2EA6A

Solution structure of the ring domain of the human ring finger protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
b'GSSGSSGTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein 4
molecule tags Transcription
source organism Homo sapiens
publication title Solution Structure of the RING domain of the human ring finger protein 4
rcsb
total genus 6
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ea6A01
3U5OA 4CA1A 2LGKA 2ECIA 2YQMA 5C11A 4IC2A 4WZ0A 4C9ZA 3MHHA 2KGIA 2LQ6A 2ZETC 4V3KC 4FJCA 1Z60A 3DPLR 1CHCA 1LDKC 1X4IA 3MHSA 2LXHC 4XI1A 2MD8C 1WEWA 2KGGA 5H9MA 2MA5A 4N4FA 5B75A 2K17A 2KU3A 1WESA 1FBVA 1XWHA 5TDRA 2KR4A 2MNYA 2KWNA 5LKUA 1N87A 1K2FA 3FL2A 4NN2A 3O34A 1X4JA 2K1JA 2XEUA 3LRQA 4YAXA 3V43A 4MSXA 3HCTA 3T7LA 4F52B 2M6MA 2H0DA 5G0FA 2LXPC 3I2DA 5FERA 2Y43A 4S3OB 1RMDA 5D1MB 2K16A 4Q6FA 2MD7B 5AITA 3GV4A 4R8PK 1WEQA 4A4BA 5B8DA 5J3XA 1VFYA 2BAYA 2VP7A 2G43A 2YU4A 4YBMA 3RPGC 4AYCA 5LKZA 5D1LB 1WIMA 2CSYA 4AYCB 3IHPA 3N9NA 3O33A 2M3HA 4IC3A 2M1RA 2MNZA 1WEPA 4CCGX 3QZVA 2KREA 3EB5A 1WILA 4A49A 5TDWA 5JG6A 3LQIA 3N9QA 2F6NA 1WENA 2LGLA 2LN0A 3KQIA 2KWOA 1LDJB 5H1UA 3U5NA 2VPBA 3ZYQA 1F62A 4S3OC 4WZ2A 2LGVA 2VPGA 3PHDA 2DX8A 2OXQC 4GB0A 1FP0A 5B79A 3U5MA 5DINA 4L7XA 3HCUA 3NG2A 4I7DA 3L11A 3M99A 2F6JA 1WEMA 3C5KA 4WZ3B 2YSMA 2VJEA 2D8SA 3HCSA 5B77A 3RPGB 3U5PA 2E6SA 4B7YC 4V3LC 2ECJA 3LQJA 5TABA 2PUYA 2QIZA 2HYED 2CKLB 3ZVZB 4ZQLA 2UZGA 1T1HA 4FK5A 3M63A 5KH9A 4YC9A 3ZNIA 2C2LA 3ZPVE 1G25A 3N9LA 5EYAF 3KV6A 3PUQA 4LADB 2KWJA 3SHBA 4AVXA 5H1TA 5FB1A 2L80A 2C2VS 4GNFA 5LKXA 2M85A 2ECTA 5H1VA 2KE1A 1ZBDB 4AP4A 2AN6A 2ECWA 4X3GA 2KWKA 4TKPB 4LKAA 5KH3A 4R2YA 4MVTA 4YATA 4BBQA 2LV9A 3RTRB 3ZTGA 5TBNA 2RSDA 3SOUA 2QICA 3N9MA 2YSJA 2H0DB 4ZDTA 4QF3A 3GL6A 3DQVR 2ECVA 4UP0A 1Z6UA 2CT2A 5D1KB 2FUUA 3EB6A 2ECGA 5FB0A 1WFKA 2RI7A 4WA6A 2ECNA 3N9OA 2MA6A 1HYIA 2MUMA 4N3WA 2YHNA 3ASLA 4I7BA 3ZVYA 2YUCA 4PPEA 1WE9A 4P5OB 1X4UA 2YURA 1Z2QA 2Y1NA 1DVPA 5LCWB 2VJFB 1WEEA 3SOXA 4YABA 2YHOA 4ZUXU 1WEVA 5LKTA 3L1ZB 5FEYA 1VYXA 2L43A 2MIQA 2LGGA 4I7CA 5I3LA 2YYRA 2Y1MA 4QF2A 4PTBA 3O37A 4UP5A 4FIPA 4YADA 4BHWA 1JM7A 3N9PA 4YBTA 3O70A 2PNXA 3LQHA 3C6WA 3ZPV1 1U6GB 4LK9A 5KH7A 2VJEB 5AIUA 5B78A 2L0BA 2EGPA 2L75A 4L58A 3KV5A 3KNVA 2G45A 2XB1A 2YT5A 1HYJA 2HDPA 2VPEA 3PURA 1BORA 1WEUA 4GNGA 2VNFA 3O36A 1MM3A 1JOCA 4W4UA 2CSZA 2I50A 1MM2A 2K4DA 2FSAA 2JMIA 5TRBA 2YQLA 5B76A 2VPDA 4A4CA 5C13A 1IYMA 2JMDA 2EODA 3HTKC 1VD4A 2EA6A 3L1XA 4AUQB 2KYUA 2KFTA 2LDRA 5G05B 4R7EA 2LRIC 2G6QA 3O35A 1WGMA 4GNEA 2NAAA 2E6RA 4O64A 3VK6A 2IDAA 4A0CD 1JM7B 4UI9B 1E4UA 2F42A 2KIZA 4YBSA 2CKLA 2JMJA 4LJNA 1V87A 3O7AA 3SOWA 2VJFA 3T6RA 3M62A 4B86C 2YREA 2QJ0A 2JRJA 2MT5A 4FO9A 1WEOA 4GNDA 2YW8A 5DKAA 2FUIA 5G04B 4LLBA 2L5UA
chains in the Genus database with same CATH superfamily
3U5OA 4CA1A 2LGKA 2ECIA 2YQMA 5C11A 3T9KA 4IC2A 4WZ0A 1DCQA 4C9ZA 3MHHA 2KGIA 2XOCA 2LQ6A 2ZETC 2XOZA 4V3KC 4FJCA 1Z60A 3DPLR 1CHCA 1LDKC 1X4IA 3MDBC 3MHSA 2LXHC 4XI1A 2MD8C 1WEWA 2KGGA 5H9MA 2FFWA 2MA5A 1MBMA 4N4FA 5B75A 2K17A 2KU3A 2CRWA 1WESA 1FBVA 2DJAA 1XWHA 5TDRA 2KR4A 2L7PA 2MNYA 2KWNA 5LKUA 1N87A 1K2FA 3FL2A 4NN2A 3O34A 1X4JA 3SUBA 2K1JA 2XEUA 3LRQA 4YAXA 2E61A 2RR4A 3V43A 4MSXA 3HCTA 3T7LA 4F52B 2M6MA 2H0DA 5G0FA 2LXPC 5SVYA 3I2DA 5FERA 2Y43A 4S3OB 1RMDA 2KKYA 5D1MB 2K16A 4Q6FA 2MD7B 5AITA 3GV4A 4R8PK 1WEQA 4A4BA 5B8DA 5J3XA 3M7KA 1VFYA 2BAYA 2VP7A 2G43A 2YU4A 4YBMA 3RPGC 4AYCA 4O62A 5LKZA 5D1LB 3DWDA 1WIMA 2CSYA 4AYCB 5SVXA 3IHPA 3N9NA 3O33A 2M3HA 4IC3A 2M1RA 2MNZA 3H7HA 1WEPA 4CCGX 3QZVA 2KREA 3EB5A 2B0OE 1WILA 4A49A 2CONA 5TDWA 5JG6A 3LDYA 3LQIA 3N9QA 2F6NA 1WENA 4F1PA 2LGLA 2D8UA 2LN0A 3KQIA 2KWOA 1LDJB 5H1UA 3U5NA 2VPBA 5K3QA 3ZYQA 1F62A 4S3OC 4WZ2A 2LGVA 2VPGA 3PHDA 2DX8A 2OXQC 4GB0A 2CRRA 1FP0A 5B79A 3U5MA 4Z0OA 5DINA 4L7XA 3HCUA 3NG2A 4I7DA 3L11A 3M99A 2F6JA 2LAUA 1WEMA 3C5KA 3KDEC 4WZ3B 2YSMA 2VJEA 2D8SA 2JM3A 3HCSA 5B77A 3RPGB 3U5PA 2E6SA 4B7YC 4V3LC 2ECJA 3LQJA 5TABA 4OGEA 2PUYA 2QIZA 2CKLB 2HYED 3ZVZB 4ZQLA 2CSVA 2UZGA 1T1HA 2EXUA 4FK5A 3M63A 5KH9A 2XP0A 4YC9A 3ZNIA 2C2LA 3ZPVE 1G25A 3N9LA 5EYAF 3KV6A 3PUQA 4LADB 2KWJA 3SHBA 4AVXA 5H1TA 5FB1A 2L80A 2C2VS 4GNFA 5LKXA 2M85A 2ECTA 5H1VA 2KE1A 3DDTA 3LJUX 1ZBDB 4AP4A 2AN6A 2ECWA 4X3GA 2KWKA 4TKPB 2FD4A 4LKAA 5KH3A 4R2YA 3FAOA 4MVTA 4YATA 4BBQA 2EGMA 2LV9A 3RTRB 3ZTGA 5TBNA 2RSDA 3SOUA 2QICA 2P57A 3N9MA 2YSJA 2H0DB 4ZDTA 4QF3A 3GL6A 3DQVR 2ECVA 4UP0A 1Z6UA 2CT2A 5D1KB 2FUUA 3EB6A 2ECGA 5FB0A 5SVIB 1WFKA 2RI7A 4WA6A 2ECNA 3N9OA 2MA6A 2XOYA 1HYIA 2MUMA 4N3WA 2YHNA 3ASLA 4I7BA 3ZVYA 2YUCA 4PPEA 3FANA 1WE9A 4P5OB 1X4UA 2YURA 1Z2QA 2Y1NA 1DVPA 5LCWB 2VJFB 1WEEA 2OWAA 3FM8C 3SOXA 4YABA 3FJUB 4QQ4A 2YHOA 4ZUXU 1WEVA 5LKTA 3L1ZB 5FEYA 1VYXA 2JUNA 2L43A 2MIQA 2LGGA 4I7CA 5I3LA 2YYRA 2Y1MA 3JUEA 4QF2A 3Q1DA 3O47A 4PTBA 3O37A 2YVRA 4UP5A 4FIPA 2MKEA 4YADA 4BHWA 1JM7A 3N9PA 4H9DA 4OGCA 3O70A 4YBTA 3LVQE 2IQJA 2PNXA 3LQHA 3C6WA 3ZPV1 1U6GB 4LK9A 5KH7A 2M13A 5SVIA 2VJEB 5AIUA 5B78A 2L0BA 2EGPA 2L75A 4L58A 3KV5A 3KNVA 2G45A 2XB1A 2YT5A 1HYJA 2HDPA 2VPEA 3PURA 1BORA 1WEUA 4GNGA 2VNFA 3O36A 1MM3A 1JOCA 4W4UA 2CSZA 2I50A 3FEHA 1MM2A 2K4DA 2FSAA 3E2DA 2JMIA 5TRBA 2YQLA 5B76A 2VPDA 4A4CA 5C13A 1IYMA 2JMDA 2EODA 2KKXA 3HTKC 3PLWA 1VD4A 2EA6A 3L1XA 4AUQB 2KYUA 2KFTA 2LDRA 5G05B 4R7EA 2LRIC 3LVRE 2G6QA 3O35A 1WGMA 4GNEA 2NAAA 2E6RA 4O64A 3VK6A 2IDAA 4A0CD 1JM7B 4UI9B 1E4UA 2F42A 2KIZA 4YBSA 2CKLA 2JMJA 4Z0RA 4LJNA 1V87A 3O7AA 3SOWA 2VJFA 3T6RA 3M62A 4B86C 2DSMA 2YREA 2QJ0A 2JRJA 2MT5A 4FO9A 1WEOA 4GNDA 2YW8A 5DKAA 2FUIA 5G04B 4LLBA 2L5UA
chains in the Genus database with same CATH topology
3U5OA 4CA1A 2LGKA 2ECIA 2YQMA 5C11A 4IC2A 4WZ0A 4C9ZA 3MHHA 2KGIA 2LQ6A 2ZETC 4V3KC 4FJCA 1Z60A 3DPLR 1CHCA 1LDKC 1X4IA 3MHSA 2LXHC 4XI1A 2MD8C 1WEWA 2KGGA 5H9MA 2MA5A 4N4FA 5B75A 2K17A 2KU3A 1WESA 1FBVA 1XWHA 5TDRA 2KR4A 2MNYA 2KWNA 5LKUA 1N87A 1K2FA 3FL2A 4NN2A 3O34A 1X4JA 2K1JA 2XEUA 3LRQA 4YAXA 3V43A 4MSXA 3HCTA 3T7LA 4F52B 2M6MA 2H0DA 5G0FA 2LXPC 3I2DA 5FERA 2Y43A 4S3OB 1RMDA 5D1MB 2K16A 4Q6FA 2MD7B 5AITA 3GV4A 4R8PK 1WEQA 4A4BA 5B8DA 5J3XA 1VFYA 2BAYA 2VP7A 2G43A 2YU4A 4YBMA 3RPGC 4AYCA 5LKZA 5D1LB 1WIMA 2CSYA 4AYCB 3IHPA 3N9NA 3O33A 2M3HA 4IC3A 2M1RA 2MNZA 1WEPA 4CCGX 3QZVA 2KREA 3EB5A 1WILA 4A49A 5TDWA 5JG6A 3LQIA 3N9QA 2F6NA 1WENA 2LGLA 2LN0A 3KQIA 2KWOA 1LDJB 5H1UA 3U5NA 2VPBA 3ZYQA 1F62A 4S3OC 4WZ2A 2LGVA 2VPGA 3PHDA 2DX8A 2OXQC 4GB0A 1FP0A 5B79A 3U5MA 5DINA 4L7XA 3HCUA 3NG2A 4I7DA 3L11A 3M99A 2F6JA 1WEMA 3C5KA 4WZ3B 2YSMA 2VJEA 2D8SA 3HCSA 5B77A 3RPGB 3U5PA 2E6SA 4B7YC 4V3LC 2ECJA 3LQJA 5TABA 2PUYA 2QIZA 2HYED 2CKLB 3ZVZB 4ZQLA 2UZGA 1T1HA 4FK5A 3M63A 5KH9A 4YC9A 3ZNIA 2C2LA 3ZPVE 1G25A 3N9LA 5EYAF 3KV6A 3PUQA 4LADB 2KWJA 3SHBA 4AVXA 5H1TA 5FB1A 2L80A 2C2VS 4GNFA 5LKXA 2M85A 2ECTA 5H1VA 2KE1A 1ZBDB 4AP4A 2AN6A 2ECWA 4X3GA 2KWKA 4TKPB 4LKAA 5KH3A 4R2YA 4MVTA 4YATA 4BBQA 2LV9A 3RTRB 3ZTGA 5TBNA 2RSDA 3SOUA 2QICA 3N9MA 2YSJA 2H0DB 4ZDTA 4QF3A 3GL6A 3DQVR 2ECVA 4UP0A 1Z6UA 2CT2A 5D1KB 2FUUA 3EB6A 2ECGA 5FB0A 1WFKA 2RI7A 4WA6A 2ECNA 3N9OA 2MA6A 1HYIA 2MUMA 4N3WA 2YHNA 3ASLA 4I7BA 3ZVYA 2YUCA 4PPEA 1WE9A 4P5OB 1X4UA 2YURA 1Z2QA 2Y1NA 1DVPA 5LCWB 2VJFB 1WEEA 3SOXA 4YABA 2YHOA 4ZUXU 1WEVA 5LKTA 3L1ZB 5FEYA 1VYXA 2L43A 2MIQA 2LGGA 4I7CA 5I3LA 2YYRA 2Y1MA 4QF2A 4PTBA 3O37A 4UP5A 4FIPA 4YADA 4BHWA 1JM7A 3N9PA 4YBTA 3O70A 2PNXA 3LQHA 3C6WA 3ZPV1 1U6GB 4LK9A 5KH7A 2VJEB 5AIUA 5B78A 2L0BA 2EGPA 2L75A 4L58A 3KV5A 3KNVA 2G45A 2XB1A 2YT5A 1HYJA 2HDPA 2VPEA 3PURA 1BORA 1WEUA 4GNGA 2VNFA 3O36A 1MM3A 1JOCA 4W4UA 2CSZA 2I50A 1MM2A 2K4DA 2FSAA 2JMIA 5TRBA 2YQLA 5B76A 2VPDA 4A4CA 5C13A 1IYMA 2JMDA 2EODA 3HTKC 1VD4A 2EA6A 3L1XA 4AUQB 2KYUA 2KFTA 2LDRA 5G05B 4R7EA 2LRIC 2G6QA 3O35A 1WGMA 4GNEA 2NAAA 2E6RA 4O64A 3VK6A 2IDAA 4A0CD 1JM7B 4UI9B 1E4UA 2F42A 2KIZA 4YBSA 2CKLA 2JMJA 4LJNA 1V87A 3O7AA 3SOWA 2VJFA 3T6RA 3M62A 4B86C 2YREA 2QJ0A 2JRJA 2MT5A 4FO9A 1WEOA 4GNDA 2YW8A 5DKAA 2FUIA 5G04B 4LLBA 2L5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5O A;  4CA1 A;  2LGK A;  2ECI A;  2YQM A;  5C11 A;  4IC2 A;  4WZ0 A;  4C9Z A;  3MHH A;  2KGI A;  2LQ6 A;  2ZET C;  4V3K C;  4FJC A;  1Z60 A;  3DPL R;  1CHC A;  1LDK C;  1X4I A;  3MHS A;  2LXH C;  4XI1 A;  2MD8 C;  1WEW A;  2KGG A;  5H9M A;  2MA5 A;  4N4F A;  5B75 A;  2K17 A;  2KU3 A;  1WES A;  1FBV A;  1XWH A;  5TDR A;  2KR4 A;  2MNY A;  2KWN A;  5LKU A;  1N87 A;  1K2F A;  3FL2 A;  4NN2 A;  3O34 A;  1X4J A;  2K1J A;  2XEU A;  3LRQ A;  4YAX A;  3V43 A;  4MSX A;  3HCT A;  3T7L A;  4F52 B;  2M6M A;  2H0D A;  5G0F A;  2LXP C;  3I2D A;  5FER A;  2Y43 A;  4S3O B;  1RMD A;  5D1M B;  2K16 A;  4Q6F A;  2MD7 B;  5AIT A;  3GV4 A;  4R8P K;  1WEQ A;  4A4B A;  5B8D A;  5J3X A;  1VFY A;  2BAY A;  2VP7 A;  2G43 A;  2YU4 A;  4YBM A;  3RPG C;  4AYC A;  5LKZ A;  5D1L B;  1WIM A;  2CSY A;  4AYC B;  3IHP A;  3N9N A;  3O33 A;  2M3H A;  4IC3 A;  2M1R A;  2MNZ A;  1WEP A;  4CCG X;  3QZV A;  2KRE A;  3EB5 A;  1WIL A;  4A49 A;  5TDW A;  5JG6 A;  3LQI A;  3N9Q A;  2F6N A;  1WEN A;  2LGL A;  2LN0 A;  3KQI A;  2KWO A;  1LDJ B;  5H1U A;  3U5N A;  2VPB A;  3ZYQ A;  1F62 A;  4S3O C;  4WZ2 A;  2LGV A;  2VPG A;  3PHD A;  2DX8 A;  2OXQ C;  4GB0 A;  1FP0 A;  5B79 A;  3U5M A;  5DIN A;  4L7X A;  3HCU A;  3NG2 A;  4I7D A;  3L11 A;  3M99 A;  2F6J A;  1WEM A;  3C5K A;  4WZ3 B;  2YSM A;  2VJE A;  2D8S A;  3HCS A;  5B77 A;  3RPG B;  3U5P A;  2E6S A;  4B7Y C;  4V3L C;  2ECJ A;  3LQJ A;  5TAB A;  2PUY A;  2QIZ A;  2HYE D;  2CKL B;  3ZVZ B;  4ZQL A;  2UZG A;  1T1H A;  4FK5 A;  3M63 A;  5KH9 A;  4YC9 A;  3ZNI A;  2C2L A;  3ZPV E;  1G25 A;  3N9L A;  5EYA F;  3KV6 A;  3PUQ A;  4LAD B;  2KWJ A;  3SHB A;  4AVX A;  5H1T A;  5FB1 A;  2L80 A;  2C2V S;  4GNF A;  5LKX A;  2M85 A;  2ECT A;  5H1V A;  2KE1 A;  1ZBD B;  4AP4 A;  2AN6 A;  2ECW A;  4X3G A;  2KWK A;  4TKP B;  4LKA A;  5KH3 A;  4R2Y A;  4MVT A;  4YAT A;  4BBQ A;  2LV9 A;  3RTR B;  3ZTG A;  5TBN A;  2RSD A;  3SOU A;  2QIC A;  3N9M A;  2YSJ A;  2H0D B;  4ZDT A;  4QF3 A;  3GL6 A;  3DQV R;  2ECV A;  4UP0 A;  1Z6U A;  2CT2 A;  5D1K B;  2FUU A;  3EB6 A;  2ECG A;  5FB0 A;  1WFK A;  2RI7 A;  4WA6 A;  2ECN A;  3N9O A;  2MA6 A;  1HYI A;  2MUM A;  4N3W A;  2YHN A;  3ASL A;  4I7B A;  3ZVY A;  2YUC A;  4PPE A;  1WE9 A;  4P5O B;  1X4U A;  2YUR A;  1Z2Q A;  2Y1N A;  1DVP A;  5LCW B;  2VJF B;  1WEE A;  3SOX A;  4YAB A;  2YHO A;  4ZUX U;  1WEV A;  5LKT A;  3L1Z B;  5FEY A;  1VYX A;  2L43 A;  2MIQ A;  2LGG A;  4I7C A;  5I3L A;  2YYR A;  2Y1M A;  4QF2 A;  4PTB A;  3O37 A;  4UP5 A;  4FIP A;  4YAD A;  4BHW A;  1JM7 A;  3N9P A;  4YBT A;  3O70 A;  2PNX A;  3LQH A;  3C6W A;  3ZPV 1;  1U6G B;  4LK9 A;  5KH7 A;  2VJE B;  5AIU A;  5B78 A;  2L0B A;  2EGP A;  2L75 A;  4L58 A;  3KV5 A;  3KNV A;  2G45 A;  2XB1 A;  2YT5 A;  1HYJ A;  2HDP A;  2VPE A;  3PUR A;  1BOR A;  1WEU A;  4GNG A;  2VNF A;  3O36 A;  1MM3 A;  1JOC A;  4W4U A;  2CSZ A;  2I50 A;  1MM2 A;  2K4D A;  2FSA A;  2JMI A;  5TRB A;  2YQL A;  5B76 A;  2VPD A;  4A4C A;  5C13 A;  1IYM A;  2JMD A;  2EOD A;  3HTK C;  1VD4 A;  2EA6 A;  3L1X A;  4AUQ B;  2KYU A;  2KFT A;  2LDR A;  5G05 B;  4R7E A;  2LRI C;  2G6Q A;  3O35 A;  1WGM A;  4GNE A;  2NAA A;  2E6R A;  4O64 A;  3VK6 A;  2IDA A;  4A0C D;  1JM7 B;  4UI9 B;  1E4U A;  2F42 A;  2KIZ A;  4YBS A;  2CKL A;  2JMJ A;  4LJN A;  1V87 A;  3O7A A;  3SOW A;  2VJF A;  3T6R A;  3M62 A;  4B86 C;  2YRE A;  2QJ0 A;  2JRJ A;  2MT5 A;  4FO9 A;  1WEO A;  4GND A;  2YW8 A;  5DKA A;  2FUI A;  5G04 B;  4LLB A;  2L5U A; 
#chains in the Genus database with same CATH topology
 3U5O A;  4CA1 A;  2LGK A;  2ECI A;  2YQM A;  5C11 A;  3T9K A;  4IC2 A;  4WZ0 A;  1DCQ A;  4C9Z A;  3MHH A;  2KGI A;  2XOC A;  2LQ6 A;  2ZET C;  2XOZ A;  4V3K C;  4FJC A;  1Z60 A;  3DPL R;  1CHC A;  1LDK C;  1X4I A;  3MDB C;  3MHS A;  2LXH C;  4XI1 A;  2MD8 C;  1WEW A;  2KGG A;  5H9M A;  2FFW A;  2MA5 A;  1MBM A;  4N4F A;  5B75 A;  2K17 A;  2KU3 A;  2CRW A;  1WES A;  1FBV A;  2DJA A;  1XWH A;  5TDR A;  2KR4 A;  2L7P A;  2MNY A;  2KWN A;  5LKU A;  1N87 A;  1K2F A;  3FL2 A;  4NN2 A;  3O34 A;  1X4J A;  3SUB A;  2K1J A;  2XEU A;  3LRQ A;  4YAX A;  2E61 A;  2RR4 A;  3V43 A;  4MSX A;  3HCT A;  3T7L A;  4F52 B;  2M6M A;  2H0D A;  5G0F A;  2LXP C;  5SVY A;  3I2D A;  5FER A;  2Y43 A;  4S3O B;  1RMD A;  2KKY A;  5D1M B;  2K16 A;  4Q6F A;  2MD7 B;  5AIT A;  3GV4 A;  4R8P K;  1WEQ A;  4A4B A;  5B8D A;  5J3X A;  3M7K A;  1VFY A;  2BAY A;  2VP7 A;  2G43 A;  2YU4 A;  4YBM A;  3RPG C;  4AYC A;  4O62 A;  5LKZ A;  5D1L B;  3DWD A;  1WIM A;  2CSY A;  4AYC B;  5SVX A;  3IHP A;  3N9N A;  3O33 A;  2M3H A;  4IC3 A;  2M1R A;  2MNZ A;  3H7H A;  1WEP A;  4CCG X;  3QZV A;  2KRE A;  3EB5 A;  2B0O E;  1WIL A;  4A49 A;  2CON A;  5TDW A;  5JG6 A;  3LDY A;  3LQI A;  3N9Q A;  2F6N A;  1WEN A;  4F1P A;  2LGL A;  2D8U A;  2LN0 A;  3KQI A;  2KWO A;  1LDJ B;  5H1U A;  3U5N A;  2VPB A;  5K3Q A;  3ZYQ A;  1F62 A;  4S3O C;  4WZ2 A;  2LGV A;  2VPG A;  3PHD A;  2DX8 A;  2OXQ C;  4GB0 A;  2CRR A;  1FP0 A;  5B79 A;  3U5M A;  4Z0O A;  5DIN A;  4L7X A;  3HCU A;  3NG2 A;  4I7D A;  3L11 A;  3M99 A;  2F6J A;  2LAU A;  1WEM A;  3C5K A;  3KDE C;  4WZ3 B;  2YSM A;  2VJE A;  2D8S A;  2JM3 A;  3HCS A;  5B77 A;  3RPG B;  3U5P A;  2E6S A;  4B7Y C;  4V3L C;  2ECJ A;  3LQJ A;  5TAB A;  4OGE A;  2PUY A;  2QIZ A;  2CKL B;  2HYE D;  3ZVZ B;  4ZQL A;  2CSV A;  2UZG A;  1T1H A;  2EXU A;  4FK5 A;  3M63 A;  5KH9 A;  2XP0 A;  4YC9 A;  3ZNI A;  2C2L A;  3ZPV E;  1G25 A;  3N9L A;  5EYA F;  3KV6 A;  3PUQ A;  4LAD B;  2KWJ A;  3SHB A;  4AVX A;  5H1T A;  5FB1 A;  2L80 A;  2C2V S;  4GNF A;  5LKX A;  2M85 A;  2ECT A;  5H1V A;  2KE1 A;  3DDT A;  3LJU X;  1ZBD B;  4AP4 A;  2AN6 A;  2ECW A;  4X3G A;  2KWK A;  4TKP B;  2FD4 A;  4LKA A;  5KH3 A;  4R2Y A;  3FAO A;  4MVT A;  4YAT A;  4BBQ A;  2EGM A;  2LV9 A;  3RTR B;  3ZTG A;  5TBN A;  2RSD A;  3SOU A;  2QIC A;  2P57 A;  3N9M A;  2YSJ A;  2H0D B;  4ZDT A;  4QF3 A;  3GL6 A;  3DQV R;  2ECV A;  4UP0 A;  1Z6U A;  2CT2 A;  5D1K B;  2FUU A;  3EB6 A;  2ECG A;  5FB0 A;  5SVI B;  1WFK A;  2RI7 A;  4WA6 A;  2ECN A;  3N9O A;  2MA6 A;  2XOY A;  1HYI A;  2MUM A;  4N3W A;  2YHN A;  3ASL A;  4I7B A;  3ZVY A;  2YUC A;  4PPE A;  3FAN A;  1WE9 A;  4P5O B;  1X4U A;  2YUR A;  1Z2Q A;  2Y1N A;  1DVP A;  5LCW B;  2VJF B;  1WEE A;  2OWA A;  3FM8 C;  3SOX A;  4YAB A;  3FJU B;  4QQ4 A;  2YHO A;  4ZUX U;  1WEV A;  5LKT A;  3L1Z B;  5FEY A;  1VYX A;  2JUN A;  2L43 A;  2MIQ A;  2LGG A;  4I7C A;  5I3L A;  2YYR A;  2Y1M A;  3JUE A;  4QF2 A;  3Q1D A;  3O47 A;  4PTB A;  3O37 A;  2YVR A;  4UP5 A;  4FIP A;  2MKE A;  4YAD A;  4BHW A;  1JM7 A;  3N9P A;  4H9D A;  4OGC A;  3O70 A;  4YBT A;  3LVQ E;  2IQJ A;  2PNX A;  3LQH A;  3C6W A;  3ZPV 1;  1U6G B;  4LK9 A;  5KH7 A;  2M13 A;  5SVI A;  2VJE B;  5AIU A;  5B78 A;  2L0B A;  2EGP A;  2L75 A;  4L58 A;  3KV5 A;  3KNV A;  2G45 A;  2XB1 A;  2YT5 A;  1HYJ A;  2HDP A;  2VPE A;  3PUR A;  1BOR A;  1WEU A;  4GNG A;  2VNF A;  3O36 A;  1MM3 A;  1JOC A;  4W4U A;  2CSZ A;  2I50 A;  3FEH A;  1MM2 A;  2K4D A;  2FSA A;  3E2D A;  2JMI A;  5TRB A;  2YQL A;  5B76 A;  2VPD A;  4A4C A;  5C13 A;  1IYM A;  2JMD A;  2EOD A;  2KKX A;  3HTK C;  3PLW A;  1VD4 A;  2EA6 A;  3L1X A;  4AUQ B;  2KYU A;  2KFT A;  2LDR A;  5G05 B;  4R7E A;  2LRI C;  3LVR E;  2G6Q A;  3O35 A;  1WGM A;  4GNE A;  2NAA A;  2E6R A;  4O64 A;  3VK6 A;  2IDA A;  4A0C D;  1JM7 B;  4UI9 B;  1E4U A;  2F42 A;  2KIZ A;  4YBS A;  2CKL A;  2JMJ A;  4Z0R A;  4LJN A;  1V87 A;  3O7A A;  3SOW A;  2VJF A;  3T6R A;  3M62 A;  4B86 C;  2DSM A;  2YRE A;  2QJ0 A;  2JRJ A;  2MT5 A;  4FO9 A;  1WEO A;  4GND A;  2YW8 A;  5DKA A;  2FUI A;  5G04 B;  4LLB A;  2L5U A; 
#chains in the Genus database with same CATH homology
 3U5O A;  4CA1 A;  2LGK A;  2ECI A;  2YQM A;  5C11 A;  4IC2 A;  4WZ0 A;  4C9Z A;  3MHH A;  2KGI A;  2LQ6 A;  2ZET C;  4V3K C;  4FJC A;  1Z60 A;  3DPL R;  1CHC A;  1LDK C;  1X4I A;  3MHS A;  2LXH C;  4XI1 A;  2MD8 C;  1WEW A;  2KGG A;  5H9M A;  2MA5 A;  4N4F A;  5B75 A;  2K17 A;  2KU3 A;  1WES A;  1FBV A;  1XWH A;  5TDR A;  2KR4 A;  2MNY A;  2KWN A;  5LKU A;  1N87 A;  1K2F A;  3FL2 A;  4NN2 A;  3O34 A;  1X4J A;  2K1J A;  2XEU A;  3LRQ A;  4YAX A;  3V43 A;  4MSX A;  3HCT A;  3T7L A;  4F52 B;  2M6M A;  2H0D A;  5G0F A;  2LXP C;  3I2D A;  5FER A;  2Y43 A;  4S3O B;  1RMD A;  5D1M B;  2K16 A;  4Q6F A;  2MD7 B;  5AIT A;  3GV4 A;  4R8P K;  1WEQ A;  4A4B A;  5B8D A;  5J3X A;  1VFY A;  2BAY A;  2VP7 A;  2G43 A;  2YU4 A;  4YBM A;  3RPG C;  4AYC A;  5LKZ A;  5D1L B;  1WIM A;  2CSY A;  4AYC B;  3IHP A;  3N9N A;  3O33 A;  2M3H A;  4IC3 A;  2M1R A;  2MNZ A;  1WEP A;  4CCG X;  3QZV A;  2KRE A;  3EB5 A;  1WIL A;  4A49 A;  5TDW A;  5JG6 A;  3LQI A;  3N9Q A;  2F6N A;  1WEN A;  2LGL A;  2LN0 A;  3KQI A;  2KWO A;  1LDJ B;  5H1U A;  3U5N A;  2VPB A;  3ZYQ A;  1F62 A;  4S3O C;  4WZ2 A;  2LGV A;  2VPG A;  3PHD A;  2DX8 A;  2OXQ C;  4GB0 A;  1FP0 A;  5B79 A;  3U5M A;  5DIN A;  4L7X A;  3HCU A;  3NG2 A;  4I7D A;  3L11 A;  3M99 A;  2F6J A;  1WEM A;  3C5K A;  4WZ3 B;  2YSM A;  2VJE A;  2D8S A;  3HCS A;  5B77 A;  3RPG B;  3U5P A;  2E6S A;  4B7Y C;  4V3L C;  2ECJ A;  3LQJ A;  5TAB A;  2PUY A;  2QIZ A;  2HYE D;  2CKL B;  3ZVZ B;  4ZQL A;  2UZG A;  1T1H A;  4FK5 A;  3M63 A;  5KH9 A;  4YC9 A;  3ZNI A;  2C2L A;  3ZPV E;  1G25 A;  3N9L A;  5EYA F;  3KV6 A;  3PUQ A;  4LAD B;  2KWJ A;  3SHB A;  4AVX A;  5H1T A;  5FB1 A;  2L80 A;  2C2V S;  4GNF A;  5LKX A;  2M85 A;  2ECT A;  5H1V A;  2KE1 A;  1ZBD B;  4AP4 A;  2AN6 A;  2ECW A;  4X3G A;  2KWK A;  4TKP B;  4LKA A;  5KH3 A;  4R2Y A;  4MVT A;  4YAT A;  4BBQ A;  2LV9 A;  3RTR B;  3ZTG A;  5TBN A;  2RSD A;  3SOU A;  2QIC A;  3N9M A;  2YSJ A;  2H0D B;  4ZDT A;  4QF3 A;  3GL6 A;  3DQV R;  2ECV A;  4UP0 A;  1Z6U A;  2CT2 A;  5D1K B;  2FUU A;  3EB6 A;  2ECG A;  5FB0 A;  1WFK A;  2RI7 A;  4WA6 A;  2ECN A;  3N9O A;  2MA6 A;  1HYI A;  2MUM A;  4N3W A;  2YHN A;  3ASL A;  4I7B A;  3ZVY A;  2YUC A;  4PPE A;  1WE9 A;  4P5O B;  1X4U A;  2YUR A;  1Z2Q A;  2Y1N A;  1DVP A;  5LCW B;  2VJF B;  1WEE A;  3SOX A;  4YAB A;  2YHO A;  4ZUX U;  1WEV A;  5LKT A;  3L1Z B;  5FEY A;  1VYX A;  2L43 A;  2MIQ A;  2LGG A;  4I7C A;  5I3L A;  2YYR A;  2Y1M A;  4QF2 A;  4PTB A;  3O37 A;  4UP5 A;  4FIP A;  4YAD A;  4BHW A;  1JM7 A;  3N9P A;  4YBT A;  3O70 A;  2PNX A;  3LQH A;  3C6W A;  3ZPV 1;  1U6G B;  4LK9 A;  5KH7 A;  2VJE B;  5AIU A;  5B78 A;  2L0B A;  2EGP A;  2L75 A;  4L58 A;  3KV5 A;  3KNV A;  2G45 A;  2XB1 A;  2YT5 A;  1HYJ A;  2HDP A;  2VPE A;  3PUR A;  1BOR A;  1WEU A;  4GNG A;  2VNF A;  3O36 A;  1MM3 A;  1JOC A;  4W4U A;  2CSZ A;  2I50 A;  1MM2 A;  2K4D A;  2FSA A;  2JMI A;  5TRB A;  2YQL A;  5B76 A;  2VPD A;  4A4C A;  5C13 A;  1IYM A;  2JMD A;  2EOD A;  3HTK C;  1VD4 A;  2EA6 A;  3L1X A;  4AUQ B;  2KYU A;  2KFT A;  2LDR A;  5G05 B;  4R7E A;  2LRI C;  2G6Q A;  3O35 A;  1WGM A;  4GNE A;  2NAA A;  2E6R A;  4O64 A;  3VK6 A;  2IDA A;  4A0C D;  1JM7 B;  4UI9 B;  1E4U A;  2F42 A;  2KIZ A;  4YBS A;  2CKL A;  2JMJ A;  4LJN A;  1V87 A;  3O7A A;  3SOW A;  2VJF A;  3T6R A;  3M62 A;  4B86 C;  2YRE A;  2QJ0 A;  2JRJ A;  2MT5 A;  4FO9 A;  1WEO A;  4GND A;  2YW8 A;  5DKA A;  2FUI A;  5G04 B;  4LLB A;  2L5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...