2D8UA

Solution structure of the b-box domain of the human tripartite motif-containing 63 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
b'GSSGSSGHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin ligase TRIM63
publication title Solution structure of the B-box domain of the human tripartite motif-containing 63 protein
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 5
structure length 64
sequence length 64
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2d8uA01
3DDTA 3Q1DA 5K3QA 2EGMA 2D8UA 2JUNA 2YVRA 2DJAA 2CSVA
chains in the Genus database with same CATH superfamily
2CT2A 5B78A 3LQIA 3M99A 2CSZA 4GNFA 1G25A 4I7DA 2M13A 2YURA 2YREA 5LKUA 3DWDA 1N87A 3LDYA 2MKEA 2VJFA 2XOYA 2QJ0A 3LJUX 3SOUA 4S3OB 5FB0A 2VJEA 2EODA 4XI1A 5FERA 2M3HA 5DINA 2H0DB 4A4CA 2VJFB 4AYCB 3KQIA 3VK6A 4WZ0A 2JMDA 4TKPB 2KGIA 2IDAA 1WILA 4YBTA 5DKAA 2FSAA 2ECIA 3EB6A 1VFYA 5LKXA 2UZGA 2EGPA 3KV6A 1XWHA 2BAYA 4I7CA 2RR4A 4UI9B 5C11A 3HTKC 1WENA 2QICA 2ECVA 4V3LC 1VD4A 2ECJA 4R2YA 5TABA 2K16A 3U5OA 4LLBA 2PUYA 4N3WA 5TBNA 4YADA 3N9QA 2KREA 2AN6A 2LGKA 1Z2QA 5H1UA 2YVRA 4LK9A 4YBSA 2JMJA 2ECTA 2LXHC 3V43A 4FIPA 2NAAA 2VP7A 2G6QA 3PURA 2LGGA 4UP0A 2LDRA 3T7LA 2XB1A 2YT5A 2L43A 3E2DA 4OGEA 3ZPVE 3FAOA 4N4FA 3O35A 4YABA 4R7EA 2B0OE 2MT5A 1WEMA 1MBMA 2EXUA 3RTRB 2KU3A 1LDKC 2EA6A 2LRIC 1WGMA 2Y1NA 4AUQB 2K17A 4FJCA 5D1KB 3ZPV1 2HDPA 2Y1MA 5H9MA 5B75A 2DX8A 3O34A 3MHSA 4F1PA 2CONA 3O47A 3L1ZB 5C13A 2MD7B 3Q1DA 3LVRE 4L58A 1WEQA 5KH3A 3DQVR 5B79A 2MD8C 1MM2A 2KWJA 4W4UA 4S3OC 2PNXA 1F62A 5TDRA 1T1HA 3HCTA 4PPEA 2OXQC 4YAXA 2C2VS 4QF3A 4A0CD 2KKXA 4WZ2A 4ZQLA 1IYMA 1Z60A 3N9NA 2DSMA 3N9LA 4V3KC 5K3QA 3U5PA 2VJEB 5D1MB 5B77A 4CA1A 2CSYA 4AP4A 2EGMA 2VPDA 2LXPC 2CRWA 2KKYA 2LQ6A 2P57A 2FUIA 4LADB 2MNYA 4F52B 2DJAA 3T6RA 5G0FA 2YHNA 2JRJA 3O70A 5J3XA 2XEUA 2K4DA 2VPBA 2YYRA 2F6JA 4YATA 2L5UA 4MVTA 2MUMA 3FEHA 3GV4A 3QZVA 3JUEA 2KGGA 4A49A 2IQJA 2YHOA 5LKZA 1BORA 2LGVA 3M62A 4GNGA 2YSJA 1JM7A 5SVYA 2VPEA 3IHPA 5I3LA 4ZUXU 3O37A 1WEPA 4NN2A 1WIMA 2KIZA 1RMDA 2XOCA 1X4IA 2Y43A 1JM7B 2JUNA 2LGLA 2KR4A 1HYIA 4OGCA 4BHWA 1HYJA 5SVXA 2YQLA 2MA5A 3MDBC 2M1RA 1K2FA 2D8UA 4QF2A 2QIZA 2CKLA 3SHBA 5D1LB 2KWNA 4O62A 2JMIA 1WEUA 4I7BA 1U6GB 4YC9A 2MIQA 3C6WA 2YW8A 2KWKA 3DPLR 4WA6A 2YSMA 3O7AA 3DDTA 3HCSA 3KV5A 3FANA 4LJNA 4PTBA 4H9DA 4LKAA 1WE9A 3M7KA 4FK5A 1E4UA 4B86C 2M85A 4GB0A 5AIUA 1WEWA 2KYUA 3L11A 2VPGA 2ECWA 2D8SA 5LKTA 3LQJA 1X4JA 5EYAF 2L75A 3RPGB 3T9KA 2MNZA 3ASLA 4O64A 4B7YC 1WESA 5B8DA 4X3GA 2VNFA 4GNDA 1ZBDB 3ZNIA 3HCUA 2F6NA 2ZETC 3FJUB 4IC3A 2LAUA 4C9ZA 2K1JA 2YQMA 3KNVA 3SOWA 3FL2A 2KFTA 1MM3A 2HYED 2YUCA 3GL6A 4A4BA 3N9PA 3N9MA 3KDEC 3SOXA 3NG2A 5G05B 3PLWA 2LN0A 1Z6UA 2H0DA 3LRQA 5G04B 5B76A 2F42A 4AYCA 3ZTGA 3EB5A 3PHDA 3O36A 4ZDTA 2OWAA 1VYXA 2L7PA 2C2LA 1FP0A 4L7XA 5H1VA 2RSDA 3H7HA 1FBVA 1DCQA 2G45A 4YBMA 4WZ3B 2E6SA 5FB1A 1JOCA 4R8PK 4UP5A 2E61A 1V87A 4FO9A 2KE1A 5SVIA 1WEEA 3FM8C 5TDWA 2MA6A 3U5MA 5SVIB 3MHHA 3ZYQA 3O33A 2XP0A 5FEYA 5KH9A 2FD4A 4Q6FA 1CHCA 2CRRA 2ECNA 4MSXA 5KH7A 5H1TA 2YU4A 1DVPA 4GNEA 2M6MA 4BBQA 1WEVA 2ECGA 2L0BA 2CKLB 2FUUA 2G43A 3M63A 1X4UA 3C5KA 3L1XA 2JM3A 3ZVYA 4AVXA 2XOZA 5AITA 3U5NA 4P5OB 2L80A 2I50A 3LQHA 3LVQE 2E6RA 5JG6A 2RI7A 2FFWA 3I2DA 3RPGC 4CCGX 2KWOA 4Z0RA 5TRBA 3PUQA 1WEOA 1LDJB 1WFKA 5LCWB 3SUBA 3ZVZB 4QQ4A 4IC2A 2CSVA 2LV9A 4Z0OA 3N9OA
chains in the Genus database with same CATH topology
2P57A 3LVQE 2FD4A 3LJUX 2CRRA 5SVYA 2FFWA 2OWAA 4O62A 2DJAA 3E2DA 4OGEA 2RR4A 4F1PA 2XP0A 4Z0RA 2CONA 2XOCA 2E61A 3O47A 2L7PA 2KKXA 2JUNA 4OGCA 3T9KA 2B0OE 5SVIA 3FJUB 3DDTA 3FM8C 3Q1DA 3LVRE 2EXUA 3KDEC 2M13A 5K3QA 2YREA 4QQ4A 3SUBA 2JM3A 2YVRA 3H7HA 5SVXA 3DWDA 2CSVA 4H9DA 3PLWA 3FEHA 3LDYA 3M7KA 1DCQA 3JUEA 2MKEA 3MDBC 2EGMA 2IQJA 2D8UA 4Z0OA 2XOZA 5SVIB 2CRWA 2XOYA 2LAUA 2KKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDT A;  3Q1D A;  5K3Q A;  2EGM A;  2D8U A;  2JUN A;  2YVR A;  2DJA A;  2CSV A; 
#chains in the Genus database with same CATH topology
 2CT2 A;  5B78 A;  3LQI A;  3M99 A;  2CSZ A;  4GNF A;  1G25 A;  4I7D A;  2M13 A;  2YUR A;  2YRE A;  5LKU A;  3DWD A;  1N87 A;  3LDY A;  2MKE A;  2VJF A;  2XOY A;  2QJ0 A;  3LJU X;  3SOU A;  4S3O B;  5FB0 A;  2VJE A;  2EOD A;  4XI1 A;  5FER A;  2M3H A;  5DIN A;  2H0D B;  4A4C A;  2VJF B;  4AYC B;  3KQI A;  3VK6 A;  4WZ0 A;  2JMD A;  4TKP B;  2KGI A;  2IDA A;  1WIL A;  4YBT A;  5DKA A;  2FSA A;  2ECI A;  3EB6 A;  1VFY A;  5LKX A;  2UZG A;  2EGP A;  3KV6 A;  1XWH A;  2BAY A;  4I7C A;  2RR4 A;  4UI9 B;  5C11 A;  3HTK C;  1WEN A;  2QIC A;  2ECV A;  4V3L C;  1VD4 A;  2ECJ A;  4R2Y A;  5TAB A;  2K16 A;  3U5O A;  4LLB A;  2PUY A;  4N3W A;  5TBN A;  4YAD A;  3N9Q A;  2KRE A;  2AN6 A;  2LGK A;  1Z2Q A;  5H1U A;  2YVR A;  4LK9 A;  4YBS A;  2JMJ A;  2ECT A;  2LXH C;  3V43 A;  4FIP A;  2NAA A;  2VP7 A;  2G6Q A;  3PUR A;  2LGG A;  4UP0 A;  2LDR A;  3T7L A;  2XB1 A;  2YT5 A;  2L43 A;  3E2D A;  4OGE A;  3ZPV E;  3FAO A;  4N4F A;  3O35 A;  4YAB A;  4R7E A;  2B0O E;  2MT5 A;  1WEM A;  1MBM A;  2EXU A;  3RTR B;  2KU3 A;  1LDK C;  2EA6 A;  2LRI C;  1WGM A;  2Y1N A;  4AUQ B;  2K17 A;  4FJC A;  5D1K B;  3ZPV 1;  2HDP A;  2Y1M A;  5H9M A;  5B75 A;  2DX8 A;  3O34 A;  3MHS A;  4F1P A;  2CON A;  3O47 A;  3L1Z B;  5C13 A;  2MD7 B;  3Q1D A;  3LVR E;  4L58 A;  1WEQ A;  5KH3 A;  3DQV R;  5B79 A;  2MD8 C;  1MM2 A;  2KWJ A;  4W4U A;  4S3O C;  2PNX A;  1F62 A;  5TDR A;  1T1H A;  3HCT A;  4PPE A;  2OXQ C;  4YAX A;  2C2V S;  4QF3 A;  4A0C D;  2KKX A;  4WZ2 A;  4ZQL A;  1IYM A;  1Z60 A;  3N9N A;  2DSM A;  3N9L A;  4V3K C;  5K3Q A;  3U5P A;  2VJE B;  5D1M B;  5B77 A;  4CA1 A;  2CSY A;  4AP4 A;  2EGM A;  2VPD A;  2LXP C;  2CRW A;  2KKY A;  2LQ6 A;  2P57 A;  2FUI A;  4LAD B;  2MNY A;  4F52 B;  2DJA A;  3T6R A;  5G0F A;  2YHN A;  2JRJ A;  3O70 A;  5J3X A;  2XEU A;  2K4D A;  2VPB A;  2YYR A;  2F6J A;  4YAT A;  2L5U A;  4MVT A;  2MUM A;  3FEH A;  3GV4 A;  3QZV A;  3JUE A;  2KGG A;  4A49 A;  2IQJ A;  2YHO A;  5LKZ A;  1BOR A;  2LGV A;  3M62 A;  4GNG A;  2YSJ A;  1JM7 A;  5SVY A;  2VPE A;  3IHP A;  5I3L A;  4ZUX U;  3O37 A;  1WEP A;  4NN2 A;  1WIM A;  2KIZ A;  1RMD A;  2XOC A;  1X4I A;  2Y43 A;  1JM7 B;  2JUN A;  2LGL A;  2KR4 A;  1HYI A;  4OGC A;  4BHW A;  1HYJ A;  5SVX A;  2YQL A;  2MA5 A;  3MDB C;  2M1R A;  1K2F A;  2D8U A;  4QF2 A;  2QIZ A;  2CKL A;  3SHB A;  5D1L B;  2KWN A;  4O62 A;  2JMI A;  1WEU A;  4I7B A;  1U6G B;  4YC9 A;  2MIQ A;  3C6W A;  2YW8 A;  2KWK A;  3DPL R;  4WA6 A;  2YSM A;  3O7A A;  3DDT A;  3HCS A;  3KV5 A;  3FAN A;  4LJN A;  4PTB A;  4H9D A;  4LKA A;  1WE9 A;  3M7K A;  4FK5 A;  1E4U A;  4B86 C;  2M85 A;  4GB0 A;  5AIU A;  1WEW A;  2KYU A;  3L11 A;  2VPG A;  2ECW A;  2D8S A;  5LKT A;  3LQJ A;  1X4J A;  5EYA F;  2L75 A;  3RPG B;  3T9K A;  2MNZ A;  3ASL A;  4O64 A;  4B7Y C;  1WES A;  5B8D A;  4X3G A;  2VNF A;  4GND A;  1ZBD B;  3ZNI A;  3HCU A;  2F6N A;  2ZET C;  3FJU B;  4IC3 A;  2LAU A;  4C9Z A;  2K1J A;  2YQM A;  3KNV A;  3SOW A;  3FL2 A;  2KFT A;  1MM3 A;  2HYE D;  2YUC A;  3GL6 A;  4A4B A;  3N9P A;  3N9M A;  3KDE C;  3SOX A;  3NG2 A;  5G05 B;  3PLW A;  2LN0 A;  1Z6U A;  2H0D A;  3LRQ A;  5G04 B;  5B76 A;  2F42 A;  4AYC A;  3ZTG A;  3EB5 A;  3PHD A;  3O36 A;  4ZDT A;  2OWA A;  1VYX A;  2L7P A;  2C2L A;  1FP0 A;  4L7X A;  5H1V A;  2RSD A;  3H7H A;  1FBV A;  1DCQ A;  2G45 A;  4YBM A;  4WZ3 B;  2E6S A;  5FB1 A;  1JOC A;  4R8P K;  4UP5 A;  2E61 A;  1V87 A;  4FO9 A;  2KE1 A;  5SVI A;  1WEE A;  3FM8 C;  5TDW A;  2MA6 A;  3U5M A;  5SVI B;  3MHH A;  3ZYQ A;  3O33 A;  2XP0 A;  5FEY A;  5KH9 A;  2FD4 A;  4Q6F A;  1CHC A;  2CRR A;  2ECN A;  4MSX A;  5KH7 A;  5H1T A;  2YU4 A;  1DVP A;  4GNE A;  2M6M A;  4BBQ A;  1WEV A;  2ECG A;  2L0B A;  2CKL B;  2FUU A;  2G43 A;  3M63 A;  1X4U A;  3C5K A;  3L1X A;  2JM3 A;  3ZVY A;  4AVX A;  2XOZ A;  5AIT A;  3U5N A;  4P5O B;  2L80 A;  2I50 A;  3LQH A;  3LVQ E;  2E6R A;  5JG6 A;  2RI7 A;  2FFW A;  3I2D A;  3RPG C;  4CCG X;  2KWO A;  4Z0R A;  5TRB A;  3PUQ A;  1WEO A;  1LDJ B;  1WFK A;  5LCW B;  3SUB A;  3ZVZ B;  4QQ4 A;  4IC2 A;  2CSV A;  2LV9 A;  4Z0O A;  3N9O A; 
#chains in the Genus database with same CATH homology
 2P57 A;  3LVQ E;  2FD4 A;  3LJU X;  2CRR A;  5SVY A;  2FFW A;  2OWA A;  4O62 A;  2DJA A;  3E2D A;  4OGE A;  2RR4 A;  4F1P A;  2XP0 A;  4Z0R A;  2CON A;  2XOC A;  2E61 A;  3O47 A;  2L7P A;  2KKX A;  2JUN A;  4OGC A;  3T9K A;  2B0O E;  5SVI A;  3FJU B;  3DDT A;  3FM8 C;  3Q1D A;  3LVR E;  2EXU A;  3KDE C;  2M13 A;  5K3Q A;  2YRE A;  4QQ4 A;  3SUB A;  2JM3 A;  2YVR A;  3H7H A;  5SVX A;  3DWD A;  2CSV A;  4H9D A;  3PLW A;  3FEH A;  3LDY A;  3M7K A;  1DCQ A;  3JUE A;  2MKE A;  3MDB C;  2EGM A;  2IQJ A;  2D8U A;  4Z0O A;  2XOZ A;  5SVI B;  2CRW A;  2XOY A;  2LAU A;  2KKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...