2LRIC

Nmr structure of the second phd finger of aire (aire-phd2)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
GAMEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Autoimmune regulator
publication title AIRE-PHD fingers are structural hubs to maintain the integrity of chromatin-associated interactome.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lriC00
5TDRA 2ECTA 4FO9A 3C5KA 3IHPA 4YATA 2KFTA 2ZETC 2E6SA 2G45A 5LKUA 3N9MA 2RI7A 4FK5A 4AP4A 2LGGA 3V43A 5TRBA 4S3OB 2HYED 2K17A 2KWJA 1FBVA 1VD4A 2VPBA 2C2LA 3DQVR 5TBNA 2M1RA 2KYUA 4QF3A 1WIMA 4YADA 4XI1A 1VFYA 2XB1A 1N87A 3ZPV1 3LQIA 1WEVA 2MA5A 5B77A 3N9LA 3U5PA 4BBQA 2ECNA 1WGMA 1LDKC 4FJCA 2UZGA 3PURA 2YURA 3O7AA 2MA6A 2KREA 2VPEA 3RPGB 3EB5A 2CKLB 4AVXA 5LKZA 3QZVA 2VJEA 5FERA 4GB0A 1XWHA 2YW8A 3U5OA 2YREA 2F42A 4FIPA 4AYCB 5H9MA 3I2DA 2MD8C 2C2VS 2M85A 4N3WA 5B78A 3MHHA 2LGLA 2LXHC 5KH9A 2FUUA 2LXPC 1FP0A 4CA1A 2L43A 4I7CA 2VJFB 3L1XA 4WZ0A 1G25A 2PUYA 1WEOA 2BAYA 5JG6A 3T7LA 3HCUA 2CSZA 4YABA 4GNEA 5G0FA 3O33A 3O37A 3LQHA 2LGKA 4N4FA 3KV5A 2EA6A 1WEWA 1T1HA 2ECWA 3GL6A 3LQJA 1WFKA 3VK6A 2F6JA 2MIQA 2YUCA 2YU4A 4I7DA 3O34A 2L80A 4V3LC 2CKLA 5LKXA 4CCGX 2QJ0A 4Q6FA 1WE9A 2LRIC 5J3XA 2VPDA 2MNZA 2KR4A 4PTBA 4NN2A 2JRJA 2KE1A 5D1LB 2KWKA 1WILA 3M63A 1WEEA 4LJNA 2PNXA 2L0BA 4AYCA 4LLBA 4L7XA 4YBMA 1X4UA 3HCTA 5KH7A 4AUQB 2YSMA 1WEUA 1LDJB 2QICA 2G6QA 1WEMA 2VJFA 2VNFA 3C6WA 2KGGA 1X4IA 2QIZA 5H1UA 2ECVA 1F62A 1JM7B 2JMDA 5G04B 4A4CA 1MM3A 5B75A 5LKTA 2F6NA 3KQIA 1WESA 1ZBDB 2VP7A 4UP5A 2ECIA 3DPLR 4YBTA 5TABA 4LKAA 4MVTA 3ASLA 2LV9A 2K4DA 2YYRA 4YAXA 5B76A 1VYXA 2KWNA 5G05B 1Z2QA 2FUIA 4UP0A 2MD7B 5I3LA 5D1MB 3N9QA 5EYAF 2IDAA 3GV4A 3O70A 3SHBA 3O36A 2YSJA 4YC9A 1JOCA 3M62A 5D1KB 4TKPB 2E6RA 2HDPA 4X3GA 4ZDTA 2I50A 5C11A 2LDRA 4LK9A 4L58A 5AITA 4YBSA 3T6RA 5TDWA 2K16A 1JM7A 3N9OA 2KWOA 2YHNA 5H1VA 1IYMA 4B7YC 5B79A 3O35A 2EODA 3NG2A 2MNYA 4UI9B 2NAAA 4W4UA 5DKAA 3ZYQA 4O64A 2KIZA 4PPEA 3MHSA 1MM2A 4WA6A 2EGPA 3ZVZB 2XEUA 3ZPVE 2LQ6A 2H0DB 2VJEB 3PHDA 4GNGA 4IC2A 3HCSA 5B8DA 2JMJA 4F52B 4WZ3B 2DX8A 5H1TA 3KNVA 2L75A 4R8PK 3EB6A 4P5OB 2CSYA 3RPGC 5LCWB 2CT2A 4A4BA 4ZQLA 1HYIA 3ZTGA 2ECGA 4I7BA 2LGVA 3U5NA 2ECJA 2VPGA 4A49A 2K1JA 4R2YA 2YHOA 4GNFA 4WZ2A 1K2FA 5AIUA 3SOUA 2M3HA 3SOXA 1U6GB 3LRQA 2LN0A 2Y1MA 3L11A 2L5UA 5DINA 3FL2A 2YQLA 3PUQA 4A0CD 4QF2A 4ZUXU 5FEYA 2G43A 2H0DA 5C13A 1E4UA 1RMDA 2MUMA 3HTKC 4LADB 3U5MA 3M99A 2OXQC 3N9NA 1Z60A 2D8SA 4B86C 3ZVYA 1DVPA 5FB1A 2M6MA 3SOWA 3RTRB 1BORA 3ZNIA 2YQMA 3KV6A 3N9PA 2MT5A 1X4JA 4IC3A 1V87A 4S3OC 1WENA 5KH3A 2KU3A 2Y1NA 1WEQA 4MSXA 2RSDA 1Z6UA 2JMIA 2YT5A 4R7EA 4V3KC 1HYJA 4BHWA 2AN6A 5FB0A 4GNDA 2KGIA 3L1ZB 2FSAA 1CHCA 2Y43A 1WEPA 4C9ZA
chains in the Genus database with same CATH superfamily
5TDRA 2ECTA 2JUNA 4FO9A 3C5KA 3FANA 3E2DA 3IHPA 4YATA 2KFTA 2ZETC 2E6SA 4QQ4A 2YVRA 2G45A 5LKUA 3N9MA 2RI7A 4FK5A 4AP4A 2LGGA 3V43A 5TRBA 4S3OB 2HYED 2XOYA 2K17A 2KWJA 1FBVA 4O62A 1VD4A 2VPBA 2C2LA 3DQVR 5TBNA 2M1RA 2KYUA 4QF3A 1WIMA 4YADA 4XI1A 1VFYA 2XB1A 1N87A 3H7HA 3ZPV1 3FJUB 3LQIA 1WEVA 1DCQA 2MA5A 5B77A 3N9LA 3LVRE 3U5PA 4BBQA 2ECNA 1WGMA 1LDKC 4FJCA 2UZGA 3PURA 2YURA 3O7AA 2MA6A 2KREA 2VPEA 3RPGB 3EB5A 2CKLB 4AVXA 5LKZA 3QZVA 2VJEA 5FERA 4GB0A 1XWHA 2YW8A 3U5OA 3MDBC 2YREA 2EGMA 2F42A 4FIPA 4AYCB 5H9MA 3I2DA 2MD8C 2C2VS 2M85A 4N3WA 5B78A 3MHHA 2LGLA 2LXHC 5KH9A 2FUUA 2LXPC 1FP0A 4CA1A 2L43A 4I7CA 2CONA 2VJFB 3L1XA 4WZ0A 1G25A 2PUYA 1WEOA 2BAYA 5JG6A 3T7LA 3HCUA 3LVQE 2CSZA 4YABA 2JM3A 4GNEA 5G0FA 3O33A 3O37A 3LQHA 2LGKA 4N4FA 2IQJA 3KV5A 2EA6A 1WEWA 1T1HA 2ECWA 3GL6A 3LQJA 1WFKA 3VK6A 2F6JA 4OGEA 2MIQA 2YUCA 2YU4A 5SVIB 3JUEA 4I7DA 3O34A 2L80A 4V3LC 2CKLA 5LKXA 4CCGX 2QJ0A 4Q6FA 1WE9A 2LRIC 5J3XA 2VPDA 2MNZA 2KR4A 4PTBA 3Q1DA 2JRJA 2KE1A 4NN2A 5D1LB 2KWKA 1WILA 3M63A 1WEEA 4LJNA 2PNXA 2L0BA 4AYCA 4LLBA 2KKYA 4L7XA 5SVYA 4YBMA 1X4UA 3HCTA 5KH7A 4AUQB 2YSMA 5K3QA 1WEUA 1LDJB 2QICA 2G6QA 1WEMA 2VJFA 3FEHA 2VNFA 3C6WA 2KGGA 1X4IA 2QIZA 5H1UA 2ECVA 1F62A 3LJUX 1JM7B 2JMDA 5G04B 4A4CA 1MM3A 5B75A 2XOCA 5LKTA 2F6NA 3KQIA 1WESA 1ZBDB 2VP7A 4UP5A 2ECIA 3DPLR 4YBTA 5TABA 3T9KA 4LKAA 4MVTA 3ASLA 5SVIA 2LV9A 2K4DA 2YYRA 4YAXA 5B76A 1VYXA 2KWNA 5G05B 1Z2QA 2FUIA 4UP0A 2MD7B 5I3LA 5D1MB 3N9QA 5EYAF 2E61A 2IDAA 3GV4A 3O70A 3SHBA 2XOZA 3O36A 2YSJA 4YC9A 1JOCA 3M62A 5D1KB 1MBMA 4TKPB 2E6RA 2HDPA 3LDYA 4X3GA 4ZDTA 2DJAA 2I50A 5C11A 2LDRA 4LK9A 4L58A 5AITA 4YBSA 3T6RA 4OGCA 5TDWA 2DSMA 2K16A 1JM7A 3N9OA 2KWOA 2YHNA 5H1VA 1IYMA 4B7YC 5B79A 4H9DA 3O35A 2KKXA 2EODA 3FAOA 3NG2A 2MNYA 4UI9B 2NAAA 4W4UA 5DKAA 3ZYQA 2OWAA 3PLWA 4O64A 2KIZA 4PPEA 3MHSA 1MM2A 2EGPA 4WA6A 3ZVZB 2XEUA 3ZPVE 3FM8C 2CRWA 2LQ6A 2H0DB 2VJEB 3PHDA 4GNGA 4IC2A 3HCSA 5B8DA 2JMJA 4F52B 4WZ3B 2DX8A 5H1TA 3KNVA 2L75A 3M7KA 3DWDA 4R8PK 4F1PA 3EB6A 4P5OB 2CSVA 2CSYA 3RPGC 2RR4A 2CT2A 5LCWB 4A4BA 4ZQLA 1HYIA 2XP0A 3ZTGA 2ECGA 4I7BA 2LGVA 3U5NA 2ECJA 2VPGA 4A49A 2K1JA 4R2YA 2YHOA 4GNFA 4WZ2A 2CRRA 2FD4A 1K2FA 5AIUA 2EXUA 3SOUA 2M3HA 3SUBA 3SOXA 1U6GB 3LRQA 2M13A 2B0OE 2LN0A 2Y1MA 2L7PA 3L11A 2L5UA 5DINA 3FL2A 2MKEA 2YQLA 3PUQA 3O47A 4A0CD 4QF2A 4Z0OA 2FFWA 4ZUXU 5FEYA 2G43A 2H0DA 5C13A 1E4UA 1RMDA 2MUMA 3HTKC 4LADB 4Z0RA 3M99A 3U5MA 2OXQC 3N9NA 1Z60A 2D8SA 4B86C 3ZVYA 1DVPA 2D8UA 5FB1A 2M6MA 3SOWA 3RTRB 3KDEC 1BORA 2LAUA 3ZNIA 2YQMA 3KV6A 3N9PA 2MT5A 5SVXA 1X4JA 4IC3A 1V87A 4S3OC 1WENA 5KH3A 2KU3A 2Y1NA 1WEQA 4MSXA 2RSDA 1Z6UA 2JMIA 2P57A 2YT5A 4R7EA 4V3KC 1HYJA 4BHWA 2AN6A 5FB0A 4GNDA 2KGIA 3L1ZB 2FSAA 1CHCA 2Y43A 1WEPA 4C9ZA 3DDTA
chains in the Genus database with same CATH topology
5TDRA 2ECTA 4FO9A 3C5KA 3IHPA 4YATA 2KFTA 2ZETC 2E6SA 2G45A 5LKUA 3N9MA 2RI7A 4FK5A 4AP4A 2LGGA 3V43A 5TRBA 4S3OB 2HYED 2K17A 2KWJA 1FBVA 1VD4A 2VPBA 2C2LA 3DQVR 5TBNA 2M1RA 2KYUA 4QF3A 1WIMA 4YADA 4XI1A 1VFYA 2XB1A 1N87A 3ZPV1 3LQIA 1WEVA 2MA5A 5B77A 3N9LA 3U5PA 4BBQA 2ECNA 1WGMA 1LDKC 4FJCA 2UZGA 3PURA 2YURA 3O7AA 2MA6A 2KREA 2VPEA 3RPGB 3EB5A 2CKLB 4AVXA 5LKZA 3QZVA 2VJEA 5FERA 4GB0A 1XWHA 2YW8A 3U5OA 2YREA 2F42A 4FIPA 4AYCB 5H9MA 3I2DA 2MD8C 2C2VS 2M85A 4N3WA 5B78A 3MHHA 2LGLA 2LXHC 5KH9A 2FUUA 2LXPC 1FP0A 4CA1A 2L43A 4I7CA 2VJFB 3L1XA 4WZ0A 1G25A 2PUYA 1WEOA 2BAYA 5JG6A 3T7LA 3HCUA 2CSZA 4YABA 4GNEA 5G0FA 3O33A 3O37A 3LQHA 2LGKA 4N4FA 3KV5A 2EA6A 1WEWA 1T1HA 2ECWA 3GL6A 3LQJA 1WFKA 3VK6A 2F6JA 2MIQA 2YUCA 2YU4A 4I7DA 3O34A 2L80A 4V3LC 2CKLA 5LKXA 4CCGX 2QJ0A 4Q6FA 1WE9A 2LRIC 5J3XA 2VPDA 2MNZA 2KR4A 4PTBA 4NN2A 2JRJA 2KE1A 5D1LB 2KWKA 1WILA 3M63A 1WEEA 4LJNA 2PNXA 2L0BA 4AYCA 4LLBA 4L7XA 4YBMA 1X4UA 3HCTA 5KH7A 4AUQB 2YSMA 1WEUA 1LDJB 2QICA 2G6QA 1WEMA 2VJFA 2VNFA 3C6WA 2KGGA 1X4IA 2QIZA 5H1UA 2ECVA 1F62A 1JM7B 2JMDA 5G04B 4A4CA 1MM3A 5B75A 5LKTA 2F6NA 3KQIA 1WESA 1ZBDB 2VP7A 4UP5A 2ECIA 3DPLR 4YBTA 5TABA 4LKAA 4MVTA 3ASLA 2LV9A 2K4DA 2YYRA 4YAXA 5B76A 1VYXA 2KWNA 5G05B 1Z2QA 2FUIA 4UP0A 2MD7B 5I3LA 5D1MB 3N9QA 5EYAF 2IDAA 3GV4A 3O70A 3SHBA 3O36A 2YSJA 4YC9A 1JOCA 3M62A 5D1KB 4TKPB 2E6RA 2HDPA 4X3GA 4ZDTA 2I50A 5C11A 2LDRA 4LK9A 4L58A 5AITA 4YBSA 3T6RA 5TDWA 2K16A 1JM7A 3N9OA 2KWOA 2YHNA 5H1VA 1IYMA 4B7YC 5B79A 3O35A 2EODA 3NG2A 2MNYA 4UI9B 2NAAA 4W4UA 5DKAA 3ZYQA 4O64A 2KIZA 4PPEA 3MHSA 1MM2A 4WA6A 2EGPA 3ZVZB 2XEUA 3ZPVE 2LQ6A 2H0DB 2VJEB 3PHDA 4GNGA 4IC2A 3HCSA 5B8DA 2JMJA 4F52B 4WZ3B 2DX8A 5H1TA 3KNVA 2L75A 4R8PK 3EB6A 4P5OB 2CSYA 3RPGC 5LCWB 2CT2A 4A4BA 4ZQLA 1HYIA 3ZTGA 2ECGA 4I7BA 2LGVA 3U5NA 2ECJA 2VPGA 4A49A 2K1JA 4R2YA 2YHOA 4GNFA 4WZ2A 1K2FA 5AIUA 3SOUA 2M3HA 3SOXA 1U6GB 3LRQA 2LN0A 2Y1MA 3L11A 2L5UA 5DINA 3FL2A 2YQLA 3PUQA 4A0CD 4QF2A 4ZUXU 5FEYA 2G43A 2H0DA 5C13A 1E4UA 1RMDA 2MUMA 3HTKC 4LADB 3U5MA 3M99A 2OXQC 3N9NA 1Z60A 2D8SA 4B86C 3ZVYA 1DVPA 5FB1A 2M6MA 3SOWA 3RTRB 1BORA 3ZNIA 2YQMA 3KV6A 3N9PA 2MT5A 1X4JA 4IC3A 1V87A 4S3OC 1WENA 5KH3A 2KU3A 2Y1NA 1WEQA 4MSXA 2RSDA 1Z6UA 2JMIA 2YT5A 4R7EA 4V3KC 1HYJA 4BHWA 2AN6A 5FB0A 4GNDA 2KGIA 3L1ZB 2FSAA 1CHCA 2Y43A 1WEPA 4C9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDR A;  2ECT A;  4FO9 A;  3C5K A;  3IHP A;  4YAT A;  2KFT A;  2ZET C;  2E6S A;  2G45 A;  5LKU A;  3N9M A;  2RI7 A;  4FK5 A;  4AP4 A;  2LGG A;  3V43 A;  5TRB A;  4S3O B;  2HYE D;  2K17 A;  2KWJ A;  1FBV A;  1VD4 A;  2VPB A;  2C2L A;  3DQV R;  5TBN A;  2M1R A;  2KYU A;  4QF3 A;  1WIM A;  4YAD A;  4XI1 A;  1VFY A;  2XB1 A;  1N87 A;  3ZPV 1;  3LQI A;  1WEV A;  2MA5 A;  5B77 A;  3N9L A;  3U5P A;  4BBQ A;  2ECN A;  1WGM A;  1LDK C;  4FJC A;  2UZG A;  3PUR A;  2YUR A;  3O7A A;  2MA6 A;  2KRE A;  2VPE A;  3RPG B;  3EB5 A;  2CKL B;  4AVX A;  5LKZ A;  3QZV A;  2VJE A;  5FER A;  4GB0 A;  1XWH A;  2YW8 A;  3U5O A;  2YRE A;  2F42 A;  4FIP A;  4AYC B;  5H9M A;  3I2D A;  2MD8 C;  2C2V S;  2M85 A;  4N3W A;  5B78 A;  3MHH A;  2LGL A;  2LXH C;  5KH9 A;  2FUU A;  2LXP C;  1FP0 A;  4CA1 A;  2L43 A;  4I7C A;  2VJF B;  3L1X A;  4WZ0 A;  1G25 A;  2PUY A;  1WEO A;  2BAY A;  5JG6 A;  3T7L A;  3HCU A;  2CSZ A;  4YAB A;  4GNE A;  5G0F A;  3O33 A;  3O37 A;  3LQH A;  2LGK A;  4N4F A;  3KV5 A;  2EA6 A;  1WEW A;  1T1H A;  2ECW A;  3GL6 A;  3LQJ A;  1WFK A;  3VK6 A;  2F6J A;  2MIQ A;  2YUC A;  2YU4 A;  4I7D A;  3O34 A;  2L80 A;  4V3L C;  2CKL A;  5LKX A;  4CCG X;  2QJ0 A;  4Q6F A;  1WE9 A;  2LRI C;  5J3X A;  2VPD A;  2MNZ A;  2KR4 A;  4PTB A;  4NN2 A;  2JRJ A;  2KE1 A;  5D1L B;  2KWK A;  1WIL A;  3M63 A;  1WEE A;  4LJN A;  2PNX A;  2L0B A;  4AYC A;  4LLB A;  4L7X A;  4YBM A;  1X4U A;  3HCT A;  5KH7 A;  4AUQ B;  2YSM A;  1WEU A;  1LDJ B;  2QIC A;  2G6Q A;  1WEM A;  2VJF A;  2VNF A;  3C6W A;  2KGG A;  1X4I A;  2QIZ A;  5H1U A;  2ECV A;  1F62 A;  1JM7 B;  2JMD A;  5G04 B;  4A4C A;  1MM3 A;  5B75 A;  5LKT A;  2F6N A;  3KQI A;  1WES A;  1ZBD B;  2VP7 A;  4UP5 A;  2ECI A;  3DPL R;  4YBT A;  5TAB A;  4LKA A;  4MVT A;  3ASL A;  2LV9 A;  2K4D A;  2YYR A;  4YAX A;  5B76 A;  1VYX A;  2KWN A;  5G05 B;  1Z2Q A;  2FUI A;  4UP0 A;  2MD7 B;  5I3L A;  5D1M B;  3N9Q A;  5EYA F;  2IDA A;  3GV4 A;  3O70 A;  3SHB A;  3O36 A;  2YSJ A;  4YC9 A;  1JOC A;  3M62 A;  5D1K B;  4TKP B;  2E6R A;  2HDP A;  4X3G A;  4ZDT A;  2I50 A;  5C11 A;  2LDR A;  4LK9 A;  4L58 A;  5AIT A;  4YBS A;  3T6R A;  5TDW A;  2K16 A;  1JM7 A;  3N9O A;  2KWO A;  2YHN A;  5H1V A;  1IYM A;  4B7Y C;  5B79 A;  3O35 A;  2EOD A;  3NG2 A;  2MNY A;  4UI9 B;  2NAA A;  4W4U A;  5DKA A;  3ZYQ A;  4O64 A;  2KIZ A;  4PPE A;  3MHS A;  1MM2 A;  4WA6 A;  2EGP A;  3ZVZ B;  2XEU A;  3ZPV E;  2LQ6 A;  2H0D B;  2VJE B;  3PHD A;  4GNG A;  4IC2 A;  3HCS A;  5B8D A;  2JMJ A;  4F52 B;  4WZ3 B;  2DX8 A;  5H1T A;  3KNV A;  2L75 A;  4R8P K;  3EB6 A;  4P5O B;  2CSY A;  3RPG C;  5LCW B;  2CT2 A;  4A4B A;  4ZQL A;  1HYI A;  3ZTG A;  2ECG A;  4I7B A;  2LGV A;  3U5N A;  2ECJ A;  2VPG A;  4A49 A;  2K1J A;  4R2Y A;  2YHO A;  4GNF A;  4WZ2 A;  1K2F A;  5AIU A;  3SOU A;  2M3H A;  3SOX A;  1U6G B;  3LRQ A;  2LN0 A;  2Y1M A;  3L11 A;  2L5U A;  5DIN A;  3FL2 A;  2YQL A;  3PUQ A;  4A0C D;  4QF2 A;  4ZUX U;  5FEY A;  2G43 A;  2H0D A;  5C13 A;  1E4U A;  1RMD A;  2MUM A;  3HTK C;  4LAD B;  3U5M A;  3M99 A;  2OXQ C;  3N9N A;  1Z60 A;  2D8S A;  4B86 C;  3ZVY A;  1DVP A;  5FB1 A;  2M6M A;  3SOW A;  3RTR B;  1BOR A;  3ZNI A;  2YQM A;  3KV6 A;  3N9P A;  2MT5 A;  1X4J A;  4IC3 A;  1V87 A;  4S3O C;  1WEN A;  5KH3 A;  2KU3 A;  2Y1N A;  1WEQ A;  4MSX A;  2RSD A;  1Z6U A;  2JMI A;  2YT5 A;  4R7E A;  4V3K C;  1HYJ A;  4BHW A;  2AN6 A;  5FB0 A;  4GND A;  2KGI A;  3L1Z B;  2FSA A;  1CHC A;  2Y43 A;  1WEP A;  4C9Z A; 
#chains in the Genus database with same CATH topology
 5TDR A;  2ECT A;  2JUN A;  4FO9 A;  3C5K A;  3FAN A;  3E2D A;  3IHP A;  4YAT A;  2KFT A;  2ZET C;  2E6S A;  4QQ4 A;  2YVR A;  2G45 A;  5LKU A;  3N9M A;  2RI7 A;  4FK5 A;  4AP4 A;  2LGG A;  3V43 A;  5TRB A;  4S3O B;  2HYE D;  2XOY A;  2K17 A;  2KWJ A;  1FBV A;  4O62 A;  1VD4 A;  2VPB A;  2C2L A;  3DQV R;  5TBN A;  2M1R A;  2KYU A;  4QF3 A;  1WIM A;  4YAD A;  4XI1 A;  1VFY A;  2XB1 A;  1N87 A;  3H7H A;  3ZPV 1;  3FJU B;  3LQI A;  1WEV A;  1DCQ A;  2MA5 A;  5B77 A;  3N9L A;  3LVR E;  3U5P A;  4BBQ A;  2ECN A;  1WGM A;  1LDK C;  4FJC A;  2UZG A;  3PUR A;  2YUR A;  3O7A A;  2MA6 A;  2KRE A;  2VPE A;  3RPG B;  3EB5 A;  2CKL B;  4AVX A;  5LKZ A;  3QZV A;  2VJE A;  5FER A;  4GB0 A;  1XWH A;  2YW8 A;  3U5O A;  3MDB C;  2YRE A;  2EGM A;  2F42 A;  4FIP A;  4AYC B;  5H9M A;  3I2D A;  2MD8 C;  2C2V S;  2M85 A;  4N3W A;  5B78 A;  3MHH A;  2LGL A;  2LXH C;  5KH9 A;  2FUU A;  2LXP C;  1FP0 A;  4CA1 A;  2L43 A;  4I7C A;  2CON A;  2VJF B;  3L1X A;  4WZ0 A;  1G25 A;  2PUY A;  1WEO A;  2BAY A;  5JG6 A;  3T7L A;  3HCU A;  3LVQ E;  2CSZ A;  4YAB A;  2JM3 A;  4GNE A;  5G0F A;  3O33 A;  3O37 A;  3LQH A;  2LGK A;  4N4F A;  2IQJ A;  3KV5 A;  2EA6 A;  1WEW A;  1T1H A;  2ECW A;  3GL6 A;  3LQJ A;  1WFK A;  3VK6 A;  2F6J A;  4OGE A;  2MIQ A;  2YUC A;  2YU4 A;  5SVI B;  3JUE A;  4I7D A;  3O34 A;  2L80 A;  4V3L C;  2CKL A;  5LKX A;  4CCG X;  2QJ0 A;  4Q6F A;  1WE9 A;  2LRI C;  5J3X A;  2VPD A;  2MNZ A;  2KR4 A;  4PTB A;  3Q1D A;  2JRJ A;  2KE1 A;  4NN2 A;  5D1L B;  2KWK A;  1WIL A;  3M63 A;  1WEE A;  4LJN A;  2PNX A;  2L0B A;  4AYC A;  4LLB A;  2KKY A;  4L7X A;  5SVY A;  4YBM A;  1X4U A;  3HCT A;  5KH7 A;  4AUQ B;  2YSM A;  5K3Q A;  1WEU A;  1LDJ B;  2QIC A;  2G6Q A;  1WEM A;  2VJF A;  3FEH A;  2VNF A;  3C6W A;  2KGG A;  1X4I A;  2QIZ A;  5H1U A;  2ECV A;  1F62 A;  3LJU X;  1JM7 B;  2JMD A;  5G04 B;  4A4C A;  1MM3 A;  5B75 A;  2XOC A;  5LKT A;  2F6N A;  3KQI A;  1WES A;  1ZBD B;  2VP7 A;  4UP5 A;  2ECI A;  3DPL R;  4YBT A;  5TAB A;  3T9K A;  4LKA A;  4MVT A;  3ASL A;  5SVI A;  2LV9 A;  2K4D A;  2YYR A;  4YAX A;  5B76 A;  1VYX A;  2KWN A;  5G05 B;  1Z2Q A;  2FUI A;  4UP0 A;  2MD7 B;  5I3L A;  5D1M B;  3N9Q A;  5EYA F;  2E61 A;  2IDA A;  3GV4 A;  3O70 A;  3SHB A;  2XOZ A;  3O36 A;  2YSJ A;  4YC9 A;  1JOC A;  3M62 A;  5D1K B;  1MBM A;  4TKP B;  2E6R A;  2HDP A;  3LDY A;  4X3G A;  4ZDT A;  2DJA A;  2I50 A;  5C11 A;  2LDR A;  4LK9 A;  4L58 A;  5AIT A;  4YBS A;  3T6R A;  4OGC A;  5TDW A;  2DSM A;  2K16 A;  1JM7 A;  3N9O A;  2KWO A;  2YHN A;  5H1V A;  1IYM A;  4B7Y C;  5B79 A;  4H9D A;  3O35 A;  2KKX A;  2EOD A;  3FAO A;  3NG2 A;  2MNY A;  4UI9 B;  2NAA A;  4W4U A;  5DKA A;  3ZYQ A;  2OWA A;  3PLW A;  4O64 A;  2KIZ A;  4PPE A;  3MHS A;  1MM2 A;  2EGP A;  4WA6 A;  3ZVZ B;  2XEU A;  3ZPV E;  3FM8 C;  2CRW A;  2LQ6 A;  2H0D B;  2VJE B;  3PHD A;  4GNG A;  4IC2 A;  3HCS A;  5B8D A;  2JMJ A;  4F52 B;  4WZ3 B;  2DX8 A;  5H1T A;  3KNV A;  2L75 A;  3M7K A;  3DWD A;  4R8P K;  4F1P A;  3EB6 A;  4P5O B;  2CSV A;  2CSY A;  3RPG C;  2RR4 A;  2CT2 A;  5LCW B;  4A4B A;  4ZQL A;  1HYI A;  2XP0 A;  3ZTG A;  2ECG A;  4I7B A;  2LGV A;  3U5N A;  2ECJ A;  2VPG A;  4A49 A;  2K1J A;  4R2Y A;  2YHO A;  4GNF A;  4WZ2 A;  2CRR A;  2FD4 A;  1K2F A;  5AIU A;  2EXU A;  3SOU A;  2M3H A;  3SUB A;  3SOX A;  1U6G B;  3LRQ A;  2M13 A;  2B0O E;  2LN0 A;  2Y1M A;  2L7P A;  3L11 A;  2L5U A;  5DIN A;  3FL2 A;  2MKE A;  2YQL A;  3PUQ A;  3O47 A;  4A0C D;  4QF2 A;  4Z0O A;  2FFW A;  4ZUX U;  5FEY A;  2G43 A;  2H0D A;  5C13 A;  1E4U A;  1RMD A;  2MUM A;  3HTK C;  4LAD B;  4Z0R A;  3M99 A;  3U5M A;  2OXQ C;  3N9N A;  1Z60 A;  2D8S A;  4B86 C;  3ZVY A;  1DVP A;  2D8U A;  5FB1 A;  2M6M A;  3SOW A;  3RTR B;  3KDE C;  1BOR A;  2LAU A;  3ZNI A;  2YQM A;  3KV6 A;  3N9P A;  2MT5 A;  5SVX A;  1X4J A;  4IC3 A;  1V87 A;  4S3O C;  1WEN A;  5KH3 A;  2KU3 A;  2Y1N A;  1WEQ A;  4MSX A;  2RSD A;  1Z6U A;  2JMI A;  2P57 A;  2YT5 A;  4R7E A;  4V3K C;  1HYJ A;  4BHW A;  2AN6 A;  5FB0 A;  4GND A;  2KGI A;  3L1Z B;  2FSA A;  1CHC A;  2Y43 A;  1WEP A;  4C9Z A;  3DDT A; 
#chains in the Genus database with same CATH homology
 5TDR A;  2ECT A;  4FO9 A;  3C5K A;  3IHP A;  4YAT A;  2KFT A;  2ZET C;  2E6S A;  2G45 A;  5LKU A;  3N9M A;  2RI7 A;  4FK5 A;  4AP4 A;  2LGG A;  3V43 A;  5TRB A;  4S3O B;  2HYE D;  2K17 A;  2KWJ A;  1FBV A;  1VD4 A;  2VPB A;  2C2L A;  3DQV R;  5TBN A;  2M1R A;  2KYU A;  4QF3 A;  1WIM A;  4YAD A;  4XI1 A;  1VFY A;  2XB1 A;  1N87 A;  3ZPV 1;  3LQI A;  1WEV A;  2MA5 A;  5B77 A;  3N9L A;  3U5P A;  4BBQ A;  2ECN A;  1WGM A;  1LDK C;  4FJC A;  2UZG A;  3PUR A;  2YUR A;  3O7A A;  2MA6 A;  2KRE A;  2VPE A;  3RPG B;  3EB5 A;  2CKL B;  4AVX A;  5LKZ A;  3QZV A;  2VJE A;  5FER A;  4GB0 A;  1XWH A;  2YW8 A;  3U5O A;  2YRE A;  2F42 A;  4FIP A;  4AYC B;  5H9M A;  3I2D A;  2MD8 C;  2C2V S;  2M85 A;  4N3W A;  5B78 A;  3MHH A;  2LGL A;  2LXH C;  5KH9 A;  2FUU A;  2LXP C;  1FP0 A;  4CA1 A;  2L43 A;  4I7C A;  2VJF B;  3L1X A;  4WZ0 A;  1G25 A;  2PUY A;  1WEO A;  2BAY A;  5JG6 A;  3T7L A;  3HCU A;  2CSZ A;  4YAB A;  4GNE A;  5G0F A;  3O33 A;  3O37 A;  3LQH A;  2LGK A;  4N4F A;  3KV5 A;  2EA6 A;  1WEW A;  1T1H A;  2ECW A;  3GL6 A;  3LQJ A;  1WFK A;  3VK6 A;  2F6J A;  2MIQ A;  2YUC A;  2YU4 A;  4I7D A;  3O34 A;  2L80 A;  4V3L C;  2CKL A;  5LKX A;  4CCG X;  2QJ0 A;  4Q6F A;  1WE9 A;  2LRI C;  5J3X A;  2VPD A;  2MNZ A;  2KR4 A;  4PTB A;  4NN2 A;  2JRJ A;  2KE1 A;  5D1L B;  2KWK A;  1WIL A;  3M63 A;  1WEE A;  4LJN A;  2PNX A;  2L0B A;  4AYC A;  4LLB A;  4L7X A;  4YBM A;  1X4U A;  3HCT A;  5KH7 A;  4AUQ B;  2YSM A;  1WEU A;  1LDJ B;  2QIC A;  2G6Q A;  1WEM A;  2VJF A;  2VNF A;  3C6W A;  2KGG A;  1X4I A;  2QIZ A;  5H1U A;  2ECV A;  1F62 A;  1JM7 B;  2JMD A;  5G04 B;  4A4C A;  1MM3 A;  5B75 A;  5LKT A;  2F6N A;  3KQI A;  1WES A;  1ZBD B;  2VP7 A;  4UP5 A;  2ECI A;  3DPL R;  4YBT A;  5TAB A;  4LKA A;  4MVT A;  3ASL A;  2LV9 A;  2K4D A;  2YYR A;  4YAX A;  5B76 A;  1VYX A;  2KWN A;  5G05 B;  1Z2Q A;  2FUI A;  4UP0 A;  2MD7 B;  5I3L A;  5D1M B;  3N9Q A;  5EYA F;  2IDA A;  3GV4 A;  3O70 A;  3SHB A;  3O36 A;  2YSJ A;  4YC9 A;  1JOC A;  3M62 A;  5D1K B;  4TKP B;  2E6R A;  2HDP A;  4X3G A;  4ZDT A;  2I50 A;  5C11 A;  2LDR A;  4LK9 A;  4L58 A;  5AIT A;  4YBS A;  3T6R A;  5TDW A;  2K16 A;  1JM7 A;  3N9O A;  2KWO A;  2YHN A;  5H1V A;  1IYM A;  4B7Y C;  5B79 A;  3O35 A;  2EOD A;  3NG2 A;  2MNY A;  4UI9 B;  2NAA A;  4W4U A;  5DKA A;  3ZYQ A;  4O64 A;  2KIZ A;  4PPE A;  3MHS A;  1MM2 A;  4WA6 A;  2EGP A;  3ZVZ B;  2XEU A;  3ZPV E;  2LQ6 A;  2H0D B;  2VJE B;  3PHD A;  4GNG A;  4IC2 A;  3HCS A;  5B8D A;  2JMJ A;  4F52 B;  4WZ3 B;  2DX8 A;  5H1T A;  3KNV A;  2L75 A;  4R8P K;  3EB6 A;  4P5O B;  2CSY A;  3RPG C;  5LCW B;  2CT2 A;  4A4B A;  4ZQL A;  1HYI A;  3ZTG A;  2ECG A;  4I7B A;  2LGV A;  3U5N A;  2ECJ A;  2VPG A;  4A49 A;  2K1J A;  4R2Y A;  2YHO A;  4GNF A;  4WZ2 A;  1K2F A;  5AIU A;  3SOU A;  2M3H A;  3SOX A;  1U6G B;  3LRQ A;  2LN0 A;  2Y1M A;  3L11 A;  2L5U A;  5DIN A;  3FL2 A;  2YQL A;  3PUQ A;  4A0C D;  4QF2 A;  4ZUX U;  5FEY A;  2G43 A;  2H0D A;  5C13 A;  1E4U A;  1RMD A;  2MUM A;  3HTK C;  4LAD B;  3U5M A;  3M99 A;  2OXQ C;  3N9N A;  1Z60 A;  2D8S A;  4B86 C;  3ZVY A;  1DVP A;  5FB1 A;  2M6M A;  3SOW A;  3RTR B;  1BOR A;  3ZNI A;  2YQM A;  3KV6 A;  3N9P A;  2MT5 A;  1X4J A;  4IC3 A;  1V87 A;  4S3O C;  1WEN A;  5KH3 A;  2KU3 A;  2Y1N A;  1WEQ A;  4MSX A;  2RSD A;  1Z6U A;  2JMI A;  2YT5 A;  4R7E A;  4V3K C;  1HYJ A;  4BHW A;  2AN6 A;  5FB0 A;  4GND A;  2KGI A;  3L1Z B;  2FSA A;  1CHC A;  2Y43 A;  1WEP A;  4C9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...