2D8UA

Solution structure of the b-box domain of the human tripartite motif-containing 63 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
GSSGSSGHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the B-box domain of the human tripartite motif-containing 63 protein
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin ligase TRIM63
total genus 5
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2d8uA01
2D8UA 2CSVA 5K3QA 2JUNA 2DJAA 3DDTA 2YVRA 3Q1DA 2EGMA
chains in the Genus database with same CATH superfamily
3ZNIA 4L58A 3DWDA 3O35A 4YADA 5LKZA 3DQVR 2MIQA 2D8SA 3N9NA 2LDRA 5H1TA 1DVPA 1WESA 4Z0RA 5TRBA 4OGEA 4GNFA 2F6NA 2ECIA 2IDAA 4S3OC 3FANA 2CSYA 4N3WA 2DSMA 2OWAA 3GV4A 2KKXA 4R7EA 4UP5A 1MM3A 5G05B 2QIZA 4OGCA 2FD4A 2JMIA 5DKAA 2AN6A 4F52B 2F42A 3SOXA 2LGVA 2G6QA 2K16A 1BORA 2CSZA 5I3LA 1WENA 4LK9A 5SVYA 4O64A 5G04B 2KKYA 1X4UA 1HYJA 2LQ6A 4QQ4A 2K1JA 3FJUB 3U5NA 4BHWA 2JMJA 1RMDA 1WE9A 2ECWA 2PUYA 3QZVA 1FP0A 3ZVYA 2MKEA 2CRWA 4GNEA 2JRJA 1WILA 2QJ0A 2XP0A 2L7PA 2PNXA 5H1VA 5TABA 2EGMA 1VFYA 2JM3A 4B86C 2MT5A 5KH9A 2B0OE 3RPGB 3FM8C 4A0CD 4GNGA 5D1LB 2E61A 2K4DA 3ASLA 4F1PA 1WGMA 3KQIA 1T1HA 1JM7B 3L1XA 2YT5A 1JM7A 3T6RA 2MNZA 4QF2A 3C5KA 3NG2A 4R8PK 3M99A 2IQJA 2YQMA 2JUNA 4C9ZA 3L1ZB 2VJFB 1LDJB 4TKPB 1LDKC 2VJFA 3PURA 4FJCA 3FL2A 1Z6UA 3KDEC 3T9KA 2XOYA 2M3HA 3I2DA 2C2LA 2K17A 2KWKA 1DCQA 2YHNA 3EB6A 2YQLA 3HCSA 1Z60A 4V3LC 2MD8C 2KGIA 1VYXA 2LN0A 4GB0A 4L7XA 2I50A 4FO9A 4XI1A 5SVIA 5G0FA 3T7LA 2H0DB 3M63A 2KGGA 2M13A 3M62A 2RI7A 4WA6A 2YSJA 2JMDA 3KNVA 4Q6FA 3DDTA 2LXHC 5TDRA 4YBSA 3LQHA 2C2VS 5LKXA 4IC3A 1Z2QA 4LADB 5LKTA 1F62A 2M1RA 1WEWA 5KH7A 3RTRB 2D8UA 5J3XA 1XWHA 3V43A 5EYAF 3N9MA 4AVXA 2VNFA 2NAAA 2XEUA 3LQJA 3EB5A 3VK6A 2MA5A 3HCUA 5AIUA 3GL6A 4UP0A 2KWNA 1WEPA 3ZPV1 3PLWA 3O47A 3E2DA 3U5OA 4WZ0A 3SOUA 2L5UA 4YABA 3O36A 1MBMA 5B79A 2LV9A 4BBQA 4A4BA 4W4UA 3LQIA 2VJEB 3LRQA 3LVQE 2FFWA 1JOCA 1FBVA 5FB1A 1WEMA 3MHHA 1X4IA 3SHBA 5FEYA 2E6SA 2MNYA 2VPBA 3SOWA 5K3QA 5TBNA 2EA6A 5SVXA 4ZQLA 2KIZA 3MDBC 5DINA 2G43A 2YVRA 4I7DA 3LVRE 2VP7A 3HCTA 2BAYA 2EODA 3KV5A 3Q1DA 2KR4A 2L80A 3HTKC 4CCGX 4YBTA 2XB1A 2MUMA 4V3KC 3M7KA 5TDWA 1MM2A 3N9PA 4WZ2A 3ZTGA 2CRRA 2YSMA 4FK5A 4ZUXU 1WEOA 1X4JA 2FSAA 5H9MA 5JG6A 3O34A 4AUQB 3ZYQA 2ZETC 2FUUA 3KV6A 4O62A 1WFKA 1ZBDB 2ECNA 3SUBA 2HYED 3O33A 1G25A 3C6WA 5D1MB 4YC9A 4S3OB 2YYRA 5B76A 2UZGA 3O7AA 4X3GA 4LKAA 3LJUX 3N9LA 2KWOA 4LLBA 5LCWB 3JUEA 1WEEA 2Y1NA 4QF3A 4AP4A 3O70A 1N87A 1WEQA 1K2FA 4YAXA 2L43A 2VJEA 1CHCA 4LJNA 1IYMA 4P5OB 2XOCA 5H1UA 2YUCA 2KE1A 2ECVA 5D1KB 2Y43A 4H9DA 5FB0A 2KREA 2ECTA 5AITA 2OXQC 4MVTA 2QICA 4UI9B 1VD4A 3PHDA 4Z0OA 2CKLA 2VPDA 2KWJA 4GNDA 2P57A 2EXUA 2VPEA 2DJAA 2YURA 3FAOA 4MSXA 4A49A 5B8DA 2MA6A 4WZ3B 4NN2A 2EGPA 4ZDTA 3LDYA 4PPEA 2FUIA 5KH3A 2YHOA 2L0BA 5B78A 4I7CA 2H0DA 5LKUA 2RSDA 4AYCB 2ECGA 2VPGA 2LRIC 3L11A 2KYUA 4IC2A 2M85A 3PUQA 1HYIA 2CSVA 2DX8A 4YATA 5B75A 1E4UA 3MHSA 2G45A 2XOZA 3U5PA 3N9QA 3H7HA 3RPGC 4I7BA 2KU3A 2YREA 4PTBA 3FEHA 3IHPA 2RR4A 2LXPC 2LGKA 1WEUA 2CONA 2KFTA 2ECJA 3DPLR 2LGGA 5B77A 3N9OA 5FERA 2L75A 1WIMA 3ZVZB 4CA1A 2YU4A 2Y1MA 1V87A 4YBMA 3ZPVE 3O37A 1WEVA 3U5MA 2CT2A 5SVIB 5C13A 4AYCA 4A4CA 2M6MA 1U6GB 4R2YA 4B7YC 2YW8A 4N4FA 4FIPA 2LAUA 2F6JA 2LGLA 5C11A 2E6RA 2MD7B 2HDPA 2CKLB
chains in the Genus database with same CATH topology
2JM3A 3LVRE 2IQJA 2OWAA 2JUNA 2XOZA 2KKXA 3DWDA 2KKYA 2B0OE 3Q1DA 3LDYA 3H7HA 4QQ4A 3FJUB 3FM8C 2YREA 2E61A 5K3QA 3PLWA 4O62A 3O47A 3E2DA 5SVIB 4Z0OA 5SVIA 3FEHA 3SUBA 4F1PA 2RR4A 4OGCA 2FD4A 2XOCA 5SVXA 3M7KA 2D8UA 2CONA 4Z0RA 3T9KA 3KDEC 2MKEA 2CRWA 2EXUA 2P57A 2DJAA 2XOYA 2M13A 3MDBC 4OGEA 2LAUA 3LJUX 4H9DA 2XP0A 3LVQE 2CRRA 1DCQA 2L7PA 2CSVA 2FFWA 3JUEA 3DDTA 2YVRA 2EGMA 5SVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8U A;  2CSV A;  5K3Q A;  2JUN A;  2DJA A;  3DDT A;  2YVR A;  3Q1D A;  2EGM A; 
#chains in the Genus database with same CATH topology
 3ZNI A;  4L58 A;  3DWD A;  3O35 A;  4YAD A;  5LKZ A;  3DQV R;  2MIQ A;  2D8S A;  3N9N A;  2LDR A;  5H1T A;  1DVP A;  1WES A;  4Z0R A;  5TRB A;  4OGE A;  4GNF A;  2F6N A;  2ECI A;  2IDA A;  4S3O C;  3FAN A;  2CSY A;  4N3W A;  2DSM A;  2OWA A;  3GV4 A;  2KKX A;  4R7E A;  4UP5 A;  1MM3 A;  5G05 B;  2QIZ A;  4OGC A;  2FD4 A;  2JMI A;  5DKA A;  2AN6 A;  4F52 B;  2F42 A;  3SOX A;  2LGV A;  2G6Q A;  2K16 A;  1BOR A;  2CSZ A;  5I3L A;  1WEN A;  4LK9 A;  5SVY A;  4O64 A;  5G04 B;  2KKY A;  1X4U A;  1HYJ A;  2LQ6 A;  4QQ4 A;  2K1J A;  3FJU B;  3U5N A;  4BHW A;  2JMJ A;  1RMD A;  1WE9 A;  2ECW A;  2PUY A;  3QZV A;  1FP0 A;  3ZVY A;  2MKE A;  2CRW A;  4GNE A;  2JRJ A;  1WIL A;  2QJ0 A;  2XP0 A;  2L7P A;  2PNX A;  5H1V A;  5TAB A;  2EGM A;  1VFY A;  2JM3 A;  4B86 C;  2MT5 A;  5KH9 A;  2B0O E;  3RPG B;  3FM8 C;  4A0C D;  4GNG A;  5D1L B;  2E61 A;  2K4D A;  3ASL A;  4F1P A;  1WGM A;  3KQI A;  1T1H A;  1JM7 B;  3L1X A;  2YT5 A;  1JM7 A;  3T6R A;  2MNZ A;  4QF2 A;  3C5K A;  3NG2 A;  4R8P K;  3M99 A;  2IQJ A;  2YQM A;  2JUN A;  4C9Z A;  3L1Z B;  2VJF B;  1LDJ B;  4TKP B;  1LDK C;  2VJF A;  3PUR A;  4FJC A;  3FL2 A;  1Z6U A;  3KDE C;  3T9K A;  2XOY A;  2M3H A;  3I2D A;  2C2L A;  2K17 A;  2KWK A;  1DCQ A;  2YHN A;  3EB6 A;  2YQL A;  3HCS A;  1Z60 A;  4V3L C;  2MD8 C;  2KGI A;  1VYX A;  2LN0 A;  4GB0 A;  4L7X A;  2I50 A;  4FO9 A;  4XI1 A;  5SVI A;  5G0F A;  3T7L A;  2H0D B;  3M63 A;  2KGG A;  2M13 A;  3M62 A;  2RI7 A;  4WA6 A;  2YSJ A;  2JMD A;  3KNV A;  4Q6F A;  3DDT A;  2LXH C;  5TDR A;  4YBS A;  3LQH A;  2C2V S;  5LKX A;  4IC3 A;  1Z2Q A;  4LAD B;  5LKT A;  1F62 A;  2M1R A;  1WEW A;  5KH7 A;  3RTR B;  2D8U A;  5J3X A;  1XWH A;  3V43 A;  5EYA F;  3N9M A;  4AVX A;  2VNF A;  2NAA A;  2XEU A;  3LQJ A;  3EB5 A;  3VK6 A;  2MA5 A;  3HCU A;  5AIU A;  3GL6 A;  4UP0 A;  2KWN A;  1WEP A;  3ZPV 1;  3PLW A;  3O47 A;  3E2D A;  3U5O A;  4WZ0 A;  3SOU A;  2L5U A;  4YAB A;  3O36 A;  1MBM A;  5B79 A;  2LV9 A;  4BBQ A;  4A4B A;  4W4U A;  3LQI A;  2VJE B;  3LRQ A;  3LVQ E;  2FFW A;  1JOC A;  1FBV A;  5FB1 A;  1WEM A;  3MHH A;  1X4I A;  3SHB A;  5FEY A;  2E6S A;  2MNY A;  2VPB A;  3SOW A;  5K3Q A;  5TBN A;  2EA6 A;  5SVX A;  4ZQL A;  2KIZ A;  3MDB C;  5DIN A;  2G43 A;  2YVR A;  4I7D A;  3LVR E;  2VP7 A;  3HCT A;  2BAY A;  2EOD A;  3KV5 A;  3Q1D A;  2KR4 A;  2L80 A;  3HTK C;  4CCG X;  4YBT A;  2XB1 A;  2MUM A;  4V3K C;  3M7K A;  5TDW A;  1MM2 A;  3N9P A;  4WZ2 A;  3ZTG A;  2CRR A;  2YSM A;  4FK5 A;  4ZUX U;  1WEO A;  1X4J A;  2FSA A;  5H9M A;  5JG6 A;  3O34 A;  4AUQ B;  3ZYQ A;  2ZET C;  2FUU A;  3KV6 A;  4O62 A;  1WFK A;  1ZBD B;  2ECN A;  3SUB A;  2HYE D;  3O33 A;  1G25 A;  3C6W A;  5D1M B;  4YC9 A;  4S3O B;  2YYR A;  5B76 A;  2UZG A;  3O7A A;  4X3G A;  4LKA A;  3LJU X;  3N9L A;  2KWO A;  4LLB A;  5LCW B;  3JUE A;  1WEE A;  2Y1N A;  4QF3 A;  4AP4 A;  3O70 A;  1N87 A;  1WEQ A;  1K2F A;  4YAX A;  2L43 A;  2VJE A;  1CHC A;  4LJN A;  1IYM A;  4P5O B;  2XOC A;  5H1U A;  2YUC A;  2KE1 A;  2ECV A;  5D1K B;  2Y43 A;  4H9D A;  5FB0 A;  2KRE A;  2ECT A;  5AIT A;  2OXQ C;  4MVT A;  2QIC A;  4UI9 B;  1VD4 A;  3PHD A;  4Z0O A;  2CKL A;  2VPD A;  2KWJ A;  4GND A;  2P57 A;  2EXU A;  2VPE A;  2DJA A;  2YUR A;  3FAO A;  4MSX A;  4A49 A;  5B8D A;  2MA6 A;  4WZ3 B;  4NN2 A;  2EGP A;  4ZDT A;  3LDY A;  4PPE A;  2FUI A;  5KH3 A;  2YHO A;  2L0B A;  5B78 A;  4I7C A;  2H0D A;  5LKU A;  2RSD A;  4AYC B;  2ECG A;  2VPG A;  2LRI C;  3L11 A;  2KYU A;  4IC2 A;  2M85 A;  3PUQ A;  1HYI A;  2CSV A;  2DX8 A;  4YAT A;  5B75 A;  1E4U A;  3MHS A;  2G45 A;  2XOZ A;  3U5P A;  3N9Q A;  3H7H A;  3RPG C;  4I7B A;  2KU3 A;  2YRE A;  4PTB A;  3FEH A;  3IHP A;  2RR4 A;  2LXP C;  2LGK A;  1WEU A;  2CON A;  2KFT A;  2ECJ A;  3DPL R;  2LGG A;  5B77 A;  3N9O A;  5FER A;  2L75 A;  1WIM A;  3ZVZ B;  4CA1 A;  2YU4 A;  2Y1M A;  1V87 A;  4YBM A;  3ZPV E;  3O37 A;  1WEV A;  3U5M A;  2CT2 A;  5SVI B;  5C13 A;  4AYC A;  4A4C A;  2M6M A;  1U6G B;  4R2Y A;  4B7Y C;  2YW8 A;  4N4F A;  4FIP A;  2LAU A;  2F6J A;  2LGL A;  5C11 A;  2E6R A;  2MD7 B;  2HDP A;  2CKL B; 
#chains in the Genus database with same CATH homology
 2JM3 A;  3LVR E;  2IQJ A;  2OWA A;  2JUN A;  2XOZ A;  2KKX A;  3DWD A;  2KKY A;  2B0O E;  3Q1D A;  3LDY A;  3H7H A;  4QQ4 A;  3FJU B;  3FM8 C;  2YRE A;  2E61 A;  5K3Q A;  3PLW A;  4O62 A;  3O47 A;  3E2D A;  5SVI B;  4Z0O A;  5SVI A;  3FEH A;  3SUB A;  4F1P A;  2RR4 A;  4OGC A;  2FD4 A;  2XOC A;  5SVX A;  3M7K A;  2D8U A;  2CON A;  4Z0R A;  3T9K A;  3KDE C;  2MKE A;  2CRW A;  2EXU A;  2P57 A;  2DJA A;  2XOY A;  2M13 A;  3MDB C;  4OGE A;  2LAU A;  3LJU X;  4H9D A;  2XP0 A;  3LVQ E;  2CRR A;  1DCQ A;  2L7P A;  2CSV A;  2FFW A;  3JUE A;  3DDT A;  2YVR A;  2EGM A;  5SVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...