2D8UA

Solution structure of the b-box domain of the human tripartite motif-containing 63 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
GSSGSSGHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin ligase TRIM63
publication title Solution structure of the B-box domain of the human tripartite motif-containing 63 protein
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 5
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2d8uA01
2EGMA 3Q1DA 3DDTA 2DJAA 2JUNA 2CSVA 2D8UA 5K3QA 2YVRA
chains in the Genus database with same CATH superfamily
2KWJA 2FD4A 2QIZA 5KH7A 2VPDA 3O47A 3SUBA 4P5OB 5D1KB 4R8PK 4WZ0A 3MHHA 2RSDA 2LXPC 2XEUA 3PLWA 4R2YA 4IC3A 3EB6A 1WEEA 2IQJA 3MDBC 5B8DA 2QJ0A 1VYXA 3H7HA 2CKLA 5KH9A 2L0BA 2LGLA 4I7BA 1HYIA 2BAYA 2FUIA 2MIQA 2YREA 2G43A 3N9OA 4ZQLA 3LJUX 2LN0A 3LDYA 4XI1A 2MA5A 3HCUA 2LRIC 3KV5A 4A0CD 2CRRA 2KIZA 1WE9A 2JM3A 2YVRA 4LJNA 4YAXA 2OXQC 1XWHA 2KWKA 4BBQA 2L80A 2IDAA 2B0OE 3LRQA 4PTBA 3DWDA 5KH3A 2L75A 2QICA 4N3WA 4N4FA 2YYRA 2C2LA 4MSXA 4A4BA 2ECWA 3LVRE 2CSZA 1MM2A 4ZDTA 2XB1A 2LGVA 5B77A 2G6QA 2F6JA 1VD4A 4FO9A 5LKXA 5FERA 1IYMA 2EODA 2K1JA 3N9QA 3SHBA 2ZETC 2I50A 1X4JA 2CSYA 2EXUA 2LDRA 3PURA 2XP0A 3N9LA 1K2FA 4FJCA 3FL2A 2YSJA 1DVPA 4AUQB 3O36A 1WEVA 2YUCA 1WEPA 1T1HA 2FSAA 3N9NA 4O64A 1Z60A 5G05B 2PNXA 3SOXA 4F52B 5SVIB 4YBMA 2KR4A 3O34A 1U6GB 3IHPA 4W4UA 2CT2A 2VPEA 2KREA 3M7KA 3FEHA 4V3LC 5C13A 3LQIA 3HCSA 3ZVYA 4LADB 2NAAA 5B78A 2M13A 3L1ZB 2Y1NA 2KGIA 2E61A 2MKEA 2HDPA 2KYUA 5TDRA 4L7XA 4A4CA 3ZVZB 5I3LA 4O62A 2YT5A 3FM8C 5FB0A 1N87A 2F42A 5FEYA 3ZPVE 3EB5A 5LKUA 2XOZA 2RI7A 2YHNA 1JM7B 2JMJA 3N9MA 2LGGA 1LDJB 1F62A 1WEMA 3DQVR 4YBTA 2KU3A 1CHCA 3O33A 2EA6A 4I7CA 3RPGC 4QQ4A 2YURA 1WEQA 2KWOA 3M62A 2RR4A 4L58A 4QF3A 4FK5A 1FP0A 3SOWA 3ZTGA 3T9KA 2Y1MA 5H1VA 3QZVA 2YU4A 4F1PA 3KQIA 4V3KC 4GNFA 1WFKA 2M6MA 2MD8C 2Y43A 5TBNA 2JMDA 2H0DB 2ECGA 5SVIA 3KNVA 2PUYA 1Z2QA 2VJEB 5TDWA 3LVQE 4FIPA 2C2VS 2E6RA 3KDEC 2FFWA 3T7LA 3Q1DA 1X4UA 2D8SA 3ZPV1 2AN6A 4AYCA 4Z0OA 1BORA 5J3XA 1LDKC 5DKAA 2P57A 4S3OC 3U5MA 4GNDA 3FAOA 3ZNIA 1Z6UA 3DDTA 3T6RA 2E6SA 4GNGA 3VK6A 4ZUXU 4LKAA 3RPGB 2G45A 5LKTA 5TABA 2YQLA 3JUEA 4GNEA 1V87A 1WENA 2DX8A 2ECTA 1WEUA 4A49A 5FB1A 5JG6A 2MNZA 2JUNA 4AYCB 3GV4A 2XOCA 3LQHA 3FANA 5B76A 3HCTA 5SVXA 2M85A 1JM7A 5LKZA 2DJAA 3E2DA 2OWAA 2VJFB 5SVYA 2ECVA 2K4DA 4OGCA 4Z0RA 2MD7B 2YSMA 4UP5A 2ECJA 5H1UA 4QF2A 4B86C 2CSVA 2D8UA 1WEWA 3FJUB 3N9PA 1HYJA 1X4IA 3C5KA 3I2DA 2M3HA 3NG2A 4UP0A 2L5UA 5B79A 3KV6A 1WEOA 2CRWA 2JMIA 2VPGA 3O35A 2KGGA 2YHOA 5B75A 2F6NA 1G25A 4LLBA 3DPLR 2LAUA 4S3OB 2H0DA 2CONA 4IC2A 2KKYA 2YW8A 3O7AA 4WA6A 5AITA 4NN2A 3HTKC 2DSMA 3SOUA 2VJEA 4Q6FA 3O37A 4GB0A 4CA1A 1JOCA 4C9ZA 5TRBA 2HYED 5K3QA 2KKXA 2EGMA 3MHSA 2KFTA 4YABA 3U5PA 2VNFA 2UZGA 1FBVA 2LQ6A 4MVTA 2ECIA 4UI9B 4AP4A 4I7DA 2ECNA 3C6WA 3O70A 5D1LB 2VPBA 1MM3A 2L43A 5H9MA 1E4UA 2LV9A 2CKLB 2FUUA 5D1MB 2M1RA 3GL6A 3ASLA 2VP7A 1DCQA 2EGPA 4YC9A 5DINA 4X3GA 2LXHC 3L11A 3RTRB 1ZBDB 4R7EA 3PHDA 1MBMA 2MUMA 3M63A 3U5OA 4H9DA 4YATA 2VJFA 4WZ2A 2YQMA 5EYAF 4TKPB 4YBSA 4PPEA 1VFYA 2JRJA 5G04B 5AIUA 3V43A 1WILA 2MNYA 1WIMA 5C11A 2MT5A 4AVXA 3M99A 4CCGX 4YADA 3U5NA 5LCWB 1RMDA 3PUQA 4LK9A 4WZ3B 2K17A 3LQJA 5G0FA 4OGEA 2KWNA 1WGMA 4B7YC 2MA6A 5H1TA 2KE1A 2K16A 3L1XA 2XOYA 3ZYQA 2LGKA 4BHWA 1WESA 2L7PA
chains in the Genus database with same CATH topology
4H9DA 2P57A 2FD4A 2JUNA 5SVIA 2XOCA 2CRWA 5K3QA 5SVXA 2RR4A 4OGEA 2B0OE 2KKXA 2EGMA 3O47A 3DDTA 2DJAA 3LVQE 3E2DA 3SUBA 2OWAA 5SVIB 5SVYA 2YREA 4OGCA 2XOZA 4Z0RA 3KDEC 2M13A 1DCQA 3DWDA 2FFWA 3T9KA 2EXUA 3Q1DA 3LJUX 2CSVA 2D8UA 3FJUB 2E61A 4F1PA 2MKEA 3PLWA 2XOYA 2LAUA 2XP0A 3JUEA 3LDYA 2CONA 2KKYA 4Z0OA 3M7KA 3LVRE 2IQJA 2CRRA 3FEHA 3MDBC 4O62A 4QQ4A 2L7PA 3FM8C 2JM3A 2YVRA 3H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGM A;  3Q1D A;  3DDT A;  2DJA A;  2JUN A;  2CSV A;  2D8U A;  5K3Q A;  2YVR A; 
#chains in the Genus database with same CATH topology
 2KWJ A;  2FD4 A;  2QIZ A;  5KH7 A;  2VPD A;  3O47 A;  3SUB A;  4P5O B;  5D1K B;  4R8P K;  4WZ0 A;  3MHH A;  2RSD A;  2LXP C;  2XEU A;  3PLW A;  4R2Y A;  4IC3 A;  3EB6 A;  1WEE A;  2IQJ A;  3MDB C;  5B8D A;  2QJ0 A;  1VYX A;  3H7H A;  2CKL A;  5KH9 A;  2L0B A;  2LGL A;  4I7B A;  1HYI A;  2BAY A;  2FUI A;  2MIQ A;  2YRE A;  2G43 A;  3N9O A;  4ZQL A;  3LJU X;  2LN0 A;  3LDY A;  4XI1 A;  2MA5 A;  3HCU A;  2LRI C;  3KV5 A;  4A0C D;  2CRR A;  2KIZ A;  1WE9 A;  2JM3 A;  2YVR A;  4LJN A;  4YAX A;  2OXQ C;  1XWH A;  2KWK A;  4BBQ A;  2L80 A;  2IDA A;  2B0O E;  3LRQ A;  4PTB A;  3DWD A;  5KH3 A;  2L75 A;  2QIC A;  4N3W A;  4N4F A;  2YYR A;  2C2L A;  4MSX A;  4A4B A;  2ECW A;  3LVR E;  2CSZ A;  1MM2 A;  4ZDT A;  2XB1 A;  2LGV A;  5B77 A;  2G6Q A;  2F6J A;  1VD4 A;  4FO9 A;  5LKX A;  5FER A;  1IYM A;  2EOD A;  2K1J A;  3N9Q A;  3SHB A;  2ZET C;  2I50 A;  1X4J A;  2CSY A;  2EXU A;  2LDR A;  3PUR A;  2XP0 A;  3N9L A;  1K2F A;  4FJC A;  3FL2 A;  2YSJ A;  1DVP A;  4AUQ B;  3O36 A;  1WEV A;  2YUC A;  1WEP A;  1T1H A;  2FSA A;  3N9N A;  4O64 A;  1Z60 A;  5G05 B;  2PNX A;  3SOX A;  4F52 B;  5SVI B;  4YBM A;  2KR4 A;  3O34 A;  1U6G B;  3IHP A;  4W4U A;  2CT2 A;  2VPE A;  2KRE A;  3M7K A;  3FEH A;  4V3L C;  5C13 A;  3LQI A;  3HCS A;  3ZVY A;  4LAD B;  2NAA A;  5B78 A;  2M13 A;  3L1Z B;  2Y1N A;  2KGI A;  2E61 A;  2MKE A;  2HDP A;  2KYU A;  5TDR A;  4L7X A;  4A4C A;  3ZVZ B;  5I3L A;  4O62 A;  2YT5 A;  3FM8 C;  5FB0 A;  1N87 A;  2F42 A;  5FEY A;  3ZPV E;  3EB5 A;  5LKU A;  2XOZ A;  2RI7 A;  2YHN A;  1JM7 B;  2JMJ A;  3N9M A;  2LGG A;  1LDJ B;  1F62 A;  1WEM A;  3DQV R;  4YBT A;  2KU3 A;  1CHC A;  3O33 A;  2EA6 A;  4I7C A;  3RPG C;  4QQ4 A;  2YUR A;  1WEQ A;  2KWO A;  3M62 A;  2RR4 A;  4L58 A;  4QF3 A;  4FK5 A;  1FP0 A;  3SOW A;  3ZTG A;  3T9K A;  2Y1M A;  5H1V A;  3QZV A;  2YU4 A;  4F1P A;  3KQI A;  4V3K C;  4GNF A;  1WFK A;  2M6M A;  2MD8 C;  2Y43 A;  5TBN A;  2JMD A;  2H0D B;  2ECG A;  5SVI A;  3KNV A;  2PUY A;  1Z2Q A;  2VJE B;  5TDW A;  3LVQ E;  4FIP A;  2C2V S;  2E6R A;  3KDE C;  2FFW A;  3T7L A;  3Q1D A;  1X4U A;  2D8S A;  3ZPV 1;  2AN6 A;  4AYC A;  4Z0O A;  1BOR A;  5J3X A;  1LDK C;  5DKA A;  2P57 A;  4S3O C;  3U5M A;  4GND A;  3FAO A;  3ZNI A;  1Z6U A;  3DDT A;  3T6R A;  2E6S A;  4GNG A;  3VK6 A;  4ZUX U;  4LKA A;  3RPG B;  2G45 A;  5LKT A;  5TAB A;  2YQL A;  3JUE A;  4GNE A;  1V87 A;  1WEN A;  2DX8 A;  2ECT A;  1WEU A;  4A49 A;  5FB1 A;  5JG6 A;  2MNZ A;  2JUN A;  4AYC B;  3GV4 A;  2XOC A;  3LQH A;  3FAN A;  5B76 A;  3HCT A;  5SVX A;  2M85 A;  1JM7 A;  5LKZ A;  2DJA A;  3E2D A;  2OWA A;  2VJF B;  5SVY A;  2ECV A;  2K4D A;  4OGC A;  4Z0R A;  2MD7 B;  2YSM A;  4UP5 A;  2ECJ A;  5H1U A;  4QF2 A;  4B86 C;  2CSV A;  2D8U A;  1WEW A;  3FJU B;  3N9P A;  1HYJ A;  1X4I A;  3C5K A;  3I2D A;  2M3H A;  3NG2 A;  4UP0 A;  2L5U A;  5B79 A;  3KV6 A;  1WEO A;  2CRW A;  2JMI A;  2VPG A;  3O35 A;  2KGG A;  2YHO A;  5B75 A;  2F6N A;  1G25 A;  4LLB A;  3DPL R;  2LAU A;  4S3O B;  2H0D A;  2CON A;  4IC2 A;  2KKY A;  2YW8 A;  3O7A A;  4WA6 A;  5AIT A;  4NN2 A;  3HTK C;  2DSM A;  3SOU A;  2VJE A;  4Q6F A;  3O37 A;  4GB0 A;  4CA1 A;  1JOC A;  4C9Z A;  5TRB A;  2HYE D;  5K3Q A;  2KKX A;  2EGM A;  3MHS A;  2KFT A;  4YAB A;  3U5P A;  2VNF A;  2UZG A;  1FBV A;  2LQ6 A;  4MVT A;  2ECI A;  4UI9 B;  4AP4 A;  4I7D A;  2ECN A;  3C6W A;  3O70 A;  5D1L B;  2VPB A;  1MM3 A;  2L43 A;  5H9M A;  1E4U A;  2LV9 A;  2CKL B;  2FUU A;  5D1M B;  2M1R A;  3GL6 A;  3ASL A;  2VP7 A;  1DCQ A;  2EGP A;  4YC9 A;  5DIN A;  4X3G A;  2LXH C;  3L11 A;  3RTR B;  1ZBD B;  4R7E A;  3PHD A;  1MBM A;  2MUM A;  3M63 A;  3U5O A;  4H9D A;  4YAT A;  2VJF A;  4WZ2 A;  2YQM A;  5EYA F;  4TKP B;  4YBS A;  4PPE A;  1VFY A;  2JRJ A;  5G04 B;  5AIU A;  3V43 A;  1WIL A;  2MNY A;  1WIM A;  5C11 A;  2MT5 A;  4AVX A;  3M99 A;  4CCG X;  4YAD A;  3U5N A;  5LCW B;  1RMD A;  3PUQ A;  4LK9 A;  4WZ3 B;  2K17 A;  3LQJ A;  5G0F A;  4OGE A;  2KWN A;  1WGM A;  4B7Y C;  2MA6 A;  5H1T A;  2KE1 A;  2K16 A;  3L1X A;  2XOY A;  3ZYQ A;  2LGK A;  4BHW A;  1WES A;  2L7P A; 
#chains in the Genus database with same CATH homology
 4H9D A;  2P57 A;  2FD4 A;  2JUN A;  5SVI A;  2XOC A;  2CRW A;  5K3Q A;  5SVX A;  2RR4 A;  4OGE A;  2B0O E;  2KKX A;  2EGM A;  3O47 A;  3DDT A;  2DJA A;  3LVQ E;  3E2D A;  3SUB A;  2OWA A;  5SVI B;  5SVY A;  2YRE A;  4OGC A;  2XOZ A;  4Z0R A;  3KDE C;  2M13 A;  1DCQ A;  3DWD A;  2FFW A;  3T9K A;  2EXU A;  3Q1D A;  3LJU X;  2CSV A;  2D8U A;  3FJU B;  2E61 A;  4F1P A;  2MKE A;  3PLW A;  2XOY A;  2LAU A;  2XP0 A;  3JUE A;  3LDY A;  2CON A;  2KKY A;  4Z0O A;  3M7K A;  3LVR E;  2IQJ A;  2CRR A;  3FEH A;  3MDB C;  4O62 A;  4QQ4 A;  2L7P A;  3FM8 C;  2JM3 A;  2YVR A;  3H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...