2EA6A

Solution structure of the ring domain of the human ring finger protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
GSSGSSGTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RING finger protein 4
publication title Solution Structure of the RING domain of the human ring finger protein 4
rcsb
source organism Homo sapiens
total genus 6
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ea6A01
5G04B 4YBMA 2LRIC 3FL2A 1Z2QA 2L0BA 5KH3A 2OXQC 5D1LB 1WESA 2LXPC 1X4UA 1WEQA 2PNXA 4N4FA 4O64A 4P5OB 2F6JA 3RTRB 3KV6A 2YT5A 4GB0A 4B7YC 4WA6A 1Z6UA 4S3OB 1VFYA 4WZ0A 5DKAA 2MNYA 5I3LA 4MVTA 4GNDA 4YBSA 2LGKA 2KR4A 2JMJA 2KFTA 2YYRA 2K1JA 4AYCB 2KWOA 4NN2A 3N9MA 1ZBDB 2FUUA 1K2FA 2I50A 3O37A 2MD8C 5D1MB 5H1TA 2K16A 2YREA 3LQJA 2ZETC 3ZYQA 2PUYA 3SHBA 2EGPA 4TKPB 3L1XA 5TABA 1WENA 2QIZA 3MHHA 3U5PA 4PTBA 2F6NA 4YATA 5JG6A 2E6RA 3ZVZB 3KNVA 2CKLA 3N9PA 5B75A 5B77A 1WIMA 3L1ZB 4A4BA 2KGGA 2Y43A 5H9MA 1XWHA 2MNZA 2EA6A 1MM3A 2CSZA 4N3WA 4CA1A 2VPEA 2LGGA 3C6WA 3M62A 1JOCA 4A49A 2QICA 2F42A 3U5OA 2L43A 5FEYA 5C11A 2ECNA 3T6RA 5AIUA 3U5NA 4V3KC 2LGLA 2YQMA 5D1KB 3U5MA 2KGIA 2VPDA 2CKLB 3SOWA 1X4JA 1WEMA 1LDKC 4QF2A 4R8PK 5LKXA 5KH7A 2JMDA 4GNEA 3C5KA 2LN0A 1WGMA 3KQIA 4GNGA 3LQHA 1F62A 1JM7B 2M1RA 3QZVA 2XEUA 1LDJB 2MA5A 2RI7A 3HCTA 1N87A 4S3OC 3O7AA 1X4IA 4GNFA 3T7LA 2M85A 4LKAA 3PUQA 4FIPA 2LV9A 4A4CA 3LQIA 4I7DA 1FBVA 2ECGA 1V87A 2YHNA 5TRBA 3N9NA 2KYUA 3NG2A 2LQ6A 3ZNIA 2LXHC 4CCGX 3V43A 2H0DA 4IC3A 2G43A 2KU3A 3HCSA 3O70A 1BORA 2JRJA 1U6GB 4R2YA 1VYXA 2CT2A 2ECTA 5H1UA 2LGVA 3IHPA 3N9LA 1WEUA 2BAYA 3ZTGA 4LADB 2KE1A 2M3HA 3I2DA 1WE9A 5EYAF 2C2LA 4ZDTA 2VJFB 3MHSA 4Q6FA 1HYIA 5FB1A 4AVXA 4V3LC 5B8DA 2XB1A 3O33A 3PURA 2YURA 2CSYA 2VNFA 3ASLA 3ZPVE 2H0DB 1T1HA 3LRQA 5B76A 5LKZA 2MA6A 3M63A 3M99A 2JMIA 2VJEB 2D8SA 1FP0A 2EODA 1JM7A 2ECWA 4PPEA 1HYJA 5LKTA 4WZ2A 2UZGA 2Y1MA 1VD4A 2ECJA 1WEVA 2MUMA 2MIQA 4LJNA 4W4UA 2Y1NA 3KV5A 2K17A 2FSAA 2IDAA 3L11A 2YSMA 4L58A 3GV4A 2MT5A 1CHCA 4A0CD 4YABA 3O36A 4BBQA 5KH9A 1DVPA 5J3XA 2YHOA 4WZ3B 3O34A 4BHWA 4UP5A 2G6QA 2KWKA 2RSDA 2ECVA 2ECIA 4ZQLA 2VJFA 4UI9B 3VK6A 5FERA 1G25A 1WILA 2YQLA 5H1VA 4FJCA 5G05B 1IYMA 3DQVR 3SOXA 3ZPV1 4I7CA 2LDRA 2QJ0A 4YC9A 2VJEA 4YAXA 3ZVYA 2KIZA 3RPGC 4AUQB 2HDPA 2KWJA 3HCUA 2L5UA 3RPGB 1Z60A 1WEWA 3N9OA 4UP0A 4L7XA 2YU4A 2L75A 3HTKC 5AITA 5TBNA 4LLBA 2DX8A 2VPBA 2K4DA 5LKUA 2VP7A 1WEEA 1WEPA 2M6MA 2KWNA 1MM2A 5B79A 2KREA 5FB0A 3EB6A 1WEOA 4YADA 3GL6A 5C13A 2L80A 4AP4A 4B86C 3N9QA 1RMDA 5G0FA 5TDRA 4FK5A 4LK9A 5TDWA 5B78A 4QF3A 1WFKA 4YBTA 2MD7B 1E4UA 4C9ZA 4ZUXU 3DPLR 2VPGA 2YSJA 3EB5A 4F52B 4R7EA 3O35A 2HYED 4XI1A 2AN6A 2YUCA 4I7BA 4MSXA 4X3GA 3PHDA 2C2VS 2YW8A 4FO9A 5LCWB 2G45A 2E6SA 3SOUA 2NAAA 5DINA 4AYCA 4IC2A 2FUIA
chains in the Genus database with same CATH superfamily
5G04B 4YBMA 2LRIC 3FL2A 1Z2QA 2L0BA 5KH3A 2OXQC 5D1LB 1WESA 2CRWA 2LXPC 1X4UA 1WEQA 2PNXA 3LVQE 4N4FA 4O64A 4P5OB 2F6JA 3RTRB 3KV6A 2P57A 2YT5A 4GB0A 4B7YC 4WA6A 1Z6UA 4S3OB 1VFYA 4WZ0A 5DKAA 2MNYA 3PLWA 5I3LA 4MVTA 4GNDA 2FFWA 3DWDA 4YBSA 2LGKA 2KR4A 2JMJA 2KFTA 2YYRA 2K1JA 2IQJA 4AYCB 2KWOA 4NN2A 3N9MA 1ZBDB 2FUUA 1K2FA 2I50A 3O37A 2MD8C 5D1MB 2B0OE 5H1TA 2K16A 2YREA 3LQJA 2ZETC 3ZYQA 2PUYA 3SHBA 2EGPA 4TKPB 3L1XA 5TABA 1WENA 2QIZA 2MKEA 3MHHA 3U5PA 4PTBA 2F6NA 4YATA 5JG6A 2E6RA 3ZVZB 3KNVA 2CKLA 3N9PA 3M7KA 5B75A 5B77A 1WIMA 3L1ZB 4A4BA 2KGGA 2Y43A 5H9MA 1XWHA 2MNZA 2E61A 2EA6A 1MM3A 2CSZA 4N3WA 4CA1A 2VPEA 2LGGA 3C6WA 3M62A 1JOCA 4A49A 2QICA 2XP0A 2F42A 3U5OA 2L43A 5FEYA 5C11A 2ECNA 3T6RA 5AIUA 3U5NA 4V3KC 2LGLA 2YQMA 5D1KB 3U5MA 2KGIA 2VPDA 2CKLB 3SOWA 1X4JA 3LJUX 1WEMA 1LDKC 4QF2A 4R8PK 3SUBA 5SVIB 5LKXA 5KH7A 2JMDA 4GNEA 3C5KA 2LN0A 1WGMA 3KQIA 1DCQA 4GNGA 3LQHA 1F62A 1JM7B 2M1RA 3QZVA 2XEUA 1LDJB 2MA5A 2RI7A 3HCTA 1N87A 3O47A 4S3OC 3O7AA 1X4IA 4GNFA 3T7LA 2M85A 4LKAA 4QQ4A 3PUQA 3FJUB 4FIPA 3MDBC 2KKXA 2LV9A 4A4CA 3LQIA 2FD4A 4I7DA 1FBVA 2ECGA 2YVRA 1V87A 2YHNA 5TRBA 3N9NA 2KYUA 3FEHA 5K3QA 3NG2A 4F1PA 2LQ6A 4OGCA 2LXHC 3ZNIA 4CCGX 3V43A 2H0DA 4IC3A 2G43A 2KU3A 3HCSA 3O70A 1BORA 2JRJA 1U6GB 4R2YA 1VYXA 2CT2A 2ECTA 5H1UA 2LGVA 3IHPA 3N9LA 1WEUA 2BAYA 3LVRE 3ZTGA 4LADB 2KE1A 2M3HA 2DSMA 3I2DA 2OWAA 1WE9A 5EYAF 2C2LA 4ZDTA 2VJFB 3MHSA 4Q6FA 1HYIA 3T9KA 5FB1A 3Q1DA 4AVXA 2JM3A 2DJAA 4V3LC 4Z0RA 5B8DA 2XB1A 3O33A 3PURA 2YURA 2CSYA 2VNFA 5SVIA 3H7HA 2RR4A 3ASLA 3ZPVE 2H0DB 1T1HA 3LRQA 5B76A 5LKZA 2MA6A 3M63A 3M99A 2JMIA 2VJEB 2EGMA 2XOYA 2D8SA 1FP0A 2EODA 1JM7A 2ECWA 4PPEA 1HYJA 5LKTA 2LAUA 4WZ2A 2UZGA 2Y1MA 1VD4A 1WEVA 2ECJA 2MUMA 2MIQA 4LJNA 2L7PA 4W4UA 4O62A 2Y1NA 3KV5A 2K17A 4Z0OA 2FSAA 2IDAA 3L11A 2YSMA 4L58A 3GV4A 2MT5A 1CHCA 4A0CD 4YABA 3O36A 4BBQA 2JUNA 5KH9A 1DVPA 5J3XA 2YHOA 4WZ3B 3O34A 4BHWA 4UP5A 2G6QA 2KWKA 2RSDA 2ECVA 2ECIA 4ZQLA 2VJFA 4UI9B 3VK6A 5FERA 1G25A 1WILA 2YQLA 5H1VA 2D8UA 4FJCA 5G05B 1IYMA 3DQVR 3SOXA 3ZPV1 4I7CA 2LDRA 2QJ0A 4YC9A 2VJEA 4YAXA 3ZVYA 2KIZA 3RPGC 4AUQB 2HDPA 2CRRA 2KWJA 4OGEA 3HCUA 2L5UA 3RPGB 1Z60A 2KKYA 3E2DA 1WEWA 3N9OA 4UP0A 4L7XA 2YU4A 2L75A 3HTKC 5AITA 2XOCA 5TBNA 3FM8C 4LLBA 2DX8A 2VPBA 4H9DA 2K4DA 5LKUA 2VP7A 3LDYA 1WEEA 1WEPA 2M6MA 2KWNA 1MM2A 5B79A 2KREA 5FB0A 3EB6A 1WEOA 4YADA 2CONA 3GL6A 5C13A 5SVXA 2EXUA 2L80A 2XOZA 3DDTA 4AP4A 4B86C 3N9QA 1RMDA 5G0FA 2M13A 5TDRA 4FK5A 4LK9A 5TDWA 5B78A 4QF3A 3KDEC 1WFKA 3FAOA 4YBTA 2MD7B 1E4UA 1MBMA 4C9ZA 3FANA 4ZUXU 3DPLR 2VPGA 2YSJA 3EB5A 4F52B 3JUEA 4R7EA 3O35A 2HYED 4XI1A 2AN6A 2YUCA 4I7BA 4MSXA 4X3GA 3PHDA 2C2VS 2YW8A 4FO9A 5SVYA 5LCWB 2G45A 2E6SA 3SOUA 2NAAA 5DINA 4AYCA 4IC2A 2CSVA 2FUIA
chains in the Genus database with same CATH topology
5G04B 4YBMA 2LRIC 3FL2A 1Z2QA 2L0BA 5KH3A 2OXQC 5D1LB 1WESA 2LXPC 1X4UA 1WEQA 2PNXA 4N4FA 4O64A 4P5OB 2F6JA 3RTRB 3KV6A 2YT5A 4GB0A 4B7YC 4WA6A 1Z6UA 4S3OB 1VFYA 4WZ0A 5DKAA 2MNYA 5I3LA 4MVTA 4GNDA 4YBSA 2LGKA 2KR4A 2JMJA 2KFTA 2YYRA 2K1JA 4AYCB 2KWOA 4NN2A 3N9MA 1ZBDB 2FUUA 1K2FA 2I50A 3O37A 2MD8C 5D1MB 5H1TA 2K16A 2YREA 3LQJA 2ZETC 3ZYQA 2PUYA 3SHBA 2EGPA 4TKPB 3L1XA 5TABA 1WENA 2QIZA 3MHHA 3U5PA 4PTBA 2F6NA 4YATA 5JG6A 2E6RA 3ZVZB 3KNVA 2CKLA 3N9PA 5B75A 5B77A 1WIMA 3L1ZB 4A4BA 2KGGA 2Y43A 5H9MA 1XWHA 2MNZA 2EA6A 1MM3A 2CSZA 4N3WA 4CA1A 2VPEA 2LGGA 3C6WA 3M62A 1JOCA 4A49A 2QICA 2F42A 3U5OA 2L43A 5FEYA 5C11A 2ECNA 3T6RA 5AIUA 3U5NA 4V3KC 2LGLA 2YQMA 5D1KB 3U5MA 2KGIA 2VPDA 2CKLB 3SOWA 1X4JA 1WEMA 1LDKC 4QF2A 4R8PK 5LKXA 5KH7A 2JMDA 4GNEA 3C5KA 2LN0A 1WGMA 3KQIA 4GNGA 3LQHA 1F62A 1JM7B 2M1RA 3QZVA 2XEUA 1LDJB 2MA5A 2RI7A 3HCTA 1N87A 4S3OC 3O7AA 1X4IA 4GNFA 3T7LA 2M85A 4LKAA 3PUQA 4FIPA 2LV9A 4A4CA 3LQIA 4I7DA 1FBVA 2ECGA 1V87A 2YHNA 5TRBA 3N9NA 2KYUA 3NG2A 2LQ6A 3ZNIA 2LXHC 4CCGX 3V43A 2H0DA 4IC3A 2G43A 2KU3A 3HCSA 3O70A 1BORA 2JRJA 1U6GB 4R2YA 1VYXA 2CT2A 2ECTA 5H1UA 2LGVA 3IHPA 3N9LA 1WEUA 2BAYA 3ZTGA 4LADB 2KE1A 2M3HA 3I2DA 1WE9A 5EYAF 2C2LA 4ZDTA 2VJFB 3MHSA 4Q6FA 1HYIA 5FB1A 4AVXA 4V3LC 5B8DA 2XB1A 3O33A 3PURA 2YURA 2CSYA 2VNFA 3ASLA 3ZPVE 2H0DB 1T1HA 3LRQA 5B76A 5LKZA 2MA6A 3M63A 3M99A 2JMIA 2VJEB 2D8SA 1FP0A 2EODA 1JM7A 2ECWA 4PPEA 1HYJA 5LKTA 4WZ2A 2UZGA 2Y1MA 1VD4A 2ECJA 1WEVA 2MUMA 2MIQA 4LJNA 4W4UA 2Y1NA 3KV5A 2K17A 2FSAA 2IDAA 3L11A 2YSMA 4L58A 3GV4A 2MT5A 1CHCA 4A0CD 4YABA 3O36A 4BBQA 5KH9A 1DVPA 5J3XA 2YHOA 4WZ3B 3O34A 4BHWA 4UP5A 2G6QA 2KWKA 2RSDA 2ECVA 2ECIA 4ZQLA 2VJFA 4UI9B 3VK6A 5FERA 1G25A 1WILA 2YQLA 5H1VA 4FJCA 5G05B 1IYMA 3DQVR 3SOXA 3ZPV1 4I7CA 2LDRA 2QJ0A 4YC9A 2VJEA 4YAXA 3ZVYA 2KIZA 3RPGC 4AUQB 2HDPA 2KWJA 3HCUA 2L5UA 3RPGB 1Z60A 1WEWA 3N9OA 4UP0A 4L7XA 2YU4A 2L75A 3HTKC 5AITA 5TBNA 4LLBA 2DX8A 2VPBA 2K4DA 5LKUA 2VP7A 1WEEA 1WEPA 2M6MA 2KWNA 1MM2A 5B79A 2KREA 5FB0A 3EB6A 1WEOA 4YADA 3GL6A 5C13A 2L80A 4AP4A 4B86C 3N9QA 1RMDA 5G0FA 5TDRA 4FK5A 4LK9A 5TDWA 5B78A 4QF3A 1WFKA 4YBTA 2MD7B 1E4UA 4C9ZA 4ZUXU 3DPLR 2VPGA 2YSJA 3EB5A 4F52B 4R7EA 3O35A 2HYED 4XI1A 2AN6A 2YUCA 4I7BA 4MSXA 4X3GA 3PHDA 2C2VS 2YW8A 4FO9A 5LCWB 2G45A 2E6SA 3SOUA 2NAAA 5DINA 4AYCA 4IC2A 2FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G04 B;  4YBM A;  2LRI C;  3FL2 A;  1Z2Q A;  2L0B A;  5KH3 A;  2OXQ C;  5D1L B;  1WES A;  2LXP C;  1X4U A;  1WEQ A;  2PNX A;  4N4F A;  4O64 A;  4P5O B;  2F6J A;  3RTR B;  3KV6 A;  2YT5 A;  4GB0 A;  4B7Y C;  4WA6 A;  1Z6U A;  4S3O B;  1VFY A;  4WZ0 A;  5DKA A;  2MNY A;  5I3L A;  4MVT A;  4GND A;  4YBS A;  2LGK A;  2KR4 A;  2JMJ A;  2KFT A;  2YYR A;  2K1J A;  4AYC B;  2KWO A;  4NN2 A;  3N9M A;  1ZBD B;  2FUU A;  1K2F A;  2I50 A;  3O37 A;  2MD8 C;  5D1M B;  5H1T A;  2K16 A;  2YRE A;  3LQJ A;  2ZET C;  3ZYQ A;  2PUY A;  3SHB A;  2EGP A;  4TKP B;  3L1X A;  5TAB A;  1WEN A;  2QIZ A;  3MHH A;  3U5P A;  4PTB A;  2F6N A;  4YAT A;  5JG6 A;  2E6R A;  3ZVZ B;  3KNV A;  2CKL A;  3N9P A;  5B75 A;  5B77 A;  1WIM A;  3L1Z B;  4A4B A;  2KGG A;  2Y43 A;  5H9M A;  1XWH A;  2MNZ A;  2EA6 A;  1MM3 A;  2CSZ A;  4N3W A;  4CA1 A;  2VPE A;  2LGG A;  3C6W A;  3M62 A;  1JOC A;  4A49 A;  2QIC A;  2F42 A;  3U5O A;  2L43 A;  5FEY A;  5C11 A;  2ECN A;  3T6R A;  5AIU A;  3U5N A;  4V3K C;  2LGL A;  2YQM A;  5D1K B;  3U5M A;  2KGI A;  2VPD A;  2CKL B;  3SOW A;  1X4J A;  1WEM A;  1LDK C;  4QF2 A;  4R8P K;  5LKX A;  5KH7 A;  2JMD A;  4GNE A;  3C5K A;  2LN0 A;  1WGM A;  3KQI A;  4GNG A;  3LQH A;  1F62 A;  1JM7 B;  2M1R A;  3QZV A;  2XEU A;  1LDJ B;  2MA5 A;  2RI7 A;  3HCT A;  1N87 A;  4S3O C;  3O7A A;  1X4I A;  4GNF A;  3T7L A;  2M85 A;  4LKA A;  3PUQ A;  4FIP A;  2LV9 A;  4A4C A;  3LQI A;  4I7D A;  1FBV A;  2ECG A;  1V87 A;  2YHN A;  5TRB A;  3N9N A;  2KYU A;  3NG2 A;  2LQ6 A;  3ZNI A;  2LXH C;  4CCG X;  3V43 A;  2H0D A;  4IC3 A;  2G43 A;  2KU3 A;  3HCS A;  3O70 A;  1BOR A;  2JRJ A;  1U6G B;  4R2Y A;  1VYX A;  2CT2 A;  2ECT A;  5H1U A;  2LGV A;  3IHP A;  3N9L A;  1WEU A;  2BAY A;  3ZTG A;  4LAD B;  2KE1 A;  2M3H A;  3I2D A;  1WE9 A;  5EYA F;  2C2L A;  4ZDT A;  2VJF B;  3MHS A;  4Q6F A;  1HYI A;  5FB1 A;  4AVX A;  4V3L C;  5B8D A;  2XB1 A;  3O33 A;  3PUR A;  2YUR A;  2CSY A;  2VNF A;  3ASL A;  3ZPV E;  2H0D B;  1T1H A;  3LRQ A;  5B76 A;  5LKZ A;  2MA6 A;  3M63 A;  3M99 A;  2JMI A;  2VJE B;  2D8S A;  1FP0 A;  2EOD A;  1JM7 A;  2ECW A;  4PPE A;  1HYJ A;  5LKT A;  4WZ2 A;  2UZG A;  2Y1M A;  1VD4 A;  2ECJ A;  1WEV A;  2MUM A;  2MIQ A;  4LJN A;  4W4U A;  2Y1N A;  3KV5 A;  2K17 A;  2FSA A;  2IDA A;  3L11 A;  2YSM A;  4L58 A;  3GV4 A;  2MT5 A;  1CHC A;  4A0C D;  4YAB A;  3O36 A;  4BBQ A;  5KH9 A;  1DVP A;  5J3X A;  2YHO A;  4WZ3 B;  3O34 A;  4BHW A;  4UP5 A;  2G6Q A;  2KWK A;  2RSD A;  2ECV A;  2ECI A;  4ZQL A;  2VJF A;  4UI9 B;  3VK6 A;  5FER A;  1G25 A;  1WIL A;  2YQL A;  5H1V A;  4FJC A;  5G05 B;  1IYM A;  3DQV R;  3SOX A;  3ZPV 1;  4I7C A;  2LDR A;  2QJ0 A;  4YC9 A;  2VJE A;  4YAX A;  3ZVY A;  2KIZ A;  3RPG C;  4AUQ B;  2HDP A;  2KWJ A;  3HCU A;  2L5U A;  3RPG B;  1Z60 A;  1WEW A;  3N9O A;  4UP0 A;  4L7X A;  2YU4 A;  2L75 A;  3HTK C;  5AIT A;  5TBN A;  4LLB A;  2DX8 A;  2VPB A;  2K4D A;  5LKU A;  2VP7 A;  1WEE A;  1WEP A;  2M6M A;  2KWN A;  1MM2 A;  5B79 A;  2KRE A;  5FB0 A;  3EB6 A;  1WEO A;  4YAD A;  3GL6 A;  5C13 A;  2L80 A;  4AP4 A;  4B86 C;  3N9Q A;  1RMD A;  5G0F A;  5TDR A;  4FK5 A;  4LK9 A;  5TDW A;  5B78 A;  4QF3 A;  1WFK A;  4YBT A;  2MD7 B;  1E4U A;  4C9Z A;  4ZUX U;  3DPL R;  2VPG A;  2YSJ A;  3EB5 A;  4F52 B;  4R7E A;  3O35 A;  2HYE D;  4XI1 A;  2AN6 A;  2YUC A;  4I7B A;  4MSX A;  4X3G A;  3PHD A;  2C2V S;  2YW8 A;  4FO9 A;  5LCW B;  2G45 A;  2E6S A;  3SOU A;  2NAA A;  5DIN A;  4AYC A;  4IC2 A;  2FUI A; 
#chains in the Genus database with same CATH topology
 5G04 B;  4YBM A;  2LRI C;  3FL2 A;  1Z2Q A;  2L0B A;  5KH3 A;  2OXQ C;  5D1L B;  1WES A;  2CRW A;  2LXP C;  1X4U A;  1WEQ A;  2PNX A;  3LVQ E;  4N4F A;  4O64 A;  4P5O B;  2F6J A;  3RTR B;  3KV6 A;  2P57 A;  2YT5 A;  4GB0 A;  4B7Y C;  4WA6 A;  1Z6U A;  4S3O B;  1VFY A;  4WZ0 A;  5DKA A;  2MNY A;  3PLW A;  5I3L A;  4MVT A;  4GND A;  2FFW A;  3DWD A;  4YBS A;  2LGK A;  2KR4 A;  2JMJ A;  2KFT A;  2YYR A;  2K1J A;  2IQJ A;  4AYC B;  2KWO A;  4NN2 A;  3N9M A;  1ZBD B;  2FUU A;  1K2F A;  2I50 A;  3O37 A;  2MD8 C;  5D1M B;  2B0O E;  5H1T A;  2K16 A;  2YRE A;  3LQJ A;  2ZET C;  3ZYQ A;  2PUY A;  3SHB A;  2EGP A;  4TKP B;  3L1X A;  5TAB A;  1WEN A;  2QIZ A;  2MKE A;  3MHH A;  3U5P A;  4PTB A;  2F6N A;  4YAT A;  5JG6 A;  2E6R A;  3ZVZ B;  3KNV A;  2CKL A;  3N9P A;  3M7K A;  5B75 A;  5B77 A;  1WIM A;  3L1Z B;  4A4B A;  2KGG A;  2Y43 A;  5H9M A;  1XWH A;  2MNZ A;  2E61 A;  2EA6 A;  1MM3 A;  2CSZ A;  4N3W A;  4CA1 A;  2VPE A;  2LGG A;  3C6W A;  3M62 A;  1JOC A;  4A49 A;  2QIC A;  2XP0 A;  2F42 A;  3U5O A;  2L43 A;  5FEY A;  5C11 A;  2ECN A;  3T6R A;  5AIU A;  3U5N A;  4V3K C;  2LGL A;  2YQM A;  5D1K B;  3U5M A;  2KGI A;  2VPD A;  2CKL B;  3SOW A;  1X4J A;  3LJU X;  1WEM A;  1LDK C;  4QF2 A;  4R8P K;  3SUB A;  5SVI B;  5LKX A;  5KH7 A;  2JMD A;  4GNE A;  3C5K A;  2LN0 A;  1WGM A;  3KQI A;  1DCQ A;  4GNG A;  3LQH A;  1F62 A;  1JM7 B;  2M1R A;  3QZV A;  2XEU A;  1LDJ B;  2MA5 A;  2RI7 A;  3HCT A;  1N87 A;  3O47 A;  4S3O C;  3O7A A;  1X4I A;  4GNF A;  3T7L A;  2M85 A;  4LKA A;  4QQ4 A;  3PUQ A;  3FJU B;  4FIP A;  3MDB C;  2KKX A;  2LV9 A;  4A4C A;  3LQI A;  2FD4 A;  4I7D A;  1FBV A;  2ECG A;  2YVR A;  1V87 A;  2YHN A;  5TRB A;  3N9N A;  2KYU A;  3FEH A;  5K3Q A;  3NG2 A;  4F1P A;  2LQ6 A;  4OGC A;  2LXH C;  3ZNI A;  4CCG X;  3V43 A;  2H0D A;  4IC3 A;  2G43 A;  2KU3 A;  3HCS A;  3O70 A;  1BOR A;  2JRJ A;  1U6G B;  4R2Y A;  1VYX A;  2CT2 A;  2ECT A;  5H1U A;  2LGV A;  3IHP A;  3N9L A;  1WEU A;  2BAY A;  3LVR E;  3ZTG A;  4LAD B;  2KE1 A;  2M3H A;  2DSM A;  3I2D A;  2OWA A;  1WE9 A;  5EYA F;  2C2L A;  4ZDT A;  2VJF B;  3MHS A;  4Q6F A;  1HYI A;  3T9K A;  5FB1 A;  3Q1D A;  4AVX A;  2JM3 A;  2DJA A;  4V3L C;  4Z0R A;  5B8D A;  2XB1 A;  3O33 A;  3PUR A;  2YUR A;  2CSY A;  2VNF A;  5SVI A;  3H7H A;  2RR4 A;  3ASL A;  3ZPV E;  2H0D B;  1T1H A;  3LRQ A;  5B76 A;  5LKZ A;  2MA6 A;  3M63 A;  3M99 A;  2JMI A;  2VJE B;  2EGM A;  2XOY A;  2D8S A;  1FP0 A;  2EOD A;  1JM7 A;  2ECW A;  4PPE A;  1HYJ A;  5LKT A;  2LAU A;  4WZ2 A;  2UZG A;  2Y1M A;  1VD4 A;  1WEV A;  2ECJ A;  2MUM A;  2MIQ A;  4LJN A;  2L7P A;  4W4U A;  4O62 A;  2Y1N A;  3KV5 A;  2K17 A;  4Z0O A;  2FSA A;  2IDA A;  3L11 A;  2YSM A;  4L58 A;  3GV4 A;  2MT5 A;  1CHC A;  4A0C D;  4YAB A;  3O36 A;  4BBQ A;  2JUN A;  5KH9 A;  1DVP A;  5J3X A;  2YHO A;  4WZ3 B;  3O34 A;  4BHW A;  4UP5 A;  2G6Q A;  2KWK A;  2RSD A;  2ECV A;  2ECI A;  4ZQL A;  2VJF A;  4UI9 B;  3VK6 A;  5FER A;  1G25 A;  1WIL A;  2YQL A;  5H1V A;  2D8U A;  4FJC A;  5G05 B;  1IYM A;  3DQV R;  3SOX A;  3ZPV 1;  4I7C A;  2LDR A;  2QJ0 A;  4YC9 A;  2VJE A;  4YAX A;  3ZVY A;  2KIZ A;  3RPG C;  4AUQ B;  2HDP A;  2CRR A;  2KWJ A;  4OGE A;  3HCU A;  2L5U A;  3RPG B;  1Z60 A;  2KKY A;  3E2D A;  1WEW A;  3N9O A;  4UP0 A;  4L7X A;  2YU4 A;  2L75 A;  3HTK C;  5AIT A;  2XOC A;  5TBN A;  3FM8 C;  4LLB A;  2DX8 A;  2VPB A;  4H9D A;  2K4D A;  5LKU A;  2VP7 A;  3LDY A;  1WEE A;  1WEP A;  2M6M A;  2KWN A;  1MM2 A;  5B79 A;  2KRE A;  5FB0 A;  3EB6 A;  1WEO A;  4YAD A;  2CON A;  3GL6 A;  5C13 A;  5SVX A;  2EXU A;  2L80 A;  2XOZ A;  3DDT A;  4AP4 A;  4B86 C;  3N9Q A;  1RMD A;  5G0F A;  2M13 A;  5TDR A;  4FK5 A;  4LK9 A;  5TDW A;  5B78 A;  4QF3 A;  3KDE C;  1WFK A;  3FAO A;  4YBT A;  2MD7 B;  1E4U A;  1MBM A;  4C9Z A;  3FAN A;  4ZUX U;  3DPL R;  2VPG A;  2YSJ A;  3EB5 A;  4F52 B;  3JUE A;  4R7E A;  3O35 A;  2HYE D;  4XI1 A;  2AN6 A;  2YUC A;  4I7B A;  4MSX A;  4X3G A;  3PHD A;  2C2V S;  2YW8 A;  4FO9 A;  5SVY A;  5LCW B;  2G45 A;  2E6S A;  3SOU A;  2NAA A;  5DIN A;  4AYC A;  4IC2 A;  2CSV A;  2FUI A; 
#chains in the Genus database with same CATH homology
 5G04 B;  4YBM A;  2LRI C;  3FL2 A;  1Z2Q A;  2L0B A;  5KH3 A;  2OXQ C;  5D1L B;  1WES A;  2LXP C;  1X4U A;  1WEQ A;  2PNX A;  4N4F A;  4O64 A;  4P5O B;  2F6J A;  3RTR B;  3KV6 A;  2YT5 A;  4GB0 A;  4B7Y C;  4WA6 A;  1Z6U A;  4S3O B;  1VFY A;  4WZ0 A;  5DKA A;  2MNY A;  5I3L A;  4MVT A;  4GND A;  4YBS A;  2LGK A;  2KR4 A;  2JMJ A;  2KFT A;  2YYR A;  2K1J A;  4AYC B;  2KWO A;  4NN2 A;  3N9M A;  1ZBD B;  2FUU A;  1K2F A;  2I50 A;  3O37 A;  2MD8 C;  5D1M B;  5H1T A;  2K16 A;  2YRE A;  3LQJ A;  2ZET C;  3ZYQ A;  2PUY A;  3SHB A;  2EGP A;  4TKP B;  3L1X A;  5TAB A;  1WEN A;  2QIZ A;  3MHH A;  3U5P A;  4PTB A;  2F6N A;  4YAT A;  5JG6 A;  2E6R A;  3ZVZ B;  3KNV A;  2CKL A;  3N9P A;  5B75 A;  5B77 A;  1WIM A;  3L1Z B;  4A4B A;  2KGG A;  2Y43 A;  5H9M A;  1XWH A;  2MNZ A;  2EA6 A;  1MM3 A;  2CSZ A;  4N3W A;  4CA1 A;  2VPE A;  2LGG A;  3C6W A;  3M62 A;  1JOC A;  4A49 A;  2QIC A;  2F42 A;  3U5O A;  2L43 A;  5FEY A;  5C11 A;  2ECN A;  3T6R A;  5AIU A;  3U5N A;  4V3K C;  2LGL A;  2YQM A;  5D1K B;  3U5M A;  2KGI A;  2VPD A;  2CKL B;  3SOW A;  1X4J A;  1WEM A;  1LDK C;  4QF2 A;  4R8P K;  5LKX A;  5KH7 A;  2JMD A;  4GNE A;  3C5K A;  2LN0 A;  1WGM A;  3KQI A;  4GNG A;  3LQH A;  1F62 A;  1JM7 B;  2M1R A;  3QZV A;  2XEU A;  1LDJ B;  2MA5 A;  2RI7 A;  3HCT A;  1N87 A;  4S3O C;  3O7A A;  1X4I A;  4GNF A;  3T7L A;  2M85 A;  4LKA A;  3PUQ A;  4FIP A;  2LV9 A;  4A4C A;  3LQI A;  4I7D A;  1FBV A;  2ECG A;  1V87 A;  2YHN A;  5TRB A;  3N9N A;  2KYU A;  3NG2 A;  2LQ6 A;  3ZNI A;  2LXH C;  4CCG X;  3V43 A;  2H0D A;  4IC3 A;  2G43 A;  2KU3 A;  3HCS A;  3O70 A;  1BOR A;  2JRJ A;  1U6G B;  4R2Y A;  1VYX A;  2CT2 A;  2ECT A;  5H1U A;  2LGV A;  3IHP A;  3N9L A;  1WEU A;  2BAY A;  3ZTG A;  4LAD B;  2KE1 A;  2M3H A;  3I2D A;  1WE9 A;  5EYA F;  2C2L A;  4ZDT A;  2VJF B;  3MHS A;  4Q6F A;  1HYI A;  5FB1 A;  4AVX A;  4V3L C;  5B8D A;  2XB1 A;  3O33 A;  3PUR A;  2YUR A;  2CSY A;  2VNF A;  3ASL A;  3ZPV E;  2H0D B;  1T1H A;  3LRQ A;  5B76 A;  5LKZ A;  2MA6 A;  3M63 A;  3M99 A;  2JMI A;  2VJE B;  2D8S A;  1FP0 A;  2EOD A;  1JM7 A;  2ECW A;  4PPE A;  1HYJ A;  5LKT A;  4WZ2 A;  2UZG A;  2Y1M A;  1VD4 A;  2ECJ A;  1WEV A;  2MUM A;  2MIQ A;  4LJN A;  4W4U A;  2Y1N A;  3KV5 A;  2K17 A;  2FSA A;  2IDA A;  3L11 A;  2YSM A;  4L58 A;  3GV4 A;  2MT5 A;  1CHC A;  4A0C D;  4YAB A;  3O36 A;  4BBQ A;  5KH9 A;  1DVP A;  5J3X A;  2YHO A;  4WZ3 B;  3O34 A;  4BHW A;  4UP5 A;  2G6Q A;  2KWK A;  2RSD A;  2ECV A;  2ECI A;  4ZQL A;  2VJF A;  4UI9 B;  3VK6 A;  5FER A;  1G25 A;  1WIL A;  2YQL A;  5H1V A;  4FJC A;  5G05 B;  1IYM A;  3DQV R;  3SOX A;  3ZPV 1;  4I7C A;  2LDR A;  2QJ0 A;  4YC9 A;  2VJE A;  4YAX A;  3ZVY A;  2KIZ A;  3RPG C;  4AUQ B;  2HDP A;  2KWJ A;  3HCU A;  2L5U A;  3RPG B;  1Z60 A;  1WEW A;  3N9O A;  4UP0 A;  4L7X A;  2YU4 A;  2L75 A;  3HTK C;  5AIT A;  5TBN A;  4LLB A;  2DX8 A;  2VPB A;  2K4D A;  5LKU A;  2VP7 A;  1WEE A;  1WEP A;  2M6M A;  2KWN A;  1MM2 A;  5B79 A;  2KRE A;  5FB0 A;  3EB6 A;  1WEO A;  4YAD A;  3GL6 A;  5C13 A;  2L80 A;  4AP4 A;  4B86 C;  3N9Q A;  1RMD A;  5G0F A;  5TDR A;  4FK5 A;  4LK9 A;  5TDW A;  5B78 A;  4QF3 A;  1WFK A;  4YBT A;  2MD7 B;  1E4U A;  4C9Z A;  4ZUX U;  3DPL R;  2VPG A;  2YSJ A;  3EB5 A;  4F52 B;  4R7E A;  3O35 A;  2HYE D;  4XI1 A;  2AN6 A;  2YUC A;  4I7B A;  4MSX A;  4X3G A;  3PHD A;  2C2V S;  2YW8 A;  4FO9 A;  5LCW B;  2G45 A;  2E6S A;  3SOU A;  2NAA A;  5DIN A;  4AYC A;  4IC2 A;  2FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...