2EA6A

Solution structure of the ring domain of the human ring finger protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
GSSGSSGTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein 4
publication title Solution Structure of the RING domain of the human ring finger protein 4
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ea6A01
3M63A 2YW8A 3LQJA 3RPGB 1CHCA 2ECTA 2QICA 3N9NA 2L0BA 2I50A 4AVXA 5B77A 1WEWA 4Q6FA 3PHDA 1WEQA 3T7LA 4UI9B 2YYRA 2G45A 2FUUA 2YQLA 4AP4A 1F62A 3N9PA 4L7XA 5B76A 4I7BA 2NAAA 4LK9A 1JOCA 2KWOA 5D1LB 4LADB 2F6NA 5FEYA 4TKPB 4UP5A 5G05B 3O7AA 5TABA 2YT5A 1K2FA 2UZGA 2M6MA 5H1UA 3EB6A 2VJEA 2YHOA 3L1XA 3GV4A 4S3OC 1WILA 2XEUA 2M85A 3DQVR 2DX8A 2KE1A 4N3WA 2MA6A 2QJ0A 1WE9A 3KQIA 4LJNA 5LKUA 2D8SA 5EYAF 5B78A 2FSAA 3U5MA 5AITA 2KWKA 4A4BA 4NN2A 2VPDA 3O36A 2RSDA 3L1ZB 2KYUA 2EGPA 3O33A 4LKAA 5FB0A 4R8PK 2M3HA 2FUIA 2YREA 5G04B 1U6GB 3PURA 4AUQB 3C5KA 3U5NA 5JG6A 4YC9A 2XB1A 4WZ3B 4V3KC 4F52B 4A4CA 3N9OA 4AYCA 2CSZA 2CKLA 3NG2A 3KNVA 2Y1NA 2LGGA 1T1HA 1WEEA 1WEVA 4ZQLA 3N9LA 4B86C 5AIUA 1X4UA 2LGLA 2LDRA 3HCTA 3KV6A 1JM7A 1DVPA 2YSMA 2KWJA 2G6QA 4YABA 2KFTA 1ZBDB 4I7CA 5FB1A 3N9MA 4IC3A 5DKAA 2LV9A 1X4JA 5KH3A 2ECGA 2VJFA 4UP0A 2QIZA 1E4UA 4YADA 3O70A 5H9MA 1WGMA 4ZDTA 5LKZA 4GNFA 3O34A 5G0FA 4N4FA 1X4IA 3MHSA 2CSYA 2L5UA 3ZVZB 2LRIC 1VD4A 1WIMA 4O64A 2MT5A 1HYIA 4R7EA 1WESA 2KU3A 4GB0A 2Y1MA 4BBQA 3M99A 2LQ6A 2ECJA 2EA6A 2JMIA 1VYXA 2PUYA 2VPEA 2VJEB 2VPBA 5J3XA 2LGVA 3LQIA 4QF2A 3ZPVE 3V43A 2YURA 4FJCA 4S3OB 3IHPA 2F42A 2H0DA 2L43A 4PTBA 3LQHA 1G25A 2Y43A 4MSXA 4MVTA 5H1VA 4W4UA 3T6RA 2KREA 4P5OB 3HTKC 3KV5A 4GNGA 2KIZA 2VP7A 2LGKA 4V3LC 5TDWA 5H1TA 2ECVA 2M1RA 5KH9A 1FBVA 4GNEA 2YHNA 2MNZA 1IYMA 5D1MB 5LKTA 5C13A 3M62A 3N9QA 2MIQA 3SHBA 2ECNA 4A0CD 2LXPC 3I2DA 1LDJB 1HYJA 2JRJA 4PPEA 1VFYA 3ZYQA 2G43A 1WENA 4B7YC 4AYCB 3RPGC 1MM3A 2CKLB 5TBNA 2E6SA 3GL6A 4FIPA 2MNYA 4FO9A 4ZUXU 3HCUA 2PNXA 3O35A 1Z60A 2KGGA 4QF3A 1JM7B 2MUMA 2E6RA 4C9ZA 4YATA 5I3LA 1V87A 3SOUA 1FP0A 2K17A 2VPGA 5D1KB 2MD8C 5C11A 2VJFB 3ASLA 4I7DA 4IC2A 3FL2A 4YBSA 2L75A 2IDAA 3L11A 3VK6A 3DPLR 2F6JA 1RMDA 5B75A 4BHWA 2OXQC 3RTRB 2HDPA 4WZ0A 2L80A 2ZETC 3C6WA 5DINA 3ZNIA 5TRBA 1MM2A 3ZPV1 4CA1A 3ZVYA 4A49A 2KWNA 1N87A 2HYED 2K1JA 3O37A 4L58A 2JMDA 4X3GA 5LKXA 2CT2A 2LXHC 4R2YA 2KGIA 2LN0A 1WEUA 3PUQA 2H0DB 2C2LA 1Z6UA 1WEOA 4XI1A 4LLBA 3MHHA 4YBMA 2MD7B 1Z2QA 2MA5A 1BORA 3LRQA 2K4DA 3U5OA 2YU4A 5B79A 3U5PA 2YQMA 3EB5A 2ECWA 2VNFA 2BAYA 2AN6A 3HCSA 4GNDA 3ZTGA 4FK5A 1LDKC 5KH7A 5TDRA 4WZ2A 3SOWA 1WEMA 2YSJA 2KR4A 3SOXA 2EODA 1WEPA 4YAXA 3QZVA 4WA6A 2RI7A 4YBTA 4CCGX 2YUCA 2JMJA 2K16A 5B8DA 2ECIA 5FERA 1WFKA 2C2VS 1XWHA 5LCWB
chains in the Genus database with same CATH superfamily
3M63A 2FD4A 2YW8A 2P57A 2IQJA 3LQJA 3RPGB 1CHCA 2ECTA 2QICA 3N9NA 2L0BA 2I50A 3Q1DA 4AVXA 5B77A 1WEWA 3FEHA 4Q6FA 3PHDA 1WEQA 3T7LA 4UI9B 2YYRA 5LCWB 2G45A 2FUUA 2YQLA 4AP4A 1F62A 3FJUB 3N9PA 4L7XA 5B76A 4I7BA 2NAAA 4LK9A 1JOCA 2KWOA 5D1LB 4LADB 2LAUA 2F6NA 5FEYA 4TKPB 4UP5A 5G05B 2DJAA 3O7AA 5TABA 2YT5A 1K2FA 2UZGA 2M6MA 5H1UA 3EB6A 2VJEA 2YHOA 1MBMA 3L1XA 3GV4A 4S3OC 1WILA 2XEUA 2M85A 3DQVR 3SUBA 2DX8A 2KE1A 4N3WA 2MA6A 2QJ0A 1WE9A 3KQIA 4LJNA 5LKUA 2D8SA 5EYAF 5B78A 2FSAA 3U5MA 5AITA 2KWKA 4A4BA 3MDBC 4NN2A 2VPDA 3O36A 2RSDA 3L1ZB 3H7HA 2KYUA 4H9DA 2EGPA 3O33A 4LKAA 5FB0A 4R8PK 2XOZA 2JM3A 2M3HA 2FUIA 2YREA 5G04B 3E2DA 1U6GB 3PURA 4AUQB 3C5KA 4OGCA 3U5NA 2L7PA 5JG6A 4YC9A 2XB1A 4WZ3B 4V3KC 4F52B 4A4CA 3N9OA 4AYCA 2CSZA 2CKLA 3LDYA 5SVYA 3NG2A 3KNVA 4Z0RA 2OWAA 2Y1NA 2LGGA 1T1HA 1WEEA 1WEVA 2EXUA 2XOYA 4F1PA 4ZQLA 3N9LA 4B86C 5AIUA 1X4UA 2DSMA 2LGLA 2LDRA 3HCTA 3KV6A 2D8UA 1JM7A 1DVPA 2YSMA 2B0OE 2G6QA 2KWJA 4YABA 2KFTA 1ZBDB 4I7CA 5FB1A 3N9MA 4IC3A 5DKAA 2LV9A 1X4JA 5KH3A 2ECGA 2VJFA 4UP0A 2QIZA 1E4UA 4YADA 5SVIA 3O70A 5H9MA 1WGMA 4ZDTA 5LKZA 3O47A 4GNFA 3O34A 5G0FA 4N4FA 1X4IA 3MHSA 2CRRA 2CSYA 2L5UA 2EGMA 3ZVZB 4QQ4A 2KKXA 2LRIC 1VD4A 1WIMA 4O64A 2MT5A 1HYIA 4R7EA 1WESA 2KU3A 4GB0A 2Y1MA 4BBQA 3M99A 2LQ6A 2ECJA 2EA6A 2JMIA 1VYXA 2PUYA 2VPEA 2VJEB 2VPBA 5J3XA 2LGVA 3LQIA 4QF2A 2RR4A 3ZPVE 3V43A 2YURA 4FJCA 4S3OB 3IHPA 2F42A 2H0DA 3FANA 2L43A 4PTBA 3LQHA 1G25A 4Z0OA 2Y43A 4MSXA 4MVTA 5H1VA 4W4UA 3T6RA 2KREA 4P5OB 5SVXA 3HTKC 3KV5A 4GNGA 2KIZA 2XP0A 2VP7A 2LGKA 4V3LC 5TDWA 5H1TA 2ECVA 2M1RA 2YVRA 5KH9A 1FBVA 3FAOA 3PLWA 4GNEA 2YHNA 1DCQA 2CONA 2MNZA 1IYMA 2JUNA 2M13A 3DWDA 5D1MB 5LKTA 5C13A 3M62A 2MKEA 2FFWA 3N9QA 2MIQA 3SHBA 2ECNA 4A0CD 2LXPC 3I2DA 1LDJB 1HYJA 2JRJA 4PPEA 1VFYA 3ZYQA 2G43A 1WENA 4B7YC 4AYCB 3RPGC 1MM3A 2CKLB 4O62A 5K3QA 5TBNA 2E6SA 3GL6A 4FIPA 2MNYA 4FO9A 4ZUXU 3M7KA 3HCUA 2PNXA 3O35A 3LJUX 1Z60A 2KGGA 3FM8C 4QF3A 1JM7B 2MUMA 2E6RA 4C9ZA 4YATA 5I3LA 1V87A 3SOUA 1FP0A 2K17A 2VPGA 5D1KB 2MD8C 5C11A 2VJFB 3ASLA 2XOCA 4I7DA 4IC2A 5SVIB 3FL2A 4YBSA 2L75A 2IDAA 3L11A 3VK6A 3DPLR 2F6JA 1RMDA 5B75A 3JUEA 4BHWA 2OXQC 3RTRB 2HDPA 2CSVA 2KKYA 4WZ0A 2L80A 2ZETC 3C6WA 5DINA 3ZNIA 5TRBA 1MM2A 3ZPV1 4OGEA 4CA1A 3ZVYA 4A49A 2KWNA 3KDEC 1N87A 2HYED 2K1JA 3O37A 4L58A 2JMDA 4X3GA 5LKXA 2CT2A 2LXHC 4R2YA 2KGIA 2LN0A 1WEUA 3PUQA 2H0DB 2C2LA 1Z6UA 1WEOA 4XI1A 4LLBA 3MHHA 4YBMA 2MD7B 1Z2QA 2MA5A 1BORA 3LVRE 3LRQA 3LVQE 2K4DA 3U5OA 2YU4A 5B79A 3T9KA 3U5PA 2YQMA 3EB5A 2ECWA 2VNFA 2BAYA 2AN6A 3HCSA 4GNDA 3ZTGA 4FK5A 1LDKC 5KH7A 5TDRA 4WZ2A 3SOWA 1WEMA 2YSJA 2KR4A 3SOXA 2EODA 1WEPA 3DDTA 4YAXA 3QZVA 2E61A 4WA6A 2RI7A 4YBTA 4CCGX 2YUCA 2JMJA 2K16A 5B8DA 2ECIA 5FERA 1WFKA 2C2VS 1XWHA 2CRWA
chains in the Genus database with same CATH topology
3M63A 2YW8A 3LQJA 3RPGB 1CHCA 2ECTA 2QICA 3N9NA 2L0BA 2I50A 4AVXA 5B77A 1WEWA 4Q6FA 3PHDA 1WEQA 3T7LA 4UI9B 2YYRA 2G45A 2FUUA 2YQLA 4AP4A 1F62A 3N9PA 4L7XA 5B76A 4I7BA 2NAAA 4LK9A 1JOCA 2KWOA 5D1LB 4LADB 2F6NA 5FEYA 4TKPB 4UP5A 5G05B 3O7AA 5TABA 2YT5A 1K2FA 2UZGA 2M6MA 5H1UA 3EB6A 2VJEA 2YHOA 3L1XA 3GV4A 4S3OC 1WILA 2XEUA 2M85A 3DQVR 2DX8A 2KE1A 4N3WA 2MA6A 2QJ0A 1WE9A 3KQIA 4LJNA 5LKUA 2D8SA 5EYAF 5B78A 2FSAA 3U5MA 5AITA 2KWKA 4A4BA 4NN2A 2VPDA 3O36A 2RSDA 3L1ZB 2KYUA 2EGPA 3O33A 4LKAA 5FB0A 4R8PK 2M3HA 2FUIA 2YREA 5G04B 1U6GB 3PURA 4AUQB 3C5KA 3U5NA 5JG6A 4YC9A 2XB1A 4WZ3B 4V3KC 4F52B 4A4CA 3N9OA 4AYCA 2CSZA 2CKLA 3NG2A 3KNVA 2Y1NA 2LGGA 1T1HA 1WEEA 1WEVA 4ZQLA 3N9LA 4B86C 5AIUA 1X4UA 2LGLA 2LDRA 3HCTA 3KV6A 1JM7A 1DVPA 2YSMA 2KWJA 2G6QA 4YABA 2KFTA 1ZBDB 4I7CA 5FB1A 3N9MA 4IC3A 5DKAA 2LV9A 1X4JA 5KH3A 2ECGA 2VJFA 4UP0A 2QIZA 1E4UA 4YADA 3O70A 5H9MA 1WGMA 4ZDTA 5LKZA 4GNFA 3O34A 5G0FA 4N4FA 1X4IA 3MHSA 2CSYA 2L5UA 3ZVZB 2LRIC 1VD4A 1WIMA 4O64A 2MT5A 1HYIA 4R7EA 1WESA 2KU3A 4GB0A 2Y1MA 4BBQA 3M99A 2LQ6A 2ECJA 2EA6A 2JMIA 1VYXA 2PUYA 2VPEA 2VJEB 2VPBA 5J3XA 2LGVA 3LQIA 4QF2A 3ZPVE 3V43A 2YURA 4FJCA 4S3OB 3IHPA 2F42A 2H0DA 2L43A 4PTBA 3LQHA 1G25A 2Y43A 4MSXA 4MVTA 5H1VA 4W4UA 3T6RA 2KREA 4P5OB 3HTKC 3KV5A 4GNGA 2KIZA 2VP7A 2LGKA 4V3LC 5TDWA 5H1TA 2ECVA 2M1RA 5KH9A 1FBVA 4GNEA 2YHNA 2MNZA 1IYMA 5D1MB 5LKTA 5C13A 3M62A 3N9QA 2MIQA 3SHBA 2ECNA 4A0CD 2LXPC 3I2DA 1LDJB 1HYJA 2JRJA 4PPEA 1VFYA 3ZYQA 2G43A 1WENA 4B7YC 4AYCB 3RPGC 1MM3A 2CKLB 5TBNA 2E6SA 3GL6A 4FIPA 2MNYA 4FO9A 4ZUXU 3HCUA 2PNXA 3O35A 1Z60A 2KGGA 4QF3A 1JM7B 2MUMA 2E6RA 4C9ZA 4YATA 5I3LA 1V87A 3SOUA 1FP0A 2K17A 2VPGA 5D1KB 2MD8C 5C11A 2VJFB 3ASLA 4I7DA 4IC2A 3FL2A 4YBSA 2L75A 2IDAA 3L11A 3VK6A 3DPLR 2F6JA 1RMDA 5B75A 4BHWA 2OXQC 3RTRB 2HDPA 4WZ0A 2L80A 2ZETC 3C6WA 5DINA 3ZNIA 5TRBA 1MM2A 3ZPV1 4CA1A 3ZVYA 4A49A 2KWNA 1N87A 2HYED 2K1JA 3O37A 4L58A 2JMDA 4X3GA 5LKXA 2CT2A 2LXHC 4R2YA 2KGIA 2LN0A 1WEUA 3PUQA 2H0DB 2C2LA 1Z6UA 1WEOA 4XI1A 4LLBA 3MHHA 4YBMA 2MD7B 1Z2QA 2MA5A 1BORA 3LRQA 2K4DA 3U5OA 2YU4A 5B79A 3U5PA 2YQMA 3EB5A 2ECWA 2VNFA 2BAYA 2AN6A 3HCSA 4GNDA 3ZTGA 4FK5A 1LDKC 5KH7A 5TDRA 4WZ2A 3SOWA 1WEMA 2YSJA 2KR4A 3SOXA 2EODA 1WEPA 4YAXA 3QZVA 4WA6A 2RI7A 4YBTA 4CCGX 2YUCA 2JMJA 2K16A 5B8DA 2ECIA 5FERA 1WFKA 2C2VS 1XWHA 5LCWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  2YW8 A;  3LQJ A;  3RPG B;  1CHC A;  2ECT A;  2QIC A;  3N9N A;  2L0B A;  2I50 A;  4AVX A;  5B77 A;  1WEW A;  4Q6F A;  3PHD A;  1WEQ A;  3T7L A;  4UI9 B;  2YYR A;  2G45 A;  2FUU A;  2YQL A;  4AP4 A;  1F62 A;  3N9P A;  4L7X A;  5B76 A;  4I7B A;  2NAA A;  4LK9 A;  1JOC A;  2KWO A;  5D1L B;  4LAD B;  2F6N A;  5FEY A;  4TKP B;  4UP5 A;  5G05 B;  3O7A A;  5TAB A;  2YT5 A;  1K2F A;  2UZG A;  2M6M A;  5H1U A;  3EB6 A;  2VJE A;  2YHO A;  3L1X A;  3GV4 A;  4S3O C;  1WIL A;  2XEU A;  2M85 A;  3DQV R;  2DX8 A;  2KE1 A;  4N3W A;  2MA6 A;  2QJ0 A;  1WE9 A;  3KQI A;  4LJN A;  5LKU A;  2D8S A;  5EYA F;  5B78 A;  2FSA A;  3U5M A;  5AIT A;  2KWK A;  4A4B A;  4NN2 A;  2VPD A;  3O36 A;  2RSD A;  3L1Z B;  2KYU A;  2EGP A;  3O33 A;  4LKA A;  5FB0 A;  4R8P K;  2M3H A;  2FUI A;  2YRE A;  5G04 B;  1U6G B;  3PUR A;  4AUQ B;  3C5K A;  3U5N A;  5JG6 A;  4YC9 A;  2XB1 A;  4WZ3 B;  4V3K C;  4F52 B;  4A4C A;  3N9O A;  4AYC A;  2CSZ A;  2CKL A;  3NG2 A;  3KNV A;  2Y1N A;  2LGG A;  1T1H A;  1WEE A;  1WEV A;  4ZQL A;  3N9L A;  4B86 C;  5AIU A;  1X4U A;  2LGL A;  2LDR A;  3HCT A;  3KV6 A;  1JM7 A;  1DVP A;  2YSM A;  2KWJ A;  2G6Q A;  4YAB A;  2KFT A;  1ZBD B;  4I7C A;  5FB1 A;  3N9M A;  4IC3 A;  5DKA A;  2LV9 A;  1X4J A;  5KH3 A;  2ECG A;  2VJF A;  4UP0 A;  2QIZ A;  1E4U A;  4YAD A;  3O70 A;  5H9M A;  1WGM A;  4ZDT A;  5LKZ A;  4GNF A;  3O34 A;  5G0F A;  4N4F A;  1X4I A;  3MHS A;  2CSY A;  2L5U A;  3ZVZ B;  2LRI C;  1VD4 A;  1WIM A;  4O64 A;  2MT5 A;  1HYI A;  4R7E A;  1WES A;  2KU3 A;  4GB0 A;  2Y1M A;  4BBQ A;  3M99 A;  2LQ6 A;  2ECJ A;  2EA6 A;  2JMI A;  1VYX A;  2PUY A;  2VPE A;  2VJE B;  2VPB A;  5J3X A;  2LGV A;  3LQI A;  4QF2 A;  3ZPV E;  3V43 A;  2YUR A;  4FJC A;  4S3O B;  3IHP A;  2F42 A;  2H0D A;  2L43 A;  4PTB A;  3LQH A;  1G25 A;  2Y43 A;  4MSX A;  4MVT A;  5H1V A;  4W4U A;  3T6R A;  2KRE A;  4P5O B;  3HTK C;  3KV5 A;  4GNG A;  2KIZ A;  2VP7 A;  2LGK A;  4V3L C;  5TDW A;  5H1T A;  2ECV A;  2M1R A;  5KH9 A;  1FBV A;  4GNE A;  2YHN A;  2MNZ A;  1IYM A;  5D1M B;  5LKT A;  5C13 A;  3M62 A;  3N9Q A;  2MIQ A;  3SHB A;  2ECN A;  4A0C D;  2LXP C;  3I2D A;  1LDJ B;  1HYJ A;  2JRJ A;  4PPE A;  1VFY A;  3ZYQ A;  2G43 A;  1WEN A;  4B7Y C;  4AYC B;  3RPG C;  1MM3 A;  2CKL B;  5TBN A;  2E6S A;  3GL6 A;  4FIP A;  2MNY A;  4FO9 A;  4ZUX U;  3HCU A;  2PNX A;  3O35 A;  1Z60 A;  2KGG A;  4QF3 A;  1JM7 B;  2MUM A;  2E6R A;  4C9Z A;  4YAT A;  5I3L A;  1V87 A;  3SOU A;  1FP0 A;  2K17 A;  2VPG A;  5D1K B;  2MD8 C;  5C11 A;  2VJF B;  3ASL A;  4I7D A;  4IC2 A;  3FL2 A;  4YBS A;  2L75 A;  2IDA A;  3L11 A;  3VK6 A;  3DPL R;  2F6J A;  1RMD A;  5B75 A;  4BHW A;  2OXQ C;  3RTR B;  2HDP A;  4WZ0 A;  2L80 A;  2ZET C;  3C6W A;  5DIN A;  3ZNI A;  5TRB A;  1MM2 A;  3ZPV 1;  4CA1 A;  3ZVY A;  4A49 A;  2KWN A;  1N87 A;  2HYE D;  2K1J A;  3O37 A;  4L58 A;  2JMD A;  4X3G A;  5LKX A;  2CT2 A;  2LXH C;  4R2Y A;  2KGI A;  2LN0 A;  1WEU A;  3PUQ A;  2H0D B;  2C2L A;  1Z6U A;  1WEO A;  4XI1 A;  4LLB A;  3MHH A;  4YBM A;  2MD7 B;  1Z2Q A;  2MA5 A;  1BOR A;  3LRQ A;  2K4D A;  3U5O A;  2YU4 A;  5B79 A;  3U5P A;  2YQM A;  3EB5 A;  2ECW A;  2VNF A;  2BAY A;  2AN6 A;  3HCS A;  4GND A;  3ZTG A;  4FK5 A;  1LDK C;  5KH7 A;  5TDR A;  4WZ2 A;  3SOW A;  1WEM A;  2YSJ A;  2KR4 A;  3SOX A;  2EOD A;  1WEP A;  4YAX A;  3QZV A;  4WA6 A;  2RI7 A;  4YBT A;  4CCG X;  2YUC A;  2JMJ A;  2K16 A;  5B8D A;  2ECI A;  5FER A;  1WFK A;  2C2V S;  1XWH A;  5LCW B; 
#chains in the Genus database with same CATH topology
 3M63 A;  2FD4 A;  2YW8 A;  2P57 A;  2IQJ A;  3LQJ A;  3RPG B;  1CHC A;  2ECT A;  2QIC A;  3N9N A;  2L0B A;  2I50 A;  3Q1D A;  4AVX A;  5B77 A;  1WEW A;  3FEH A;  4Q6F A;  3PHD A;  1WEQ A;  3T7L A;  4UI9 B;  2YYR A;  5LCW B;  2G45 A;  2FUU A;  2YQL A;  4AP4 A;  1F62 A;  3FJU B;  3N9P A;  4L7X A;  5B76 A;  4I7B A;  2NAA A;  4LK9 A;  1JOC A;  2KWO A;  5D1L B;  4LAD B;  2LAU A;  2F6N A;  5FEY A;  4TKP B;  4UP5 A;  5G05 B;  2DJA A;  3O7A A;  5TAB A;  2YT5 A;  1K2F A;  2UZG A;  2M6M A;  5H1U A;  3EB6 A;  2VJE A;  2YHO A;  1MBM A;  3L1X A;  3GV4 A;  4S3O C;  1WIL A;  2XEU A;  2M85 A;  3DQV R;  3SUB A;  2DX8 A;  2KE1 A;  4N3W A;  2MA6 A;  2QJ0 A;  1WE9 A;  3KQI A;  4LJN A;  5LKU A;  2D8S A;  5EYA F;  5B78 A;  2FSA A;  3U5M A;  5AIT A;  2KWK A;  4A4B A;  3MDB C;  4NN2 A;  2VPD A;  3O36 A;  2RSD A;  3L1Z B;  3H7H A;  2KYU A;  4H9D A;  2EGP A;  3O33 A;  4LKA A;  5FB0 A;  4R8P K;  2XOZ A;  2JM3 A;  2M3H A;  2FUI A;  2YRE A;  5G04 B;  3E2D A;  1U6G B;  3PUR A;  4AUQ B;  3C5K A;  4OGC A;  3U5N A;  2L7P A;  5JG6 A;  4YC9 A;  2XB1 A;  4WZ3 B;  4V3K C;  4F52 B;  4A4C A;  3N9O A;  4AYC A;  2CSZ A;  2CKL A;  3LDY A;  5SVY A;  3NG2 A;  3KNV A;  4Z0R A;  2OWA A;  2Y1N A;  2LGG A;  1T1H A;  1WEE A;  1WEV A;  2EXU A;  2XOY A;  4F1P A;  4ZQL A;  3N9L A;  4B86 C;  5AIU A;  1X4U A;  2DSM A;  2LGL A;  2LDR A;  3HCT A;  3KV6 A;  2D8U A;  1JM7 A;  1DVP A;  2YSM A;  2B0O E;  2G6Q A;  2KWJ A;  4YAB A;  2KFT A;  1ZBD B;  4I7C A;  5FB1 A;  3N9M A;  4IC3 A;  5DKA A;  2LV9 A;  1X4J A;  5KH3 A;  2ECG A;  2VJF A;  4UP0 A;  2QIZ A;  1E4U A;  4YAD A;  5SVI A;  3O70 A;  5H9M A;  1WGM A;  4ZDT A;  5LKZ A;  3O47 A;  4GNF A;  3O34 A;  5G0F A;  4N4F A;  1X4I A;  3MHS A;  2CRR A;  2CSY A;  2L5U A;  2EGM A;  3ZVZ B;  4QQ4 A;  2KKX A;  2LRI C;  1VD4 A;  1WIM A;  4O64 A;  2MT5 A;  1HYI A;  4R7E A;  1WES A;  2KU3 A;  4GB0 A;  2Y1M A;  4BBQ A;  3M99 A;  2LQ6 A;  2ECJ A;  2EA6 A;  2JMI A;  1VYX A;  2PUY A;  2VPE A;  2VJE B;  2VPB A;  5J3X A;  2LGV A;  3LQI A;  4QF2 A;  2RR4 A;  3ZPV E;  3V43 A;  2YUR A;  4FJC A;  4S3O B;  3IHP A;  2F42 A;  2H0D A;  3FAN A;  2L43 A;  4PTB A;  3LQH A;  1G25 A;  4Z0O A;  2Y43 A;  4MSX A;  4MVT A;  5H1V A;  4W4U A;  3T6R A;  2KRE A;  4P5O B;  5SVX A;  3HTK C;  3KV5 A;  4GNG A;  2KIZ A;  2XP0 A;  2VP7 A;  2LGK A;  4V3L C;  5TDW A;  5H1T A;  2ECV A;  2M1R A;  2YVR A;  5KH9 A;  1FBV A;  3FAO A;  3PLW A;  4GNE A;  2YHN A;  1DCQ A;  2CON A;  2MNZ A;  1IYM A;  2JUN A;  2M13 A;  3DWD A;  5D1M B;  5LKT A;  5C13 A;  3M62 A;  2MKE A;  2FFW A;  3N9Q A;  2MIQ A;  3SHB A;  2ECN A;  4A0C D;  2LXP C;  3I2D A;  1LDJ B;  1HYJ A;  2JRJ A;  4PPE A;  1VFY A;  3ZYQ A;  2G43 A;  1WEN A;  4B7Y C;  4AYC B;  3RPG C;  1MM3 A;  2CKL B;  4O62 A;  5K3Q A;  5TBN A;  2E6S A;  3GL6 A;  4FIP A;  2MNY A;  4FO9 A;  4ZUX U;  3M7K A;  3HCU A;  2PNX A;  3O35 A;  3LJU X;  1Z60 A;  2KGG A;  3FM8 C;  4QF3 A;  1JM7 B;  2MUM A;  2E6R A;  4C9Z A;  4YAT A;  5I3L A;  1V87 A;  3SOU A;  1FP0 A;  2K17 A;  2VPG A;  5D1K B;  2MD8 C;  5C11 A;  2VJF B;  3ASL A;  2XOC A;  4I7D A;  4IC2 A;  5SVI B;  3FL2 A;  4YBS A;  2L75 A;  2IDA A;  3L11 A;  3VK6 A;  3DPL R;  2F6J A;  1RMD A;  5B75 A;  3JUE A;  4BHW A;  2OXQ C;  3RTR B;  2HDP A;  2CSV A;  2KKY A;  4WZ0 A;  2L80 A;  2ZET C;  3C6W A;  5DIN A;  3ZNI A;  5TRB A;  1MM2 A;  3ZPV 1;  4OGE A;  4CA1 A;  3ZVY A;  4A49 A;  2KWN A;  3KDE C;  1N87 A;  2HYE D;  2K1J A;  3O37 A;  4L58 A;  2JMD A;  4X3G A;  5LKX A;  2CT2 A;  2LXH C;  4R2Y A;  2KGI A;  2LN0 A;  1WEU A;  3PUQ A;  2H0D B;  2C2L A;  1Z6U A;  1WEO A;  4XI1 A;  4LLB A;  3MHH A;  4YBM A;  2MD7 B;  1Z2Q A;  2MA5 A;  1BOR A;  3LVR E;  3LRQ A;  3LVQ E;  2K4D A;  3U5O A;  2YU4 A;  5B79 A;  3T9K A;  3U5P A;  2YQM A;  3EB5 A;  2ECW A;  2VNF A;  2BAY A;  2AN6 A;  3HCS A;  4GND A;  3ZTG A;  4FK5 A;  1LDK C;  5KH7 A;  5TDR A;  4WZ2 A;  3SOW A;  1WEM A;  2YSJ A;  2KR4 A;  3SOX A;  2EOD A;  1WEP A;  3DDT A;  4YAX A;  3QZV A;  2E61 A;  4WA6 A;  2RI7 A;  4YBT A;  4CCG X;  2YUC A;  2JMJ A;  2K16 A;  5B8D A;  2ECI A;  5FER A;  1WFK A;  2C2V S;  1XWH A;  2CRW A; 
#chains in the Genus database with same CATH homology
 3M63 A;  2YW8 A;  3LQJ A;  3RPG B;  1CHC A;  2ECT A;  2QIC A;  3N9N A;  2L0B A;  2I50 A;  4AVX A;  5B77 A;  1WEW A;  4Q6F A;  3PHD A;  1WEQ A;  3T7L A;  4UI9 B;  2YYR A;  2G45 A;  2FUU A;  2YQL A;  4AP4 A;  1F62 A;  3N9P A;  4L7X A;  5B76 A;  4I7B A;  2NAA A;  4LK9 A;  1JOC A;  2KWO A;  5D1L B;  4LAD B;  2F6N A;  5FEY A;  4TKP B;  4UP5 A;  5G05 B;  3O7A A;  5TAB A;  2YT5 A;  1K2F A;  2UZG A;  2M6M A;  5H1U A;  3EB6 A;  2VJE A;  2YHO A;  3L1X A;  3GV4 A;  4S3O C;  1WIL A;  2XEU A;  2M85 A;  3DQV R;  2DX8 A;  2KE1 A;  4N3W A;  2MA6 A;  2QJ0 A;  1WE9 A;  3KQI A;  4LJN A;  5LKU A;  2D8S A;  5EYA F;  5B78 A;  2FSA A;  3U5M A;  5AIT A;  2KWK A;  4A4B A;  4NN2 A;  2VPD A;  3O36 A;  2RSD A;  3L1Z B;  2KYU A;  2EGP A;  3O33 A;  4LKA A;  5FB0 A;  4R8P K;  2M3H A;  2FUI A;  2YRE A;  5G04 B;  1U6G B;  3PUR A;  4AUQ B;  3C5K A;  3U5N A;  5JG6 A;  4YC9 A;  2XB1 A;  4WZ3 B;  4V3K C;  4F52 B;  4A4C A;  3N9O A;  4AYC A;  2CSZ A;  2CKL A;  3NG2 A;  3KNV A;  2Y1N A;  2LGG A;  1T1H A;  1WEE A;  1WEV A;  4ZQL A;  3N9L A;  4B86 C;  5AIU A;  1X4U A;  2LGL A;  2LDR A;  3HCT A;  3KV6 A;  1JM7 A;  1DVP A;  2YSM A;  2KWJ A;  2G6Q A;  4YAB A;  2KFT A;  1ZBD B;  4I7C A;  5FB1 A;  3N9M A;  4IC3 A;  5DKA A;  2LV9 A;  1X4J A;  5KH3 A;  2ECG A;  2VJF A;  4UP0 A;  2QIZ A;  1E4U A;  4YAD A;  3O70 A;  5H9M A;  1WGM A;  4ZDT A;  5LKZ A;  4GNF A;  3O34 A;  5G0F A;  4N4F A;  1X4I A;  3MHS A;  2CSY A;  2L5U A;  3ZVZ B;  2LRI C;  1VD4 A;  1WIM A;  4O64 A;  2MT5 A;  1HYI A;  4R7E A;  1WES A;  2KU3 A;  4GB0 A;  2Y1M A;  4BBQ A;  3M99 A;  2LQ6 A;  2ECJ A;  2EA6 A;  2JMI A;  1VYX A;  2PUY A;  2VPE A;  2VJE B;  2VPB A;  5J3X A;  2LGV A;  3LQI A;  4QF2 A;  3ZPV E;  3V43 A;  2YUR A;  4FJC A;  4S3O B;  3IHP A;  2F42 A;  2H0D A;  2L43 A;  4PTB A;  3LQH A;  1G25 A;  2Y43 A;  4MSX A;  4MVT A;  5H1V A;  4W4U A;  3T6R A;  2KRE A;  4P5O B;  3HTK C;  3KV5 A;  4GNG A;  2KIZ A;  2VP7 A;  2LGK A;  4V3L C;  5TDW A;  5H1T A;  2ECV A;  2M1R A;  5KH9 A;  1FBV A;  4GNE A;  2YHN A;  2MNZ A;  1IYM A;  5D1M B;  5LKT A;  5C13 A;  3M62 A;  3N9Q A;  2MIQ A;  3SHB A;  2ECN A;  4A0C D;  2LXP C;  3I2D A;  1LDJ B;  1HYJ A;  2JRJ A;  4PPE A;  1VFY A;  3ZYQ A;  2G43 A;  1WEN A;  4B7Y C;  4AYC B;  3RPG C;  1MM3 A;  2CKL B;  5TBN A;  2E6S A;  3GL6 A;  4FIP A;  2MNY A;  4FO9 A;  4ZUX U;  3HCU A;  2PNX A;  3O35 A;  1Z60 A;  2KGG A;  4QF3 A;  1JM7 B;  2MUM A;  2E6R A;  4C9Z A;  4YAT A;  5I3L A;  1V87 A;  3SOU A;  1FP0 A;  2K17 A;  2VPG A;  5D1K B;  2MD8 C;  5C11 A;  2VJF B;  3ASL A;  4I7D A;  4IC2 A;  3FL2 A;  4YBS A;  2L75 A;  2IDA A;  3L11 A;  3VK6 A;  3DPL R;  2F6J A;  1RMD A;  5B75 A;  4BHW A;  2OXQ C;  3RTR B;  2HDP A;  4WZ0 A;  2L80 A;  2ZET C;  3C6W A;  5DIN A;  3ZNI A;  5TRB A;  1MM2 A;  3ZPV 1;  4CA1 A;  3ZVY A;  4A49 A;  2KWN A;  1N87 A;  2HYE D;  2K1J A;  3O37 A;  4L58 A;  2JMD A;  4X3G A;  5LKX A;  2CT2 A;  2LXH C;  4R2Y A;  2KGI A;  2LN0 A;  1WEU A;  3PUQ A;  2H0D B;  2C2L A;  1Z6U A;  1WEO A;  4XI1 A;  4LLB A;  3MHH A;  4YBM A;  2MD7 B;  1Z2Q A;  2MA5 A;  1BOR A;  3LRQ A;  2K4D A;  3U5O A;  2YU4 A;  5B79 A;  3U5P A;  2YQM A;  3EB5 A;  2ECW A;  2VNF A;  2BAY A;  2AN6 A;  3HCS A;  4GND A;  3ZTG A;  4FK5 A;  1LDK C;  5KH7 A;  5TDR A;  4WZ2 A;  3SOW A;  1WEM A;  2YSJ A;  2KR4 A;  3SOX A;  2EOD A;  1WEP A;  4YAX A;  3QZV A;  4WA6 A;  2RI7 A;  4YBT A;  4CCG X;  2YUC A;  2JMJ A;  2K16 A;  5B8D A;  2ECI A;  5FER A;  1WFK A;  2C2V S;  1XWH A;  5LCW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...