2EA6A

Solution structure of the ring domain of the human ring finger protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
b'GSSGSSGTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein 4
publication title Solution Structure of the RING domain of the human ring finger protein 4
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ea6A01
3QZVA 5B8DA 1JOCA 1WEMA 3ZVYA 2VJFB 3U5MA 3O7AA 2QJ0A 2LGGA 4LK9A 5D1MB 2CT2A 1LDKC 1U6GB 2JMDA 2JMJA 5B78A 4BBQA 2AN6A 3SHBA 2ZETC 1Z60A 4FO9A 4LJNA 5EYAF 3O34A 1CHCA 1VFYA 3MHSA 2RSDA 3M99A 3U5PA 4P5OB 3LRQA 2VNFA 3HCTA 3T7LA 2KWOA 4O64A 2L0BA 2NAAA 2RI7A 4UP5A 1VYXA 2MNZA 4QF3A 3N9MA 4WZ2A 4AUQB 4I7DA 1F62A 4GNEA 3HTKC 4GNFA 4CCGX 2VP7A 4N4FA 3LQIA 4A4BA 4YAXA 3T6RA 4FK5A 4AVXA 4GB0A 2G6QA 4Q6FA 4F52B 2EODA 2YQMA 2G43A 3U5NA 5TDRA 2CSYA 5I3LA 3KV6A 2ECWA 2C2VS 2F6JA 2M3HA 4A0CD 1E4UA 2FSAA 1K2FA 4LKAA 3KQIA 2QICA 2DX8A 4R8PK 4WZ0A 3RPGC 1DVPA 2EGPA 2MA6A 5TABA 2VPBA 1JM7A 1WEEA 3C5KA 1JM7B 1WILA 5LKTA 2LDRA 1MM3A 4I7BA 4UP0A 3N9LA 2YREA 4A49A 2YQLA 4NN2A 2KR4A 4TKPB 2H0DA 1VD4A 2Y43A 4ZUXU 2H0DB 5AIUA 4GNDA 2L80A 1WEWA 3ZPV1 5H1UA 3N9PA 3O33A 3ZTGA 4A4CA 5KH3A 2PUYA 4IC2A 5FB1A 5LKXA 5B75A 5G04B 2YSMA 2EA6A 5DINA 2MT5A 2KYUA 2ECTA 2LGLA 5LCWB 3PHDA 5FERA 5B79A 4V3LC 3PURA 5LKUA 4IC3A 1WESA 3V43A 4I7CA 5H1TA 2LV9A 3ZYQA 2HYED 1WE9A 4YATA 1FP0A 3O36A 2MA5A 2YT5A 4LLBA 3SOUA 2LGVA 3ASLA 4BHWA 5G05B 4B7YC 2YUCA 5TDWA 2CKLA 3LQHA 3HCUA 1ZBDB 3SOWA 2K17A 2YU4A 2CKLB 5J3XA 2ECGA 3SOXA 2I50A 2F42A 4CA1A 1Z2QA 4ZDTA 5FB0A 2KGGA 2K4DA 2UZGA 4YC9A 2FUUA 4XI1A 3HCSA 1WIMA 3O35A 3ZPVE 4FIPA 4FJCA 3DPLR 2L5UA 5C11A 1WENA 2MD8C 3DQVR 4MVTA 1HYIA 4YABA 2LXPC 4R2YA 2VJEA 3N9NA 4L7XA 4WA6A 2E6SA 2VJEB 4S3OB 2Y1MA 3M62A 5H1VA 3U5OA 2CSZA 4R7EA 4WZ3B 1T1HA 1V87A 2KWKA 2M6MA 2KGIA 2XB1A 4C9ZA 3FL2A 3LQJA 4GNGA 5B76A 1WEOA 2LGKA 2YW8A 3EB6A 5H9MA 1WGMA 2OXQC 1FBVA 2FUIA 2E6RA 3O70A 4V3KC 1WEVA 2MUMA 2XEUA 3N9QA 1HYJA 4AP4A 3ZNIA 2KFTA 4YBMA 2JMIA 3KV5A 2LXHC 2KWNA 2YSJA 4X3GA 2D8SA 2F6NA 2KU3A 3EB5A 5D1LB 2ECJA 2LN0A 2ECIA 2QIZA 4YBSA 3O37A 3N9OA 3MHHA 5FEYA 4ZQLA 2YHNA 4LADB 4UI9B 1X4IA 1X4JA 3GV4A 5AITA 2YYRA 1WEPA 2JRJA 3IHPA 2K1JA 2ECVA 4B86C 2KIZA 2VPDA 4L58A 4AYCA 3I2DA 2C2LA 4W4UA 5JG6A 2IDAA 3M63A 4AYCB 1WFKA 2K16A 3RTRB 5LKZA 2LQ6A 4N3WA 3L1XA 2MD7B 3C6WA 5D1KB 2VPGA 3KNVA 2L75A 5KH7A 4YADA 3RPGB 1BORA 2Y1NA 2ECNA 1X4UA 2HDPA 2L43A 2VPEA 3GL6A 1WEQA 5DKAA 2PNXA 1Z6UA 4QF2A 1G25A 3ZVZB 1MM2A 1XWHA 5TRBA 2BAYA 2M1RA 2G45A 4PTBA 3NG2A 2YURA 5TBNA 4YBTA 5KH9A 1LDJB 2MIQA 1WEUA 4PPEA 3VK6A 1IYMA 2KWJA 3L1ZB 2KREA 2MNYA 5G0FA 1RMDA 2M85A 3L11A 2KE1A 4MSXA 5C13A 4S3OC 2YHOA 2LRIC 3PUQA 5B77A 1N87A 2VJFA
chains in the Genus database with same CATH superfamily
3QZVA 5B8DA 1JOCA 1WEMA 3ZVYA 2VJFB 3U5MA 4OGEA 3O7AA 2QJ0A 2LGGA 4LK9A 5D1MB 2CT2A 1LDKC 1U6GB 2JMDA 2JMJA 5B78A 4BBQA 2AN6A 3SHBA 2ZETC 1Z60A 4FO9A 4LJNA 5EYAF 3O34A 1CHCA 1VFYA 3MHSA 2RSDA 3M99A 3U5PA 4P5OB 3LRQA 2VNFA 3HCTA 3T7LA 2KWOA 4O64A 2L0BA 2NAAA 2RI7A 4UP5A 1VYXA 2MNZA 4QF3A 3N9MA 4WZ2A 4AUQB 4I7DA 1F62A 4GNEA 3HTKC 4GNFA 5SVXA 3DWDA 4CCGX 2VP7A 4N4FA 3LQIA 4A4BA 4YAXA 3T6RA 4FK5A 4AVXA 4GB0A 2CRWA 2G6QA 2KKYA 4Q6FA 4F52B 2EODA 2YQMA 2G43A 3U5NA 5TDRA 4F1PA 2CSYA 5I3LA 3KV6A 4QQ4A 5K3QA 2ECWA 2C2VS 2DJAA 2F6JA 2DSMA 2M3HA 4OGCA 4A0CD 1E4UA 2FSAA 1K2FA 4LKAA 2P57A 3KQIA 2QICA 2DX8A 2XOCA 4R8PK 4WZ0A 3RPGC 1DVPA 2EGPA 2MA6A 5TABA 2VPBA 1JM7A 1WEEA 3C5KA 1JM7B 3O47A 1WILA 5LKTA 3T9KA 2OWAA 3SUBA 4H9DA 2LDRA 1MM3A 4I7BA 4UP0A 3N9LA 2YREA 4A49A 2YQLA 4NN2A 2KR4A 4TKPB 2H0DA 1VD4A 2Y43A 4ZUXU 2H0DB 5AIUA 4GNDA 2L80A 1WEWA 3ZPV1 5H1UA 3N9PA 2XOZA 3O33A 3ZTGA 4A4CA 2L7PA 5KH3A 2PUYA 4IC2A 5FB1A 5LKXA 5B75A 5G04B 2YSMA 2EA6A 5DINA 2MT5A 2KYUA 2E61A 2ECTA 3LDYA 2LGLA 5LCWB 3PHDA 5FERA 5B79A 5SVIA 2JUNA 4V3LC 3PURA 5LKUA 4IC3A 1WESA 3V43A 5SVIB 4I7CA 5H1TA 2LV9A 3ZYQA 2HYED 1WE9A 4YATA 1FP0A 3O36A 2MA5A 2YT5A 4LLBA 3SOUA 2LGVA 3ASLA 4BHWA 5G05B 4B7YC 4O62A 2YUCA 5TDWA 2CKLA 3LQHA 3HCUA 1ZBDB 3SOWA 2K17A 2YU4A 2CKLB 5J3XA 2ECGA 3SOXA 2M13A 2I50A 2F42A 4CA1A 1Z2QA 4ZDTA 5FB0A 2KGGA 2K4DA 2UZGA 4YC9A 2FUUA 3LVQE 4XI1A 3HCSA 1WIMA 3O35A 3ZPVE 4FIPA 3KDEC 4FJCA 3DPLR 2L5UA 5C11A 1WENA 2MD8C 3DQVR 4MVTA 1HYIA 4YABA 2LXPC 1DCQA 2CSVA 4R2YA 2MKEA 2VJEA 2D8UA 3N9NA 4L7XA 4WA6A 2E6SA 2VJEB 4S3OB 3JUEA 2Y1MA 3M62A 5H1VA 3U5OA 3M7KA 2CSZA 4R7EA 4WZ3B 1T1HA 1V87A 2KWKA 2M6MA 2KGIA 2XB1A 4C9ZA 2FFWA 3FL2A 3LQJA 2KKXA 4GNGA 5B76A 2CRRA 1WEOA 2LGKA 2YW8A 3LJUX 3EB6A 5H9MA 3FAOA 1WGMA 2OXQC 1FBVA 2FUIA 2E6RA 3O70A 4V3KC 1WEVA 3LVRE 2MUMA 2XEUA 3N9QA 1HYJA 4AP4A 4Z0RA 3ZNIA 2KFTA 2XOYA 4YBMA 2JMIA 3KV5A 2LXHC 2KWNA 2EXUA 4Z0OA 3PLWA 2YSJA 2D8SA 2F6NA 4X3GA 2KU3A 3EB5A 3FM8C 5D1LB 2ECJA 2LN0A 2ECIA 2QIZA 4YBSA 3O37A 2XP0A 3N9OA 3MHHA 5FEYA 3Q1DA 4ZQLA 2YHNA 4LADB 4UI9B 1X4IA 1X4JA 3GV4A 5AITA 3FEHA 2YYRA 1WEPA 2JRJA 3IHPA 2K1JA 2ECVA 4B86C 2KIZA 2VPDA 4L58A 4AYCA 3I2DA 2C2LA 4W4UA 5JG6A 2IDAA 3M63A 4AYCB 2CONA 1WFKA 2K16A 3RTRB 5LKZA 2LQ6A 4N3WA 3L1XA 2MD7B 3C6WA 5D1KB 5SVYA 2JM3A 2VPGA 2YVRA 3KNVA 2LAUA 2L75A 5KH7A 4YADA 3RPGB 1BORA 2Y1NA 2ECNA 2RR4A 1X4UA 2HDPA 2L43A 2VPEA 3GL6A 1WEQA 5DKAA 2PNXA 1Z6UA 4QF2A 1G25A 3ZVZB 1MM2A 1XWHA 5TRBA 3DDTA 2B0OE 2BAYA 2EGMA 2G45A 2M1RA 3FANA 3FJUB 4PTBA 3NG2A 2YURA 5TBNA 2IQJA 4YBTA 5KH9A 1LDJB 2MIQA 3E2DA 1WEUA 4PPEA 3VK6A 1IYMA 2KWJA 3L1ZB 2KREA 2MNYA 5G0FA 3MDBC 1RMDA 2FD4A 2M85A 1MBMA 3L11A 2KE1A 4MSXA 5C13A 4S3OC 2YHOA 2LRIC 3H7HA 3PUQA 5B77A 1N87A 2VJFA
chains in the Genus database with same CATH topology
3QZVA 5B8DA 1JOCA 1WEMA 3ZVYA 2VJFB 3U5MA 3O7AA 2QJ0A 2LGGA 4LK9A 5D1MB 2CT2A 1LDKC 1U6GB 2JMDA 2JMJA 5B78A 4BBQA 2AN6A 3SHBA 2ZETC 1Z60A 4FO9A 4LJNA 5EYAF 3O34A 1CHCA 1VFYA 3MHSA 2RSDA 3M99A 3U5PA 4P5OB 3LRQA 2VNFA 3HCTA 3T7LA 2KWOA 4O64A 2L0BA 2NAAA 2RI7A 4UP5A 1VYXA 2MNZA 4QF3A 3N9MA 4WZ2A 4AUQB 4I7DA 1F62A 4GNEA 3HTKC 4GNFA 4CCGX 2VP7A 4N4FA 3LQIA 4A4BA 4YAXA 3T6RA 4FK5A 4AVXA 4GB0A 2G6QA 4Q6FA 4F52B 2EODA 2YQMA 2G43A 3U5NA 5TDRA 2CSYA 5I3LA 3KV6A 2ECWA 2C2VS 2F6JA 2M3HA 4A0CD 1E4UA 2FSAA 1K2FA 4LKAA 3KQIA 2QICA 2DX8A 4R8PK 4WZ0A 3RPGC 1DVPA 2EGPA 2MA6A 5TABA 2VPBA 1JM7A 1WEEA 3C5KA 1JM7B 1WILA 5LKTA 2LDRA 1MM3A 4I7BA 4UP0A 3N9LA 2YREA 4A49A 2YQLA 4NN2A 2KR4A 4TKPB 2H0DA 1VD4A 2Y43A 4ZUXU 2H0DB 5AIUA 4GNDA 2L80A 1WEWA 3ZPV1 5H1UA 3N9PA 3O33A 3ZTGA 4A4CA 5KH3A 2PUYA 4IC2A 5FB1A 5LKXA 5B75A 5G04B 2YSMA 2EA6A 5DINA 2MT5A 2KYUA 2ECTA 2LGLA 5LCWB 3PHDA 5FERA 5B79A 4V3LC 3PURA 5LKUA 4IC3A 1WESA 3V43A 4I7CA 5H1TA 2LV9A 3ZYQA 2HYED 1WE9A 4YATA 1FP0A 3O36A 2MA5A 2YT5A 4LLBA 3SOUA 2LGVA 3ASLA 4BHWA 5G05B 4B7YC 2YUCA 5TDWA 2CKLA 3LQHA 3HCUA 1ZBDB 3SOWA 2K17A 2YU4A 2CKLB 5J3XA 2ECGA 3SOXA 2I50A 2F42A 4CA1A 1Z2QA 4ZDTA 5FB0A 2KGGA 2K4DA 2UZGA 4YC9A 2FUUA 4XI1A 3HCSA 1WIMA 3O35A 3ZPVE 4FIPA 4FJCA 3DPLR 2L5UA 5C11A 1WENA 2MD8C 3DQVR 4MVTA 1HYIA 4YABA 2LXPC 4R2YA 2VJEA 3N9NA 4L7XA 4WA6A 2E6SA 2VJEB 4S3OB 2Y1MA 3M62A 5H1VA 3U5OA 2CSZA 4R7EA 4WZ3B 1T1HA 1V87A 2KWKA 2M6MA 2KGIA 2XB1A 4C9ZA 3FL2A 3LQJA 4GNGA 5B76A 1WEOA 2LGKA 2YW8A 3EB6A 5H9MA 1WGMA 2OXQC 1FBVA 2FUIA 2E6RA 3O70A 4V3KC 1WEVA 2MUMA 2XEUA 3N9QA 1HYJA 4AP4A 3ZNIA 2KFTA 4YBMA 2JMIA 3KV5A 2LXHC 2KWNA 2YSJA 4X3GA 2D8SA 2F6NA 2KU3A 3EB5A 5D1LB 2ECJA 2LN0A 2ECIA 2QIZA 4YBSA 3O37A 3N9OA 3MHHA 5FEYA 4ZQLA 2YHNA 4LADB 4UI9B 1X4IA 1X4JA 3GV4A 5AITA 2YYRA 1WEPA 2JRJA 3IHPA 2K1JA 2ECVA 4B86C 2KIZA 2VPDA 4L58A 4AYCA 3I2DA 2C2LA 4W4UA 5JG6A 2IDAA 3M63A 4AYCB 1WFKA 2K16A 3RTRB 5LKZA 2LQ6A 4N3WA 3L1XA 2MD7B 3C6WA 5D1KB 2VPGA 3KNVA 2L75A 5KH7A 4YADA 3RPGB 1BORA 2Y1NA 2ECNA 1X4UA 2HDPA 2L43A 2VPEA 3GL6A 1WEQA 5DKAA 2PNXA 1Z6UA 4QF2A 1G25A 3ZVZB 1MM2A 1XWHA 5TRBA 2BAYA 2M1RA 2G45A 4PTBA 3NG2A 2YURA 5TBNA 4YBTA 5KH9A 1LDJB 2MIQA 1WEUA 4PPEA 3VK6A 1IYMA 2KWJA 3L1ZB 2KREA 2MNYA 5G0FA 1RMDA 2M85A 3L11A 2KE1A 4MSXA 5C13A 4S3OC 2YHOA 2LRIC 3PUQA 5B77A 1N87A 2VJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZV A;  5B8D A;  1JOC A;  1WEM A;  3ZVY A;  2VJF B;  3U5M A;  3O7A A;  2QJ0 A;  2LGG A;  4LK9 A;  5D1M B;  2CT2 A;  1LDK C;  1U6G B;  2JMD A;  2JMJ A;  5B78 A;  4BBQ A;  2AN6 A;  3SHB A;  2ZET C;  1Z60 A;  4FO9 A;  4LJN A;  5EYA F;  3O34 A;  1CHC A;  1VFY A;  3MHS A;  2RSD A;  3M99 A;  3U5P A;  4P5O B;  3LRQ A;  2VNF A;  3HCT A;  3T7L A;  2KWO A;  4O64 A;  2L0B A;  2NAA A;  2RI7 A;  4UP5 A;  1VYX A;  2MNZ A;  4QF3 A;  3N9M A;  4WZ2 A;  4AUQ B;  4I7D A;  1F62 A;  4GNE A;  3HTK C;  4GNF A;  4CCG X;  2VP7 A;  4N4F A;  3LQI A;  4A4B A;  4YAX A;  3T6R A;  4FK5 A;  4AVX A;  4GB0 A;  2G6Q A;  4Q6F A;  4F52 B;  2EOD A;  2YQM A;  2G43 A;  3U5N A;  5TDR A;  2CSY A;  5I3L A;  3KV6 A;  2ECW A;  2C2V S;  2F6J A;  2M3H A;  4A0C D;  1E4U A;  2FSA A;  1K2F A;  4LKA A;  3KQI A;  2QIC A;  2DX8 A;  4R8P K;  4WZ0 A;  3RPG C;  1DVP A;  2EGP A;  2MA6 A;  5TAB A;  2VPB A;  1JM7 A;  1WEE A;  3C5K A;  1JM7 B;  1WIL A;  5LKT A;  2LDR A;  1MM3 A;  4I7B A;  4UP0 A;  3N9L A;  2YRE A;  4A49 A;  2YQL A;  4NN2 A;  2KR4 A;  4TKP B;  2H0D A;  1VD4 A;  2Y43 A;  4ZUX U;  2H0D B;  5AIU A;  4GND A;  2L80 A;  1WEW A;  3ZPV 1;  5H1U A;  3N9P A;  3O33 A;  3ZTG A;  4A4C A;  5KH3 A;  2PUY A;  4IC2 A;  5FB1 A;  5LKX A;  5B75 A;  5G04 B;  2YSM A;  2EA6 A;  5DIN A;  2MT5 A;  2KYU A;  2ECT A;  2LGL A;  5LCW B;  3PHD A;  5FER A;  5B79 A;  4V3L C;  3PUR A;  5LKU A;  4IC3 A;  1WES A;  3V43 A;  4I7C A;  5H1T A;  2LV9 A;  3ZYQ A;  2HYE D;  1WE9 A;  4YAT A;  1FP0 A;  3O36 A;  2MA5 A;  2YT5 A;  4LLB A;  3SOU A;  2LGV A;  3ASL A;  4BHW A;  5G05 B;  4B7Y C;  2YUC A;  5TDW A;  2CKL A;  3LQH A;  3HCU A;  1ZBD B;  3SOW A;  2K17 A;  2YU4 A;  2CKL B;  5J3X A;  2ECG A;  3SOX A;  2I50 A;  2F42 A;  4CA1 A;  1Z2Q A;  4ZDT A;  5FB0 A;  2KGG A;  2K4D A;  2UZG A;  4YC9 A;  2FUU A;  4XI1 A;  3HCS A;  1WIM A;  3O35 A;  3ZPV E;  4FIP A;  4FJC A;  3DPL R;  2L5U A;  5C11 A;  1WEN A;  2MD8 C;  3DQV R;  4MVT A;  1HYI A;  4YAB A;  2LXP C;  4R2Y A;  2VJE A;  3N9N A;  4L7X A;  4WA6 A;  2E6S A;  2VJE B;  4S3O B;  2Y1M A;  3M62 A;  5H1V A;  3U5O A;  2CSZ A;  4R7E A;  4WZ3 B;  1T1H A;  1V87 A;  2KWK A;  2M6M A;  2KGI A;  2XB1 A;  4C9Z A;  3FL2 A;  3LQJ A;  4GNG A;  5B76 A;  1WEO A;  2LGK A;  2YW8 A;  3EB6 A;  5H9M A;  1WGM A;  2OXQ C;  1FBV A;  2FUI A;  2E6R A;  3O70 A;  4V3K C;  1WEV A;  2MUM A;  2XEU A;  3N9Q A;  1HYJ A;  4AP4 A;  3ZNI A;  2KFT A;  4YBM A;  2JMI A;  3KV5 A;  2LXH C;  2KWN A;  2YSJ A;  4X3G A;  2D8S A;  2F6N A;  2KU3 A;  3EB5 A;  5D1L B;  2ECJ A;  2LN0 A;  2ECI A;  2QIZ A;  4YBS A;  3O37 A;  3N9O A;  3MHH A;  5FEY A;  4ZQL A;  2YHN A;  4LAD B;  4UI9 B;  1X4I A;  1X4J A;  3GV4 A;  5AIT A;  2YYR A;  1WEP A;  2JRJ A;  3IHP A;  2K1J A;  2ECV A;  4B86 C;  2KIZ A;  2VPD A;  4L58 A;  4AYC A;  3I2D A;  2C2L A;  4W4U A;  5JG6 A;  2IDA A;  3M63 A;  4AYC B;  1WFK A;  2K16 A;  3RTR B;  5LKZ A;  2LQ6 A;  4N3W A;  3L1X A;  2MD7 B;  3C6W A;  5D1K B;  2VPG A;  3KNV A;  2L75 A;  5KH7 A;  4YAD A;  3RPG B;  1BOR A;  2Y1N A;  2ECN A;  1X4U A;  2HDP A;  2L43 A;  2VPE A;  3GL6 A;  1WEQ A;  5DKA A;  2PNX A;  1Z6U A;  4QF2 A;  1G25 A;  3ZVZ B;  1MM2 A;  1XWH A;  5TRB A;  2BAY A;  2M1R A;  2G45 A;  4PTB A;  3NG2 A;  2YUR A;  5TBN A;  4YBT A;  5KH9 A;  1LDJ B;  2MIQ A;  1WEU A;  4PPE A;  3VK6 A;  1IYM A;  2KWJ A;  3L1Z B;  2KRE A;  2MNY A;  5G0F A;  1RMD A;  2M85 A;  3L11 A;  2KE1 A;  4MSX A;  5C13 A;  4S3O C;  2YHO A;  2LRI C;  3PUQ A;  5B77 A;  1N87 A;  2VJF A; 
#chains in the Genus database with same CATH topology
 3QZV A;  5B8D A;  1JOC A;  1WEM A;  3ZVY A;  2VJF B;  3U5M A;  4OGE A;  3O7A A;  2QJ0 A;  2LGG A;  4LK9 A;  5D1M B;  2CT2 A;  1LDK C;  1U6G B;  2JMD A;  2JMJ A;  5B78 A;  4BBQ A;  2AN6 A;  3SHB A;  2ZET C;  1Z60 A;  4FO9 A;  4LJN A;  5EYA F;  3O34 A;  1CHC A;  1VFY A;  3MHS A;  2RSD A;  3M99 A;  3U5P A;  4P5O B;  3LRQ A;  2VNF A;  3HCT A;  3T7L A;  2KWO A;  4O64 A;  2L0B A;  2NAA A;  2RI7 A;  4UP5 A;  1VYX A;  2MNZ A;  4QF3 A;  3N9M A;  4WZ2 A;  4AUQ B;  4I7D A;  1F62 A;  4GNE A;  3HTK C;  4GNF A;  5SVX A;  3DWD A;  4CCG X;  2VP7 A;  4N4F A;  3LQI A;  4A4B A;  4YAX A;  3T6R A;  4FK5 A;  4AVX A;  4GB0 A;  2CRW A;  2G6Q A;  2KKY A;  4Q6F A;  4F52 B;  2EOD A;  2YQM A;  2G43 A;  3U5N A;  5TDR A;  4F1P A;  2CSY A;  5I3L A;  3KV6 A;  4QQ4 A;  5K3Q A;  2ECW A;  2C2V S;  2DJA A;  2F6J A;  2DSM A;  2M3H A;  4OGC A;  4A0C D;  1E4U A;  2FSA A;  1K2F A;  4LKA A;  2P57 A;  3KQI A;  2QIC A;  2DX8 A;  2XOC A;  4R8P K;  4WZ0 A;  3RPG C;  1DVP A;  2EGP A;  2MA6 A;  5TAB A;  2VPB A;  1JM7 A;  1WEE A;  3C5K A;  1JM7 B;  3O47 A;  1WIL A;  5LKT A;  3T9K A;  2OWA A;  3SUB A;  4H9D A;  2LDR A;  1MM3 A;  4I7B A;  4UP0 A;  3N9L A;  2YRE A;  4A49 A;  2YQL A;  4NN2 A;  2KR4 A;  4TKP B;  2H0D A;  1VD4 A;  2Y43 A;  4ZUX U;  2H0D B;  5AIU A;  4GND A;  2L80 A;  1WEW A;  3ZPV 1;  5H1U A;  3N9P A;  2XOZ A;  3O33 A;  3ZTG A;  4A4C A;  2L7P A;  5KH3 A;  2PUY A;  4IC2 A;  5FB1 A;  5LKX A;  5B75 A;  5G04 B;  2YSM A;  2EA6 A;  5DIN A;  2MT5 A;  2KYU A;  2E61 A;  2ECT A;  3LDY A;  2LGL A;  5LCW B;  3PHD A;  5FER A;  5B79 A;  5SVI A;  2JUN A;  4V3L C;  3PUR A;  5LKU A;  4IC3 A;  1WES A;  3V43 A;  5SVI B;  4I7C A;  5H1T A;  2LV9 A;  3ZYQ A;  2HYE D;  1WE9 A;  4YAT A;  1FP0 A;  3O36 A;  2MA5 A;  2YT5 A;  4LLB A;  3SOU A;  2LGV A;  3ASL A;  4BHW A;  5G05 B;  4B7Y C;  4O62 A;  2YUC A;  5TDW A;  2CKL A;  3LQH A;  3HCU A;  1ZBD B;  3SOW A;  2K17 A;  2YU4 A;  2CKL B;  5J3X A;  2ECG A;  3SOX A;  2M13 A;  2I50 A;  2F42 A;  4CA1 A;  1Z2Q A;  4ZDT A;  5FB0 A;  2KGG A;  2K4D A;  2UZG A;  4YC9 A;  2FUU A;  3LVQ E;  4XI1 A;  3HCS A;  1WIM A;  3O35 A;  3ZPV E;  4FIP A;  3KDE C;  4FJC A;  3DPL R;  2L5U A;  5C11 A;  1WEN A;  2MD8 C;  3DQV R;  4MVT A;  1HYI A;  4YAB A;  2LXP C;  1DCQ A;  2CSV A;  4R2Y A;  2MKE A;  2VJE A;  2D8U A;  3N9N A;  4L7X A;  4WA6 A;  2E6S A;  2VJE B;  4S3O B;  3JUE A;  2Y1M A;  3M62 A;  5H1V A;  3U5O A;  3M7K A;  2CSZ A;  4R7E A;  4WZ3 B;  1T1H A;  1V87 A;  2KWK A;  2M6M A;  2KGI A;  2XB1 A;  4C9Z A;  2FFW A;  3FL2 A;  3LQJ A;  2KKX A;  4GNG A;  5B76 A;  2CRR A;  1WEO A;  2LGK A;  2YW8 A;  3LJU X;  3EB6 A;  5H9M A;  3FAO A;  1WGM A;  2OXQ C;  1FBV A;  2FUI A;  2E6R A;  3O70 A;  4V3K C;  1WEV A;  3LVR E;  2MUM A;  2XEU A;  3N9Q A;  1HYJ A;  4AP4 A;  4Z0R A;  3ZNI A;  2KFT A;  2XOY A;  4YBM A;  2JMI A;  3KV5 A;  2LXH C;  2KWN A;  2EXU A;  4Z0O A;  3PLW A;  2YSJ A;  2D8S A;  2F6N A;  4X3G A;  2KU3 A;  3EB5 A;  3FM8 C;  5D1L B;  2ECJ A;  2LN0 A;  2ECI A;  2QIZ A;  4YBS A;  3O37 A;  2XP0 A;  3N9O A;  3MHH A;  5FEY A;  3Q1D A;  4ZQL A;  2YHN A;  4LAD B;  4UI9 B;  1X4I A;  1X4J A;  3GV4 A;  5AIT A;  3FEH A;  2YYR A;  1WEP A;  2JRJ A;  3IHP A;  2K1J A;  2ECV A;  4B86 C;  2KIZ A;  2VPD A;  4L58 A;  4AYC A;  3I2D A;  2C2L A;  4W4U A;  5JG6 A;  2IDA A;  3M63 A;  4AYC B;  2CON A;  1WFK A;  2K16 A;  3RTR B;  5LKZ A;  2LQ6 A;  4N3W A;  3L1X A;  2MD7 B;  3C6W A;  5D1K B;  5SVY A;  2JM3 A;  2VPG A;  2YVR A;  3KNV A;  2LAU A;  2L75 A;  5KH7 A;  4YAD A;  3RPG B;  1BOR A;  2Y1N A;  2ECN A;  2RR4 A;  1X4U A;  2HDP A;  2L43 A;  2VPE A;  3GL6 A;  1WEQ A;  5DKA A;  2PNX A;  1Z6U A;  4QF2 A;  1G25 A;  3ZVZ B;  1MM2 A;  1XWH A;  5TRB A;  3DDT A;  2B0O E;  2BAY A;  2EGM A;  2G45 A;  2M1R A;  3FAN A;  3FJU B;  4PTB A;  3NG2 A;  2YUR A;  5TBN A;  2IQJ A;  4YBT A;  5KH9 A;  1LDJ B;  2MIQ A;  3E2D A;  1WEU A;  4PPE A;  3VK6 A;  1IYM A;  2KWJ A;  3L1Z B;  2KRE A;  2MNY A;  5G0F A;  3MDB C;  1RMD A;  2FD4 A;  2M85 A;  1MBM A;  3L11 A;  2KE1 A;  4MSX A;  5C13 A;  4S3O C;  2YHO A;  2LRI C;  3H7H A;  3PUQ A;  5B77 A;  1N87 A;  2VJF A; 
#chains in the Genus database with same CATH homology
 3QZV A;  5B8D A;  1JOC A;  1WEM A;  3ZVY A;  2VJF B;  3U5M A;  3O7A A;  2QJ0 A;  2LGG A;  4LK9 A;  5D1M B;  2CT2 A;  1LDK C;  1U6G B;  2JMD A;  2JMJ A;  5B78 A;  4BBQ A;  2AN6 A;  3SHB A;  2ZET C;  1Z60 A;  4FO9 A;  4LJN A;  5EYA F;  3O34 A;  1CHC A;  1VFY A;  3MHS A;  2RSD A;  3M99 A;  3U5P A;  4P5O B;  3LRQ A;  2VNF A;  3HCT A;  3T7L A;  2KWO A;  4O64 A;  2L0B A;  2NAA A;  2RI7 A;  4UP5 A;  1VYX A;  2MNZ A;  4QF3 A;  3N9M A;  4WZ2 A;  4AUQ B;  4I7D A;  1F62 A;  4GNE A;  3HTK C;  4GNF A;  4CCG X;  2VP7 A;  4N4F A;  3LQI A;  4A4B A;  4YAX A;  3T6R A;  4FK5 A;  4AVX A;  4GB0 A;  2G6Q A;  4Q6F A;  4F52 B;  2EOD A;  2YQM A;  2G43 A;  3U5N A;  5TDR A;  2CSY A;  5I3L A;  3KV6 A;  2ECW A;  2C2V S;  2F6J A;  2M3H A;  4A0C D;  1E4U A;  2FSA A;  1K2F A;  4LKA A;  3KQI A;  2QIC A;  2DX8 A;  4R8P K;  4WZ0 A;  3RPG C;  1DVP A;  2EGP A;  2MA6 A;  5TAB A;  2VPB A;  1JM7 A;  1WEE A;  3C5K A;  1JM7 B;  1WIL A;  5LKT A;  2LDR A;  1MM3 A;  4I7B A;  4UP0 A;  3N9L A;  2YRE A;  4A49 A;  2YQL A;  4NN2 A;  2KR4 A;  4TKP B;  2H0D A;  1VD4 A;  2Y43 A;  4ZUX U;  2H0D B;  5AIU A;  4GND A;  2L80 A;  1WEW A;  3ZPV 1;  5H1U A;  3N9P A;  3O33 A;  3ZTG A;  4A4C A;  5KH3 A;  2PUY A;  4IC2 A;  5FB1 A;  5LKX A;  5B75 A;  5G04 B;  2YSM A;  2EA6 A;  5DIN A;  2MT5 A;  2KYU A;  2ECT A;  2LGL A;  5LCW B;  3PHD A;  5FER A;  5B79 A;  4V3L C;  3PUR A;  5LKU A;  4IC3 A;  1WES A;  3V43 A;  4I7C A;  5H1T A;  2LV9 A;  3ZYQ A;  2HYE D;  1WE9 A;  4YAT A;  1FP0 A;  3O36 A;  2MA5 A;  2YT5 A;  4LLB A;  3SOU A;  2LGV A;  3ASL A;  4BHW A;  5G05 B;  4B7Y C;  2YUC A;  5TDW A;  2CKL A;  3LQH A;  3HCU A;  1ZBD B;  3SOW A;  2K17 A;  2YU4 A;  2CKL B;  5J3X A;  2ECG A;  3SOX A;  2I50 A;  2F42 A;  4CA1 A;  1Z2Q A;  4ZDT A;  5FB0 A;  2KGG A;  2K4D A;  2UZG A;  4YC9 A;  2FUU A;  4XI1 A;  3HCS A;  1WIM A;  3O35 A;  3ZPV E;  4FIP A;  4FJC A;  3DPL R;  2L5U A;  5C11 A;  1WEN A;  2MD8 C;  3DQV R;  4MVT A;  1HYI A;  4YAB A;  2LXP C;  4R2Y A;  2VJE A;  3N9N A;  4L7X A;  4WA6 A;  2E6S A;  2VJE B;  4S3O B;  2Y1M A;  3M62 A;  5H1V A;  3U5O A;  2CSZ A;  4R7E A;  4WZ3 B;  1T1H A;  1V87 A;  2KWK A;  2M6M A;  2KGI A;  2XB1 A;  4C9Z A;  3FL2 A;  3LQJ A;  4GNG A;  5B76 A;  1WEO A;  2LGK A;  2YW8 A;  3EB6 A;  5H9M A;  1WGM A;  2OXQ C;  1FBV A;  2FUI A;  2E6R A;  3O70 A;  4V3K C;  1WEV A;  2MUM A;  2XEU A;  3N9Q A;  1HYJ A;  4AP4 A;  3ZNI A;  2KFT A;  4YBM A;  2JMI A;  3KV5 A;  2LXH C;  2KWN A;  2YSJ A;  4X3G A;  2D8S A;  2F6N A;  2KU3 A;  3EB5 A;  5D1L B;  2ECJ A;  2LN0 A;  2ECI A;  2QIZ A;  4YBS A;  3O37 A;  3N9O A;  3MHH A;  5FEY A;  4ZQL A;  2YHN A;  4LAD B;  4UI9 B;  1X4I A;  1X4J A;  3GV4 A;  5AIT A;  2YYR A;  1WEP A;  2JRJ A;  3IHP A;  2K1J A;  2ECV A;  4B86 C;  2KIZ A;  2VPD A;  4L58 A;  4AYC A;  3I2D A;  2C2L A;  4W4U A;  5JG6 A;  2IDA A;  3M63 A;  4AYC B;  1WFK A;  2K16 A;  3RTR B;  5LKZ A;  2LQ6 A;  4N3W A;  3L1X A;  2MD7 B;  3C6W A;  5D1K B;  2VPG A;  3KNV A;  2L75 A;  5KH7 A;  4YAD A;  3RPG B;  1BOR A;  2Y1N A;  2ECN A;  1X4U A;  2HDP A;  2L43 A;  2VPE A;  3GL6 A;  1WEQ A;  5DKA A;  2PNX A;  1Z6U A;  4QF2 A;  1G25 A;  3ZVZ B;  1MM2 A;  1XWH A;  5TRB A;  2BAY A;  2M1R A;  2G45 A;  4PTB A;  3NG2 A;  2YUR A;  5TBN A;  4YBT A;  5KH9 A;  1LDJ B;  2MIQ A;  1WEU A;  4PPE A;  3VK6 A;  1IYM A;  2KWJ A;  3L1Z B;  2KRE A;  2MNY A;  5G0F A;  1RMD A;  2M85 A;  3L11 A;  2KE1 A;  4MSX A;  5C13 A;  4S3O C;  2YHO A;  2LRI C;  3PUQ A;  5B77 A;  1N87 A;  2VJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...