYR A;  4MVT A;  2MD8 C;  1WEN A;  2JMD A;  5EYA F;  2QIC A;  1K2F A;  2XB1 A;  2VPD A;  2LQ6 A;  2VP7 A;  4A0C D;  4LLB A;  4AVX A;  2YRE A;  4AYC B;  5D1M B;  2E6R A;  5FB1 A;  3LQI A;  3ASL A;  5B79 A;  1WEW A;  4YBM A;  2VJE A;  4B86 C;  1WEM A;  2LN0 A;  2MD7 B;  2YSM A;  5KH3 A;  1LDJ B;  3MHS A;  2I50 A;  3ZVZ B;  4GNE A;  1F62 A;  2K4D A;  2Y43 A;  4GNG A;  3M62 A;  4QF2 A;  2MA6 A;  2C2L A;  2Y1M A;  2KGG A;  1MM3 A;  2LGK A;  2L43 A;  4A49 A;  4V3L C;  1LDK C;  2L80 A;  3ZPV E;  5TDW A;  2AN6 A;  2VJE B;  2KWK A;  3O35 A;  2QIZ A;  1Z2Q A;  3KNV A;  2NAA A;  3GV4 A;  1X4I A;  3V43 A;  2M6M A;  1HYJ A;  1WGM A;  1HYI A;  3ZYQ A;  3O34 A;  4ZQL A;  4I7D A;  1N87 A;  3SOX A;  1T1H A;  2H0D A;  4UI9 B;  2VPB A;  2VPG A;  5J3X A;  3LRQ A;  4R7E A;  2L5U A;  3C6W A;  4LJN A;  2KYU A;  1FBV A;  2M1R A;  4LK9 A;  4YAB A;  2ECJ A;  2VJF A;  2XEU A;  2KE1 A;  4AUQ B;  2MNY A;  2QJ0 A;  3FL2 A;  3GL6 A;  5G0F A;  2ECI A;  4NN2 A;  4YAT A;  2LGL A;  3O70 A;  2G6Q A;  4YBT A;  4I7B A;  3VK6 A;  4F52 B;  3N9M A;  1V87 A;  2KWO A;  3SOU A;  5B75 A;  2YUR A;  3ZVY A;  3HTK C;  2K16 A;  3LQJ A;  5TAB A;  3L1X A;  2H0D B;  1IYM A;  4LKA A;  3IHP A;  4IC2 A;  4FK5 A;  2CSZ A;  2HYE D;  4CCG X;  1WE9 A;  2LRI C;  5TBN A;  1DVP A;  2VJF B;  2EOD A;  3ZTG A;  2G43 A;  4N3W A;  2JMJ A;  1JOC A;  4XI1 A;  1WEP A;  3SHB A;  5B77 A;  2KRE A;  2PNX A;  3U5N A;  1RMD A;  2OXQ C;  2RSD A;  1BOR A;  3N9Q A;  5DIN A;  1VFY A;  2YUC A;  3MHH A;  5H1U A;  5H1T A;  2ECG A;  2D8S A;  2E6S A;  2C2V S;  2DX8 A;  1ZBD B;  3N9O A;  3PHD A;  2LGV A;  4IC3 A;  4FO9 A;  4AP4 A;  5H9M A;  3U5O A;  2CT2 A;  2CSY A;  2FSA A;  5D1K B;  2MA5 A;  2K1J A;  5H1V A;  3M63 A;  4PTB A;  3PUQ A;  4TKP B;  4ZDT A;  4YBS A;  1WFK A;  4N4F A;  5LCW B;  5KH9 A;  3M99 A;  3KQI A;  2BAY A;  2JRJ A;  4FIP A;  2VPE A;  1E4U A;  4R8P K;  3N9L A;  5B76 A;  3EB5 A;  2KWN A;  2IDA A;  3DQV R;  4V3K C;  4O64 A;  2FUU A;  2MUM A;  4LAD B;  2YQM A;  2F6N A;  4PPE A;  2LXH C;  5AIU A;  2YHN A;  5LKX A;  2F42 A;  1WEO A;  2HDP A;  4L7X A;  2M3H A;  3KV6 A;  3ZNI A;  2MIQ A;  4X3G A;  2LDR A;  1X4J A;  3O36 A;  3RTR B;  4CA1 A;  2LXP C;  2PUY A;  2M85 A;  2YSJ A;  1Z60 A;  1CHC A;  5D1L B;  2ZET C;  5C11 A;  2CKL A;  3PUR A;  5TRB A;  3N9N A;  5G05 B;  3EB6 A;  4YC9 A;  3U5P A;  2MT5 A;  5B8D A;  2KFT A;  1U6G B;  2EGP A;  2YU4 A;  1VD4 A;  1WES A;  4B7Y C;  2L0B A;  2ECV A;  3NG2 A;  4S3O C;  2YW8 A;  2LGG A;  2YQL A;  4YAD A;  4YAX A;  3RPG C;  2UZG A;  4S3O B;  3RPG B;  2ECN A;  4I7C A;  3SOW A;  2L75 A;  2YHO A;  4P5O B;  2CKL B;  1WIM A;  4QF3 A;  5C13 A;  4C9Z A;  3KV5 A;  4R2Y A;  4W4U A;  2YT5 A;  2ECW A;  4WZ0 A;  5G04 B;  1JM7 A;  3HCU A;  2JMI A;  1WEQ A;  4GNF A;  3HCT A;  3O33 A;  2KGI A;  5KH7 A;  4GB0 A;  3I2D A;  4A4C A;  4ZUX U;  1WEV A;  1WEU A;  2Y1N A;  3C5K A;  4BHW A;  5TDR A;  3N9P A;  5FEY A;  4GND A;  5FER A;  1FP0 A;  4WZ3 B;  4L58 A;  3T6R A;  4FJC A;  2VNF A;  3U5M A;  2KWJ A;  3O37 A;  5LKU A;  3T7L A;  1JM7 B;  4WZ2 A;  3L11 A;  2KU3 A;  4BBQ A;  1G25 A;  5DKA A;  4MSX A;  3ZPV 1;  1WEE A;  3L1Z B;  4UP0 A;  1VYX A;  2F6J A;  5B78 A;  5LKT A;  4UP5 A;  5LKZ A;  5FB0 A;  2FUI A;  2KR4 A;  3QZV A;  1XWH A;  3HCS A;  1X4U A;  2KIZ A;  3LQH A;  5I3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...