2EA6A

Solution structure of the ring domain of the human ring finger protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
GSSGSSGTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the RING domain of the human ring finger protein 4
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RING finger protein 4
total genus 6
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ea6A01
1E4UA 4ZUXU 5LKTA 2H0DA 1N87A 1CHCA 5H9MA 5AITA 2MIQA 2KWNA 2VJEA 3N9OA 1WFKA 4MSXA 1WENA 2KGIA 2MNZA 2YHNA 3NG2A 1MM2A 2EGPA 3L11A 2K16A 2LXPC 2IDAA 2MD7B 2K4DA 1WEEA 1WEUA 4L7XA 1ZBDB 4A49A 2YSJA 2CSYA 1VD4A 5H1VA 1X4JA 2OXQC 2MT5A 2ECTA 4YAXA 4GNDA 2YUCA 3T7LA 2VJFA 2LGGA 3FL2A 2HDPA 4WZ3B 3SHBA 2KWOA 1G25A 2YREA 5B75A 4PTBA 5LKZA 4F52B 3M63A 2C2LA 3C6WA 2C2VS 3O34A 5B78A 5H1TA 2YT5A 2MA6A 2L43A 3ZYQA 1X4UA 3O70A 4WZ2A 5I3LA 3ASLA 4BBQA 5C11A 5FB0A 1DVPA 1LDJB 1WEMA 4LJNA 4N4FA 2F42A 3DQVR 2KWKA 3ZVZB 4CCGX 2FUUA 4B7YC 5DINA 3M99A 3N9LA 2JMIA 4V3KC 4B86C 3IHPA 4YADA 2UZGA 3U5PA 4LKAA 3M62A 2F6NA 4MVTA 4A4CA 4P5OB 1WILA 5LCWB 3ZTGA 2CKLB 3O7AA 4Q6FA 2I50A 2YURA 3U5MA 4FK5A 2PUYA 3ZVYA 2L5UA 2LRIC 4AYCA 5G04B 2YW8A 4AVXA 2VJFB 2JMDA 4AUQB 2ECGA 3GL6A 2NAAA 5TABA 4YC9A 2DX8A 4FO9A 3N9MA 3ZNIA 3L1ZB 4CA1A 5J3XA 3KNVA 4I7CA 3L1XA 5D1KB 3I2DA 3O35A 5H1UA 4GNFA 3KQIA 4BHWA 2MNYA 3N9QA 4A4BA 3HCTA 3MHHA 3MHSA 2CT2A 2ECWA 4V3LC 2D8SA 1V87A 1WGMA 4NN2A 2E6SA 4LADB 2ECJA 1T1HA 5C13A 1IYMA 4AP4A 3ZPV1 5LKXA 5FB1A 3SOWA 2M85A 2MUMA 2L75A 2YYRA 4ZDTA 3VK6A 2XEUA 4X3GA 4A0CD 2FUIA 2LXHC 2YHOA 4TKPB 5JG6A 2AN6A 4XI1A 5B79A 2RSDA 2YU4A 1WEQA 2EODA 3SOUA 1JM7B 3DPLR 4IC2A 1HYIA 4GB0A 4YBSA 1BORA 3HCUA 3LQHA 3C5KA 5KH3A 2RI7A 5TDRA 2YSMA 2QIZA 4GNGA 1WEOA 2FSAA 1JOCA 2H0DB 5EYAF 2ECIA 3EB6A 4PPEA 2ECNA 5D1MB 1WESA 1JM7A 2JMJA 1WE9A 2ZETC 4WA6A 3V43A 2HYED 5FEYA 2KE1A 2JRJA 1U6GB 1F62A 3RPGB 2E6RA 4I7BA 1X4IA 5G05B 3N9PA 3O36A 4LLBA 1RMDA 4L58A 2LN0A 1HYJA 2Y1NA 5FERA 2CSZA 1Z6UA 4FJCA 5KH9A 4YABA 1K2FA 4AYCB 5B77A 1VFYA 1XWHA 4S3OC 4ZQLA 2KFTA 3U5NA 2G45A 2VP7A 2G6QA 2VPGA 2CKLA 5AIUA 2K1JA 3PHDA 2MD8C 2KYUA 3GV4A 1LDKC 2VNFA 3RTRB 2L0BA 2F6JA 5G0FA 1WEVA 5LKUA 3U5OA 5B8DA 2VJEB 2VPDA 4YBTA 3T6RA 2KREA 2K17A 1WEWA 4UP5A 5DKAA 3RPGC 1WIMA 2L80A 2YQMA 2YQLA 4YATA 4WZ0A 3LRQA 1FP0A 5TRBA 2VPBA 3O33A 2LGKA 1Z60A 2EA6A 3ZPVE 4UP0A 3LQIA 3HCSA 2LGLA 2KR4A 4O64A 1Z2QA 5KH7A 3HTKC 2KIZA 3KV6A 3N9NA 2M1RA 4IC3A 3SOXA 2M6MA 4YBMA 2VPEA 3EB5A 2LQ6A 3PUQA 4R8PK 2Y43A 5B76A 1WEPA 4N3WA 2KU3A 3PURA 4FIPA 3KV5A 4UI9B 4W4UA 2LV9A 2LDRA 4GNEA 4LK9A 2ECVA 2BAYA 2MA5A 4R2YA 2Y1MA 2LGVA 4I7DA 3O37A 4QF3A 5D1LB 4QF2A 2KWJA 2QICA 5TDWA 4C9ZA 2QJ0A 5TBNA 4S3OB 2G43A 2PNXA 2M3HA 1MM3A 2KGGA 1VYXA 1FBVA 3LQJA 4R7EA 2XB1A 3QZVA
chains in the Genus database with same CATH superfamily
1E4UA 3MDBC 4ZUXU 5LKTA 2KKXA 4QQ4A 2H0DA 1N87A 3FANA 1CHCA 5H9MA 5AITA 2MIQA 4F1PA 2KWNA 2VJEA 3N9OA 1WFKA 4MSXA 1WENA 2KGIA 2MNZA 2YHNA 3NG2A 1MM2A 2EGPA 3L11A 2DJAA 2K16A 2LXPC 2IDAA 2MD7B 2K4DA 1WEEA 1WEUA 4L7XA 1ZBDB 4A49A 2YSJA 2CSYA 1VD4A 5H1VA 1X4JA 2OXQC 2MT5A 2ECTA 4YAXA 4GNDA 2YUCA 3T7LA 2VJFA 2LGGA 3FL2A 2HDPA 1MBMA 4WZ3B 2IQJA 3SHBA 2KWOA 1G25A 2YREA 5B75A 2LAUA 4PTBA 1DCQA 5LKZA 4F52B 3M63A 2C2LA 2RR4A 3C6WA 2C2VS 3O34A 5B78A 5H1TA 2YT5A 2B0OE 2MA6A 2MKEA 2L43A 4OGCA 2JUNA 3ZYQA 1X4UA 3O70A 4WZ2A 5I3LA 3ASLA 4BBQA 5C11A 3E2DA 5FB0A 1DVPA 1LDJB 1WEMA 4LJNA 4N4FA 2F42A 3DQVR 2KWKA 3ZVZB 4CCGX 2FUUA 4B7YC 5DINA 3M99A 3N9LA 5SVYA 2JMIA 4V3KC 4B86C 3IHPA 4YADA 2UZGA 3U5PA 4LKAA 3M62A 2F6NA 4MVTA 4A4CA 4P5OB 1WILA 5LCWB 3ZTGA 2CKLB 3O7AA 4Q6FA 2I50A 2YURA 3U5MA 4FK5A 2OWAA 2PUYA 3ZVYA 2L5UA 2LRIC 4AYCA 5G04B 2YW8A 4AVXA 5SVIA 2JM3A 2VJFB 2JMDA 4AUQB 2ECGA 3GL6A 3FJUB 2NAAA 3M7KA 5TABA 4YC9A 2L7PA 2DX8A 4FO9A 3N9MA 3ZNIA 3L1ZB 3Q1DA 4CA1A 5J3XA 3KNVA 4I7CA 3DDTA 3L1XA 5D1KB 3I2DA 3O35A 5H1UA 4GNFA 3KQIA 4BHWA 2MNYA 3N9QA 2E61A 4A4BA 3LVQE 3HCTA 4O62A 3MHHA 3MHSA 2CT2A 2ECWA 4V3LC 3O47A 2D8SA 2CSVA 1V87A 1WGMA 4NN2A 2E6SA 4LADB 2ECJA 4OGEA 1T1HA 5C13A 1IYMA 2P57A 4AP4A 2XOZA 3ZPV1 3SUBA 3LVRE 5LKXA 5FB1A 3FAOA 3SOWA 2M85A 2MUMA 2L75A 2YYRA 4ZDTA 3VK6A 2XEUA 4X3GA 4A0CD 2FUIA 2LXHC 2YHOA 4TKPB 5JG6A 2AN6A 5SVXA 3FEHA 4XI1A 5B79A 2RSDA 2FFWA 2YU4A 1WEQA 2EODA 2FD4A 3SOUA 1JM7B 3DPLR 4IC2A 1HYIA 4GB0A 4YBSA 1BORA 3HCUA 3LQHA 3C5KA 5KH3A 2RI7A 5TDRA 2YSMA 2QIZA 4GNGA 1WEOA 2FSAA 1JOCA 2H0DB 5K3QA 5EYAF 2ECIA 3EB6A 4PPEA 2ECNA 5D1MB 2CRRA 1WESA 1JM7A 2JMJA 1WE9A 2ZETC 3DWDA 4WA6A 3V43A 2HYED 5FEYA 2KE1A 2JRJA 3JUEA 1U6GB 1F62A 2XP0A 3RPGB 2EGMA 2E6RA 4I7BA 1X4IA 5G05B 3N9PA 3O36A 4LLBA 1RMDA 4L58A 2LN0A 1HYJA 2Y1NA 5FERA 2CSZA 1Z6UA 4FJCA 5KH9A 4YABA 1K2FA 4AYCB 5B77A 2CRWA 1VFYA 1XWHA 4S3OC 4ZQLA 2KFTA 3U5NA 2G45A 2VP7A 2KKYA 2G6QA 2VPGA 2CKLA 3H7HA 5AIUA 2K1JA 3PHDA 2XOYA 2MD8C 2KYUA 3GV4A 1LDKC 2VNFA 2D8UA 3RTRB 2L0BA 2F6JA 2CONA 5G0FA 1WEVA 5LKUA 3U5OA 5B8DA 2VJEB 2VPDA 4YBTA 3T6RA 2KREA 2K17A 2DSMA 1WEWA 4UP5A 5DKAA 3RPGC 1WIMA 2L80A 2YQMA 2YQLA 4YATA 4WZ0A 4Z0RA 3LRQA 1FP0A 3T9KA 5TRBA 2VPBA 2YVRA 3O33A 2LGKA 1Z60A 2EA6A 3ZPVE 4UP0A 3LQIA 3HCSA 2LGLA 2KR4A 3PLWA 4O64A 1Z2QA 5KH7A 2M13A 3HTKC 2KIZA 3KV6A 3N9NA 2M1RA 2XOCA 4IC3A 3LDYA 3SOXA 2M6MA 4Z0OA 4YBMA 2VPEA 3EB5A 2LQ6A 3PUQA 4R8PK 2Y43A 5B76A 1WEPA 5SVIB 4N3WA 2KU3A 3PURA 4FIPA 3KV5A 4UI9B 4W4UA 2LV9A 2LDRA 4GNEA 4LK9A 2ECVA 2BAYA 2MA5A 4R2YA 2Y1MA 4H9DA 2LGVA 4I7DA 3O37A 4QF3A 5D1LB 4QF2A 2KWJA 2QICA 5TDWA 4C9ZA 2QJ0A 5TBNA 2EXUA 4S3OB 2G43A 2PNXA 3LJUX 3KDEC 2M3HA 1MM3A 2KGGA 1VYXA 1FBVA 3LQJA 4R7EA 2XB1A 3QZVA 3FM8C
chains in the Genus database with same CATH topology
1E4UA 4ZUXU 5LKTA 2H0DA 1N87A 1CHCA 5H9MA 5AITA 2MIQA 2KWNA 2VJEA 3N9OA 1WFKA 4MSXA 1WENA 2KGIA 2MNZA 2YHNA 3NG2A 1MM2A 2EGPA 3L11A 2K16A 2LXPC 2IDAA 2MD7B 2K4DA 1WEEA 1WEUA 4L7XA 1ZBDB 4A49A 2YSJA 2CSYA 1VD4A 5H1VA 1X4JA 2OXQC 2MT5A 2ECTA 4YAXA 4GNDA 2YUCA 3T7LA 2VJFA 2LGGA 3FL2A 2HDPA 4WZ3B 3SHBA 2KWOA 1G25A 2YREA 5B75A 4PTBA 5LKZA 4F52B 3M63A 2C2LA 3C6WA 2C2VS 3O34A 5B78A 5H1TA 2YT5A 2MA6A 2L43A 3ZYQA 1X4UA 3O70A 4WZ2A 5I3LA 3ASLA 4BBQA 5C11A 5FB0A 1DVPA 1LDJB 1WEMA 4LJNA 4N4FA 2F42A 3DQVR 2KWKA 3ZVZB 4CCGX 2FUUA 4B7YC 5DINA 3M99A 3N9LA 2JMIA 4V3KC 4B86C 3IHPA 4YADA 2UZGA 3U5PA 4LKAA 3M62A 2F6NA 4MVTA 4A4CA 4P5OB 1WILA 5LCWB 3ZTGA 2CKLB 3O7AA 4Q6FA 2I50A 2YURA 3U5MA 4FK5A 2PUYA 3ZVYA 2L5UA 2LRIC 4AYCA 5G04B 2YW8A 4AVXA 2VJFB 2JMDA 4AUQB 2ECGA 3GL6A 2NAAA 5TABA 4YC9A 2DX8A 4FO9A 3N9MA 3ZNIA 3L1ZB 4CA1A 5J3XA 3KNVA 4I7CA 3L1XA 5D1KB 3I2DA 3O35A 5H1UA 4GNFA 3KQIA 4BHWA 2MNYA 3N9QA 4A4BA 3HCTA 3MHHA 3MHSA 2CT2A 2ECWA 4V3LC 2D8SA 1V87A 1WGMA 4NN2A 2E6SA 4LADB 2ECJA 1T1HA 5C13A 1IYMA 4AP4A 3ZPV1 5LKXA 5FB1A 3SOWA 2M85A 2MUMA 2L75A 2YYRA 4ZDTA 3VK6A 2XEUA 4X3GA 4A0CD 2FUIA 2LXHC 2YHOA 4TKPB 5JG6A 2AN6A 4XI1A 5B79A 2RSDA 2YU4A 1WEQA 2EODA 3SOUA 1JM7B 3DPLR 4IC2A 1HYIA 4GB0A 4YBSA 1BORA 3HCUA 3LQHA 3C5KA 5KH3A 2RI7A 5TDRA 2YSMA 2QIZA 4GNGA 1WEOA 2FSAA 1JOCA 2H0DB 5EYAF 2ECIA 3EB6A 4PPEA 2ECNA 5D1MB 1WESA 1JM7A 2JMJA 1WE9A 2ZETC 4WA6A 3V43A 2HYED 5FEYA 2KE1A 2JRJA 1U6GB 1F62A 3RPGB 2E6RA 4I7BA 1X4IA 5G05B 3N9PA 3O36A 4LLBA 1RMDA 4L58A 2LN0A 1HYJA 2Y1NA 5FERA 2CSZA 1Z6UA 4FJCA 5KH9A 4YABA 1K2FA 4AYCB 5B77A 1VFYA 1XWHA 4S3OC 4ZQLA 2KFTA 3U5NA 2G45A 2VP7A 2G6QA 2VPGA 2CKLA 5AIUA 2K1JA 3PHDA 2MD8C 2KYUA 3GV4A 1LDKC 2VNFA 3RTRB 2L0BA 2F6JA 5G0FA 1WEVA 5LKUA 3U5OA 5B8DA 2VJEB 2VPDA 4YBTA 3T6RA 2KREA 2K17A 1WEWA 4UP5A 5DKAA 3RPGC 1WIMA 2L80A 2YQMA 2YQLA 4YATA 4WZ0A 3LRQA 1FP0A 5TRBA 2VPBA 3O33A 2LGKA 1Z60A 2EA6A 3ZPVE 4UP0A 3LQIA 3HCSA 2LGLA 2KR4A 4O64A 1Z2QA 5KH7A 3HTKC 2KIZA 3KV6A 3N9NA 2M1RA 4IC3A 3SOXA 2M6MA 4YBMA 2VPEA 3EB5A 2LQ6A 3PUQA 4R8PK 2Y43A 5B76A 1WEPA 4N3WA 2KU3A 3PURA 4FIPA 3KV5A 4UI9B 4W4UA 2LV9A 2LDRA 4GNEA 4LK9A 2ECVA 2BAYA 2MA5A 4R2YA 2Y1MA 2LGVA 4I7DA 3O37A 4QF3A 5D1LB 4QF2A 2KWJA 2QICA 5TDWA 4C9ZA 2QJ0A 5TBNA 4S3OB 2G43A 2PNXA 2M3HA 1MM3A 2KGGA 1VYXA 1FBVA 3LQJA 4R7EA 2XB1A 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4U A;  4ZUX U;  5LKT A;  2H0D A;  1N87 A;  1CHC A;  5H9M A;  5AIT A;  2MIQ A;  2KWN A;  2VJE A;  3N9O A;  1WFK A;  4MSX A;  1WEN A;  2KGI A;  2MNZ A;  2YHN A;  3NG2 A;  1MM2 A;  2EGP A;  3L11 A;  2K16 A;  2LXP C;  2IDA A;  2MD7 B;  2K4D A;  1WEE A;  1WEU A;  4L7X A;  1ZBD B;  4A49 A;  2YSJ A;  2CSY A;  1VD4 A;  5H1V A;  1X4J A;  2OXQ C;  2MT5 A;  2ECT A;  4YAX A;  4GND A;  2YUC A;  3T7L A;  2VJF A;  2LGG A;  3FL2 A;  2HDP A;  4WZ3 B;  3SHB A;  2KWO A;  1G25 A;  2YRE A;  5B75 A;  4PTB A;  5LKZ A;  4F52 B;  3M63 A;  2C2L A;  3C6W A;  2C2V S;  3O34 A;  5B78 A;  5H1T A;  2YT5 A;  2MA6 A;  2L43 A;  3ZYQ A;  1X4U A;  3O70 A;  4WZ2 A;  5I3L A;  3ASL A;  4BBQ A;  5C11 A;  5FB0 A;  1DVP A;  1LDJ B;  1WEM A;  4LJN A;  4N4F A;  2F42 A;  3DQV R;  2KWK A;  3ZVZ B;  4CCG X;  2FUU A;  4B7Y C;  5DIN A;  3M99 A;  3N9L A;  2JMI A;  4V3K C;  4B86 C;  3IHP A;  4YAD A;  2UZG A;  3U5P A;  4LKA A;  3M62 A;  2F6N A;  4MVT A;  4A4C A;  4P5O B;  1WIL A;  5LCW B;  3ZTG A;  2CKL B;  3O7A A;  4Q6F A;  2I50 A;  2YUR A;  3U5M A;  4FK5 A;  2PUY A;  3ZVY A;  2L5U A;  2LRI C;  4AYC A;  5G04 B;  2YW8 A;  4AVX A;  2VJF B;  2JMD A;  4AUQ B;  2ECG A;  3GL6 A;  2NAA A;  5TAB A;  4YC9 A;  2DX8 A;  4FO9 A;  3N9M A;  3ZNI A;  3L1Z B;  4CA1 A;  5J3X A;  3KNV A;  4I7C A;  3L1X A;  5D1K B;  3I2D A;  3O35 A;  5H1U A;  4GNF A;  3KQI A;  4BHW A;  2MNY A;  3N9Q A;  4A4B A;  3HCT A;  3MHH A;  3MHS A;  2CT2 A;  2ECW A;  4V3L C;  2D8S A;  1V87 A;  1WGM A;  4NN2 A;  2E6S A;  4LAD B;  2ECJ A;  1T1H A;  5C13 A;  1IYM A;  4AP4 A;  3ZPV 1;  5LKX A;  5FB1 A;  3SOW A;  2M85 A;  2MUM A;  2L75 A;  2YYR A;  4ZDT A;  3VK6 A;  2XEU A;  4X3G A;  4A0C D;  2FUI A;  2LXH C;  2YHO A;  4TKP B;  5JG6 A;  2AN6 A;  4XI1 A;  5B79 A;  2RSD A;  2YU4 A;  1WEQ A;  2EOD A;  3SOU A;  1JM7 B;  3DPL R;  4IC2 A;  1HYI A;  4GB0 A;  4YBS A;  1BOR A;  3HCU A;  3LQH A;  3C5K A;  5KH3 A;  2RI7 A;  5TDR A;  2YSM A;  2QIZ A;  4GNG A;  1WEO A;  2FSA A;  1JOC A;  2H0D B;  5EYA F;  2ECI A;  3EB6 A;  4PPE A;  2ECN A;  5D1M B;  1WES A;  1JM7 A;  2JMJ A;  1WE9 A;  2ZET C;  4WA6 A;  3V43 A;  2HYE D;  5FEY A;  2KE1 A;  2JRJ A;  1U6G B;  1F62 A;  3RPG B;  2E6R A;  4I7B A;  1X4I A;  5G05 B;  3N9P A;  3O36 A;  4LLB A;  1RMD A;  4L58 A;  2LN0 A;  1HYJ A;  2Y1N A;  5FER A;  2CSZ A;  1Z6U A;  4FJC A;  5KH9 A;  4YAB A;  1K2F A;  4AYC B;  5B77 A;  1VFY A;  1XWH A;  4S3O C;  4ZQL A;  2KFT A;  3U5N A;  2G45 A;  2VP7 A;  2G6Q A;  2VPG A;  2CKL A;  5AIU A;  2K1J A;  3PHD A;  2MD8 C;  2KYU A;  3GV4 A;  1LDK C;  2VNF A;  3RTR B;  2L0B A;  2F6J A;  5G0F A;  1WEV A;  5LKU A;  3U5O A;  5B8D A;  2VJE B;  2VPD A;  4YBT A;  3T6R A;  2KRE A;  2K17 A;  1WEW A;  4UP5 A;  5DKA A;  3RPG C;  1WIM A;  2L80 A;  2YQM A;  2YQL A;  4YAT A;  4WZ0 A;  3LRQ A;  1FP0 A;  5TRB A;  2VPB A;  3O33 A;  2LGK A;  1Z60 A;  2EA6 A;  3ZPV E;  4UP0 A;  3LQI A;  3HCS A;  2LGL A;  2KR4 A;  4O64 A;  1Z2Q A;  5KH7 A;  3HTK C;  2KIZ A;  3KV6 A;  3N9N A;  2M1R A;  4IC3 A;  3SOX A;  2M6M A;  4YBM A;  2VPE A;  3EB5 A;  2LQ6 A;  3PUQ A;  4R8P K;  2Y43 A;  5B76 A;  1WEP A;  4N3W A;  2KU3 A;  3PUR A;  4FIP A;  3KV5 A;  4UI9 B;  4W4U A;  2LV9 A;  2LDR A;  4GNE A;  4LK9 A;  2ECV A;  2BAY A;  2MA5 A;  4R2Y A;  2Y1M A;  2LGV A;  4I7D A;  3O37 A;  4QF3 A;  5D1L B;  4QF2 A;  2KWJ A;  2QIC A;  5TDW A;  4C9Z A;  2QJ0 A;  5TBN A;  4S3O B;  2G43 A;  2PNX A;  2M3H A;  1MM3 A;  2KGG A;  1VYX A;  1FBV A;  3LQJ A;  4R7E A;  2XB1 A;  3QZV A; 
#chains in the Genus database with same CATH topology
 1E4U A;  3MDB C;  4ZUX U;  5LKT A;  2KKX A;  4QQ4 A;  2H0D A;  1N87 A;  3FAN A;  1CHC A;  5H9M A;  5AIT A;  2MIQ A;  4F1P A;  2KWN A;  2VJE A;  3N9O A;  1WFK A;  4MSX A;  1WEN A;  2KGI A;  2MNZ A;  2YHN A;  3NG2 A;  1MM2 A;  2EGP A;  3L11 A;  2DJA A;  2K16 A;  2LXP C;  2IDA A;  2MD7 B;  2K4D A;  1WEE A;  1WEU A;  4L7X A;  1ZBD B;  4A49 A;  2YSJ A;  2CSY A;  1VD4 A;  5H1V A;  1X4J A;  2OXQ C;  2MT5 A;  2ECT A;  4YAX A;  4GND A;  2YUC A;  3T7L A;  2VJF A;  2LGG A;  3FL2 A;  2HDP A;  1MBM A;  4WZ3 B;  2IQJ A;  3SHB A;  2KWO A;  1G25 A;  2YRE A;  5B75 A;  2LAU A;  4PTB A;  1DCQ A;  5LKZ A;  4F52 B;  3M63 A;  2C2L A;  2RR4 A;  3C6W A;  2C2V S;  3O34 A;  5B78 A;  5H1T A;  2YT5 A;  2B0O E;  2MA6 A;  2MKE A;  2L43 A;  4OGC A;  2JUN A;  3ZYQ A;  1X4U A;  3O70 A;  4WZ2 A;  5I3L A;  3ASL A;  4BBQ A;  5C11 A;  3E2D A;  5FB0 A;  1DVP A;  1LDJ B;  1WEM A;  4LJN A;  4N4F A;  2F42 A;  3DQV R;  2KWK A;  3ZVZ B;  4CCG X;  2FUU A;  4B7Y C;  5DIN A;  3M99 A;  3N9L A;  5SVY A;  2JMI A;  4V3K C;  4B86 C;  3IHP A;  4YAD A;  2UZG A;  3U5P A;  4LKA A;  3M62 A;  2F6N A;  4MVT A;  4A4C A;  4P5O B;  1WIL A;  5LCW B;  3ZTG A;  2CKL B;  3O7A A;  4Q6F A;  2I50 A;  2YUR A;  3U5M A;  4FK5 A;  2OWA A;  2PUY A;  3ZVY A;  2L5U A;  2LRI C;  4AYC A;  5G04 B;  2YW8 A;  4AVX A;  5SVI A;  2JM3 A;  2VJF B;  2JMD A;  4AUQ B;  2ECG A;  3GL6 A;  3FJU B;  2NAA A;  3M7K A;  5TAB A;  4YC9 A;  2L7P A;  2DX8 A;  4FO9 A;  3N9M A;  3ZNI A;  3L1Z B;  3Q1D A;  4CA1 A;  5J3X A;  3KNV A;  4I7C A;  3DDT A;  3L1X A;  5D1K B;  3I2D A;  3O35 A;  5H1U A;  4GNF A;  3KQI A;  4BHW A;  2MNY A;  3N9Q A;  2E61 A;  4A4B A;  3LVQ E;  3HCT A;  4O62 A;  3MHH A;  3MHS A;  2CT2 A;  2ECW A;  4V3L C;  3O47 A;  2D8S A;  2CSV A;  1V87 A;  1WGM A;  4NN2 A;  2E6S A;  4LAD B;  2ECJ A;  4OGE A;  1T1H A;  5C13 A;  1IYM A;  2P57 A;  4AP4 A;  2XOZ A;  3ZPV 1;  3SUB A;  3LVR E;  5LKX A;  5FB1 A;  3FAO A;  3SOW A;  2M85 A;  2MUM A;  2L75 A;  2YYR A;  4ZDT A;  3VK6 A;  2XEU A;  4X3G A;  4A0C D;  2FUI A;  2LXH C;  2YHO A;  4TKP B;  5JG6 A;  2AN6 A;  5SVX A;  3FEH A;  4XI1 A;  5B79 A;  2RSD A;  2FFW A;  2YU4 A;  1WEQ A;  2EOD A;  2FD4 A;  3SOU A;  1JM7 B;  3DPL R;  4IC2 A;  1HYI A;  4GB0 A;  4YBS A;  1BOR A;  3HCU A;  3LQH A;  3C5K A;  5KH3 A;  2RI7 A;  5TDR A;  2YSM A;  2QIZ A;  4GNG A;  1WEO A;  2FSA A;  1JOC A;  2H0D B;  5K3Q A;  5EYA F;  2ECI A;  3EB6 A;  4PPE A;  2ECN A;  5D1M B;  2CRR A;  1WES A;  1JM7 A;  2JMJ A;  1WE9 A;  2ZET C;  3DWD A;  4WA6 A;  3V43 A;  2HYE D;  5FEY A;  2KE1 A;  2JRJ A;  3JUE A;  1U6G B;  1F62 A;  2XP0 A;  3RPG B;  2EGM A;  2E6R A;  4I7B A;  1X4I A;  5G05 B;  3N9P A;  3O36 A;  4LLB A;  1RMD A;  4L58 A;  2LN0 A;  1HYJ A;  2Y1N A;  5FER A;  2CSZ A;  1Z6U A;  4FJC A;  5KH9 A;  4YAB A;  1K2F A;  4AYC B;  5B77 A;  2CRW A;  1VFY A;  1XWH A;  4S3O C;  4ZQL A;  2KFT A;  3U5N A;  2G45 A;  2VP7 A;  2KKY A;  2G6Q A;  2VPG A;  2CKL A;  3H7H A;  5AIU A;  2K1J A;  3PHD A;  2XOY A;  2MD8 C;  2KYU A;  3GV4 A;  1LDK C;  2VNF A;  2D8U A;  3RTR B;  2L0B A;  2F6J A;  2CON A;  5G0F A;  1WEV A;  5LKU A;  3U5O A;  5B8D A;  2VJE B;  2VPD A;  4YBT A;  3T6R A;  2KRE A;  2K17 A;  2DSM A;  1WEW A;  4UP5 A;  5DKA A;  3RPG C;  1WIM A;  2L80 A;  2YQM A;  2YQL A;  4YAT A;  4WZ0 A;  4Z0R A;  3LRQ A;  1FP0 A;  3T9K A;  5TRB A;  2VPB A;  2YVR A;  3O33 A;  2LGK A;  1Z60 A;  2EA6 A;  3ZPV E;  4UP0 A;  3LQI A;  3HCS A;  2LGL A;  2KR4 A;  3PLW A;  4O64 A;  1Z2Q A;  5KH7 A;  2M13 A;  3HTK C;  2KIZ A;  3KV6 A;  3N9N A;  2M1R A;  2XOC A;  4IC3 A;  3LDY A;  3SOX A;  2M6M A;  4Z0O A;  4YBM A;  2VPE A;  3EB5 A;  2LQ6 A;  3PUQ A;  4R8P K;  2Y43 A;  5B76 A;  1WEP A;  5SVI B;  4N3W A;  2KU3 A;  3PUR A;  4FIP A;  3KV5 A;  4UI9 B;  4W4U A;  2LV9 A;  2LDR A;  4GNE A;  4LK9 A;  2ECV A;  2BAY A;  2MA5 A;  4R2Y A;  2Y1M A;  4H9D A;  2LGV A;  4I7D A;  3O37 A;  4QF3 A;  5D1L B;  4QF2 A;  2KWJ A;  2QIC A;  5TDW A;  4C9Z A;  2QJ0 A;  5TBN A;  2EXU A;  4S3O B;  2G43 A;  2PNX A;  3LJU X;  3KDE C;  2M3H A;  1MM3 A;  2KGG A;  1VYX A;  1FBV A;  3LQJ A;  4R7E A;  2XB1 A;  3QZV A;  3FM8 C; 
#chains in the Genus database with same CATH homology
 1E4U A;  4ZUX U;  5LKT A;  2H0D A;  1N87 A;  1CHC A;  5H9M A;  5AIT A;  2MIQ A;  2KWN A;  2VJE A;  3N9O A;  1WFK A;  4MSX A;  1WEN A;  2KGI A;  2MNZ A;  2YHN A;  3NG2 A;  1MM2 A;  2EGP A;  3L11 A;  2K16 A;  2LXP C;  2IDA A;  2MD7 B;  2K4D A;  1WEE A;  1WEU A;  4L7X A;  1ZBD B;  4A49 A;  2YSJ A;  2CSY A;  1VD4 A;  5H1V A;  1X4J A;  2OXQ C;  2MT5 A;  2ECT A;  4YAX A;  4GND A;  2YUC A;  3T7L A;  2VJF A;  2LGG A;  3FL2 A;  2HDP A;  4WZ3 B;  3SHB A;  2KWO A;  1G25 A;  2YRE A;  5B75 A;  4PTB A;  5LKZ A;  4F52 B;  3M63 A;  2C2L A;  3C6W A;  2C2V S;  3O34 A;  5B78 A;  5H1T A;  2YT5 A;  2MA6 A;  2L43 A;  3ZYQ A;  1X4U A;  3O70 A;  4WZ2 A;  5I3L A;  3ASL A;  4BBQ A;  5C11 A;  5FB0 A;  1DVP A;  1LDJ B;  1WEM A;  4LJN A;  4N4F A;  2F42 A;  3DQV R;  2KWK A;  3ZVZ B;  4CCG X;  2FUU A;  4B7Y C;  5DIN A;  3M99 A;  3N9L A;  2JMI A;  4V3K C;  4B86 C;  3IHP A;  4YAD A;  2UZG A;  3U5P A;  4LKA A;  3M62 A;  2F6N A;  4MVT A;  4A4C A;  4P5O B;  1WIL A;  5LCW B;  3ZTG A;  2CKL B;  3O7A A;  4Q6F A;  2I50 A;  2YUR A;  3U5M A;  4FK5 A;  2PUY A;  3ZVY A;  2L5U A;  2LRI C;  4AYC A;  5G04 B;  2YW8 A;  4AVX A;  2VJF B;  2JMD A;  4AUQ B;  2ECG A;  3GL6 A;  2NAA A;  5TAB A;  4YC9 A;  2DX8 A;  4FO9 A;  3N9M A;  3ZNI A;  3L1Z B;  4CA1 A;  5J3X A;  3KNV A;  4I7C A;  3L1X A;  5D1K B;  3I2D A;  3O35 A;  5H1U A;  4GNF A;  3KQI A;  4BHW A;  2MNY A;  3N9Q A;  4A4B A;  3HCT A;  3MHH A;  3MHS A;  2CT2 A;  2ECW A;  4V3L C;  2D8S A;  1V87 A;  1WGM A;  4NN2 A;  2E6S A;  4LAD B;  2ECJ A;  1T1H A;  5C13 A;  1IYM A;  4AP4 A;  3ZPV 1;  5LKX A;  5FB1 A;  3SOW A;  2M85 A;  2MUM A;  2L75 A;  2YYR A;  4ZDT A;  3VK6 A;  2XEU A;  4X3G A;  4A0C D;  2FUI A;  2LXH C;  2YHO A;  4TKP B;  5JG6 A;  2AN6 A;  4XI1 A;  5B79 A;  2RSD A;  2YU4 A;  1WEQ A;  2EOD A;  3SOU A;  1JM7 B;  3DPL R;  4IC2 A;  1HYI A;  4GB0 A;  4YBS A;  1BOR A;  3HCU A;  3LQH A;  3C5K A;  5KH3 A;  2RI7 A;  5TDR A;  2YSM A;  2QIZ A;  4GNG A;  1WEO A;  2FSA A;  1JOC A;  2H0D B;  5EYA F;  2ECI A;  3EB6 A;  4PPE A;  2ECN A;  5D1M B;  1WES A;  1JM7 A;  2JMJ A;  1WE9 A;  2ZET C;  4WA6 A;  3V43 A;  2HYE D;  5FEY A;  2KE1 A;  2JRJ A;  1U6G B;  1F62 A;  3RPG B;  2E6R A;  4I7B A;  1X4I A;  5G05 B;  3N9P A;  3O36 A;  4LLB A;  1RMD A;  4L58 A;  2LN0 A;  1HYJ A;  2Y1N A;  5FER A;  2CSZ A;  1Z6U A;  4FJC A;  5KH9 A;  4YAB A;  1K2F A;  4AYC B;  5B77 A;  1VFY A;  1XWH A;  4S3O C;  4ZQL A;  2KFT A;  3U5N A;  2G45 A;  2VP7 A;  2G6Q A;  2VPG A;  2CKL A;  5AIU A;  2K1J A;  3PHD A;  2MD8 C;  2KYU A;  3GV4 A;  1LDK C;  2VNF A;  3RTR B;  2L0B A;  2F6J A;  5G0F A;  1WEV A;  5LKU A;  3U5O A;  5B8D A;  2VJE B;  2VPD A;  4YBT A;  3T6R A;  2KRE A;  2K17 A;  1WEW A;  4UP5 A;  5DKA A;  3RPG C;  1WIM A;  2L80 A;  2YQM A;  2YQL A;  4YAT A;  4WZ0 A;  3LRQ A;  1FP0 A;  5TRB A;  2VPB A;  3O33 A;  2LGK A;  1Z60 A;  2EA6 A;  3ZPV E;  4UP0 A;  3LQI A;  3HCS A;  2LGL A;  2KR4 A;  4O64 A;  1Z2Q A;  5KH7 A;  3HTK C;  2KIZ A;  3KV6 A;  3N9N A;  2M1R A;  4IC3 A;  3SOX A;  2M6M A;  4YBM A;  2VPE A;  3EB5 A;  2LQ6 A;  3PUQ A;  4R8P K;  2Y43 A;  5B76 A;  1WEP A;  4N3W A;  2KU3 A;  3PUR A;  4FIP A;  3KV5 A;  4UI9 B;  4W4U A;  2LV9 A;  2LDR A;  4GNE A;  4LK9 A;  2ECV A;  2BAY A;  2MA5 A;  4R2Y A;  2Y1M A;  2LGV A;  4I7D A;  3O37 A;  4QF3 A;  5D1L B;  4QF2 A;  2KWJ A;  2QIC A;  5TDW A;  4C9Z A;  2QJ0 A;  5TBN A;  4S3O B;  2G43 A;  2PNX A;  2M3H A;  1MM3 A;  2KGG A;  1VYX A;  1FBV A;  3LQJ A;  4R7E A;  2XB1 A;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...