2VP7A

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKFFHRICTGMTETAYGLLTAEASAVWGCDTCMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vp7A00
4V3LC 4P5OB 2L75A 2L80A 5LKTA 4LLBA 2M1RA 2VPDA 4W4UA 3LQIA 1G25A 2YT5A 1MM2A 3RPGC 3U5NA 2ZETC 1HYIA 2MT5A 2IDAA 2KE1A 2C2LA 3LQJA 3EB5A 1VD4A 5TRBA 4FK5A 4AUQB 1X4IA 3ZPV1 1DVPA 5TDWA 2EODA 5TDRA 3FL2A 1X4UA 2M3HA 2KR4A 2CKLB 2LXHC 1WENA 2KWNA 2Y1MA 5KH3A 1N87A 5D1MB 2MA5A 4X3GA 5B77A 4PPEA 3O34A 2ECJA 2KIZA 3PUQA 5H1UA 3O7AA 2KGIA 2CSZA 5FERA 5LKXA 4YBSA 4I7DA 2VPEA 4BHWA 4YC9A 1FP0A 2HDPA 3N9NA 2HYED 3LRQA 2JMIA 3HCSA 2MNZA 2C2VS 1K2FA 2KWKA 4L58A 2E6RA 4GNGA 2VP7A 2RSDA 1RMDA 4XI1A 1WIMA 2K4DA 5FEYA 4CA1A 1CHCA 2LN0A 2FSAA 3N9QA 1IYMA 3SHBA 4F52B 2ECIA 5AITA 5DINA 3HCUA 1LDJB 2ECNA 2L5UA 4V3KC 5LKUA 2NAAA 5FB1A 3RTRB 5LKZA 2YURA 2MNYA 4YBTA 5C13A 5C11A 2Y1NA 4A4CA 3KNVA 3SOXA 4GNEA 2ECGA 2M6MA 4PTBA 3MHHA 5B78A 3N9OA 1WEOA 4FO9A 3SOUA 4IC3A 5KH9A 3N9PA 3GV4A 3M63A 2LGKA 4MSXA 4S3OB 4TKPB 4C9ZA 2I50A 4YBMA 4CCGX 2MD7B 4A0CD 2K17A 2G43A 2F42A 1WEQA 5D1KB 3PHDA 3KV5A 5B75A 2YQLA 2VJEA 3L1XA 3N9LA 5G0FA 4IC2A 3DPLR 2YQMA 4R2YA 2L43A 4GB0A 4MVTA 4FIPA 2LGVA 4UI9B 2KU3A 2KWOA 3LQHA 1Z2QA 3O36A 1JM7A 4UP0A 3I2DA 2KYUA 2YHOA 4GNFA 2G45A 4QF3A 5B79A 2L0BA 1F62A 4YABA 4LKAA 2QJ0A 1BORA 2YREA 5FB0A 5H1VA 4WZ3B 3IHPA 2VJEB 4N3WA 2LRIC 4S3OC 4LADB 4FJCA 2XB1A 4NN2A 2XEUA 3DQVR 2ECVA 4A4BA 2UZGA 3O37A 2MUMA 4QF2A 4AYCA 2KWJA 1JM7B 1T1HA 2F6NA 5I3LA 3GL6A 2LDRA 2PNXA 5LCWB 4AVXA 2YSJA 2D8SA 4UP5A 3VK6A 3KV6A 5TABA 2MA6A 1WEEA 3U5OA 1WILA 5KH7A 1U6GB 2EA6A 4B7YC 3HCTA 3C6WA 3V43A 5H9MA 1MM3A 4N4FA 2VPBA 3SOWA 3KQIA 2H0DB 4A49A 5DKAA 4AYCB 4ZQLA 2YHNA 2ECWA 5D1LB 2LGLA 3O35A 2JMDA 1WEPA 2F6JA 3ZTGA 2ECTA 2MIQA 4I7BA 3T6RA 3T7LA 3ZVYA 4YADA 1JOCA 2DX8A 4ZDTA 5H1TA 2QICA 1XWHA 3QZVA 4R8PK 2VJFB 3ASLA 1WEUA 1WESA 3M99A 3N9MA 2EGPA 5TBNA 2YSMA 1WGMA 2VPGA 3HTKC 2CT2A 4B86C 3C5KA 1Z60A 2JRJA 5G04B 2FUIA 3ZYQA 2LXPC 3O33A 1Z6UA 3M62A 3L11A 3PURA 2YW8A 3NG2A 4O64A 1HYJA 5JG6A 2KFTA 3U5PA 2VNFA 1WEWA 5EYAF 2LQ6A 2CSYA 2Y43A 3MHSA 3U5MA 5B8DA 1WEVA 3EB6A 4YAXA 2OXQC 2LV9A 4AP4A 1WFKA 3RPGB 4Q6FA 3ZVZB 4WZ2A 3ZNIA 2M85A 2H0DA 4ZUXU 3O70A 4L7XA 2MD8C 2AN6A 1E4UA 1X4JA 2RI7A 2G6QA 2BAYA 5J3XA 3L1ZB 2E6SA 2K16A 2JMJA 3ZPVE 2KGGA 4BBQA 1FBVA 2VJFA 2PUYA 4LK9A 5AIUA 4WZ0A 5B76A 4LJNA 1WE9A 1ZBDB 2YYRA 2QIZA 1WEMA 1LDKC 1VYXA 4WA6A 2YUCA 4GNDA 1VFYA 1V87A 2LGGA 2KREA 2K1JA 5G05B 2CKLA 2FUUA 4R7EA 4I7CA 4YATA 2YU4A
chains in the Genus database with same CATH superfamily
4V3LC 4P5OB 2L75A 2L80A 5LKTA 1DCQA 4LLBA 2M1RA 2VPDA 4W4UA 2L7PA 3LQIA 1G25A 2YT5A 1MM2A 3RPGC 3U5NA 2ZETC 1HYIA 2MT5A 2IDAA 2KE1A 2C2LA 5K3QA 3LQJA 3EB5A 1VD4A 5TRBA 4FK5A 4AUQB 1X4IA 5SVIB 3LDYA 3ZPV1 1DVPA 5TDWA 2EODA 5TDRA 3FL2A 1X4UA 3FAOA 2M3HA 2KR4A 2CKLB 2LXHC 1WENA 2KWNA 2Y1MA 5SVXA 5KH3A 1N87A 5D1MB 2MA5A 4X3GA 5B77A 3E2DA 4PPEA 2FD4A 3O34A 2ECJA 2KIZA 3PUQA 5H1UA 3O7AA 2KGIA 2CSZA 5FERA 5LKXA 4YBSA 4I7DA 2VPEA 4BHWA 4YC9A 3LJUX 1FP0A 2HDPA 3N9NA 2HYED 3LRQA 2JMIA 3HCSA 2MNZA 2C2VS 1K2FA 2MKEA 3DWDA 2KWKA 3FEHA 4L58A 2E6RA 4GNGA 2VP7A 2RSDA 2DJAA 1RMDA 4XI1A 1WIMA 2K4DA 5FEYA 4CA1A 4F1PA 1CHCA 2LN0A 2FSAA 3N9QA 1IYMA 3SHBA 4H9DA 3MDBC 4F52B 2ECIA 5AITA 5DINA 2E61A 3HCUA 1LDJB 2ECNA 2L5UA 4O62A 4V3KC 5LKUA 2NAAA 5FB1A 3RTRB 5LKZA 2YURA 2LAUA 2MNYA 4YBTA 5C13A 5C11A 2Y1NA 3SUBA 4A4CA 3KNVA 3SOXA 4GNEA 2ECGA 2M6MA 4PTBA 2IQJA 3MHHA 5B78A 3N9OA 1WEOA 4FO9A 2XOCA 2XOZA 3FM8C 2OWAA 3SOUA 2XOYA 4OGEA 4IC3A 5KH9A 3N9PA 3GV4A 3M63A 1MBMA 2LGKA 4MSXA 4S3OB 4TKPB 4C9ZA 3FANA 3LVRE 2I50A 4YBMA 4CCGX 2MD7B 3KDEC 4A0CD 2K17A 2G43A 2F42A 1WEQA 5D1KB 3PHDA 3KV5A 5B75A 2YQLA 2VJEA 3L1XA 3N9LA 5G0FA 2CSVA 4IC2A 2CRWA 3DPLR 2YQMA 4R2YA 2L43A 4GB0A 4MVTA 4FIPA 2LGVA 4UI9B 2KU3A 2KWOA 3LQHA 1Z2QA 3O36A 1JM7A 4UP0A 3I2DA 2KYUA 2YHOA 4GNFA 2G45A 4QF3A 5B79A 2L0BA 1F62A 4YABA 4LKAA 2QJ0A 1BORA 2YREA 5FB0A 5H1VA 4WZ3B 3IHPA 2VJEB 4N3WA 2LRIC 4S3OC 4LADB 4FJCA 2XB1A 4NN2A 4Z0OA 2XEUA 3DQVR 2ECVA 4A4BA 2YVRA 2UZGA 3O37A 3PLWA 2MUMA 4QF2A 2D8UA 4AYCA 2KWJA 1JM7B 2EXUA 1T1HA 2F6NA 5I3LA 3GL6A 2LDRA 2PNXA 5LCWB 4AVXA 2YSJA 2M13A 2D8SA 4UP5A 3VK6A 3KV6A 5TABA 2MA6A 3LVQE 1WEEA 2KKYA 3U5OA 1WILA 5KH7A 3DDTA 1U6GB 2EA6A 4B7YC 3HCTA 3C6WA 3O47A 2KKXA 5H9MA 3V43A 1MM3A 4N4FA 2VPBA 3SOWA 3KQIA 2H0DB 4A49A 3M7KA 5DKAA 4AYCB 4ZQLA 2YHNA 4Z0RA 2ECWA 5D1LB 2LGLA 3O35A 2B0OE 2JMDA 1WEPA 2F6JA 3ZTGA 2ECTA 2MIQA 4I7BA 3T6RA 3T7LA 3ZVYA 4YADA 1JOCA 2DX8A 4ZDTA 5H1TA 2DSMA 2QICA 1XWHA 3QZVA 4R8PK 2VJFB 3ASLA 1WEUA 1WESA 3M99A 3N9MA 2EGPA 5TBNA 2YSMA 2CONA 1WGMA 3Q1DA 2VPGA 3HTKC 2CT2A 4B86C 3JUEA 3C5KA 2JM3A 1Z60A 2JRJA 5G04B 2FUIA 2JUNA 3ZYQA 2LXPC 3O33A 1Z6UA 3M62A 2XP0A 3L11A 3PURA 2YW8A 3NG2A 4O64A 2RR4A 1HYJA 5JG6A 2KFTA 3U5PA 2VNFA 1WEWA 5EYAF 2LQ6A 2CSYA 2Y43A 3MHSA 3U5MA 5B8DA 1WEVA 3EB6A 4YAXA 2OXQC 2LV9A 4AP4A 1WFKA 2CRRA 3RPGB 4Q6FA 3ZVZB 4WZ2A 5SVYA 3ZNIA 2M85A 2H0DA 4ZUXU 3O70A 4L7XA 2MD8C 2AN6A 1E4UA 4OGCA 1X4JA 2FFWA 2RI7A 2G6QA 2BAYA 5J3XA 3L1ZB 2E6SA 2K16A 2JMJA 3ZPVE 2KGGA 4BBQA 3H7HA 1FBVA 2VJFA 2PUYA 4LK9A 5AIUA 4WZ0A 5B76A 4LJNA 1WE9A 1ZBDB 2YYRA 2QIZA 1WEMA 1LDKC 3T9KA 1VYXA 5SVIA 2P57A 4WA6A 2YUCA 4GNDA 1VFYA 1V87A 2LGGA 2EGMA 2KREA 2K1JA 3FJUB 5G05B 2CKLA 4QQ4A 2FUUA 4R7EA 4I7CA 4YATA 2YU4A
chains in the Genus database with same CATH topology
4V3LC 4P5OB 2L75A 2L80A 5LKTA 4LLBA 2M1RA 2VPDA 4W4UA 3LQIA 1G25A 2YT5A 1MM2A 3RPGC 3U5NA 2ZETC 1HYIA 2MT5A 2IDAA 2KE1A 2C2LA 3LQJA 3EB5A 1VD4A 5TRBA 4FK5A 4AUQB 1X4IA 3ZPV1 1DVPA 5TDWA 2EODA 5TDRA 3FL2A 1X4UA 2M3HA 2KR4A 2CKLB 2LXHC 1WENA 2KWNA 2Y1MA 5KH3A 1N87A 5D1MB 2MA5A 4X3GA 5B77A 4PPEA 3O34A 2ECJA 2KIZA 3PUQA 5H1UA 3O7AA 2KGIA 2CSZA 5FERA 5LKXA 4YBSA 4I7DA 2VPEA 4BHWA 4YC9A 1FP0A 2HDPA 3N9NA 2HYED 3LRQA 2JMIA 3HCSA 2MNZA 2C2VS 1K2FA 2KWKA 4L58A 2E6RA 4GNGA 2VP7A 2RSDA 1RMDA 4XI1A 1WIMA 2K4DA 5FEYA 4CA1A 1CHCA 2LN0A 2FSAA 3N9QA 1IYMA 3SHBA 4F52B 2ECIA 5AITA 5DINA 3HCUA 1LDJB 2ECNA 2L5UA 4V3KC 5LKUA 2NAAA 5FB1A 3RTRB 5LKZA 2YURA 2MNYA 4YBTA 5C13A 5C11A 2Y1NA 4A4CA 3KNVA 3SOXA 4GNEA 2ECGA 2M6MA 4PTBA 3MHHA 5B78A 3N9OA 1WEOA 4FO9A 3SOUA 4IC3A 5KH9A 3N9PA 3GV4A 3M63A 2LGKA 4MSXA 4S3OB 4TKPB 4C9ZA 2I50A 4YBMA 4CCGX 2MD7B 4A0CD 2K17A 2G43A 2F42A 1WEQA 5D1KB 3PHDA 3KV5A 5B75A 2YQLA 2VJEA 3L1XA 3N9LA 5G0FA 4IC2A 3DPLR 2YQMA 4R2YA 2L43A 4GB0A 4MVTA 4FIPA 2LGVA 4UI9B 2KU3A 2KWOA 3LQHA 1Z2QA 3O36A 1JM7A 4UP0A 3I2DA 2KYUA 2YHOA 4GNFA 2G45A 4QF3A 5B79A 2L0BA 1F62A 4YABA 4LKAA 2QJ0A 1BORA 2YREA 5FB0A 5H1VA 4WZ3B 3IHPA 2VJEB 4N3WA 2LRIC 4S3OC 4LADB 4FJCA 2XB1A 4NN2A 2XEUA 3DQVR 2ECVA 4A4BA 2UZGA 3O37A 2MUMA 4QF2A 4AYCA 2KWJA 1JM7B 1T1HA 2F6NA 5I3LA 3GL6A 2LDRA 2PNXA 5LCWB 4AVXA 2YSJA 2D8SA 4UP5A 3VK6A 3KV6A 5TABA 2MA6A 1WEEA 3U5OA 1WILA 5KH7A 1U6GB 2EA6A 4B7YC 3HCTA 3C6WA 3V43A 5H9MA 1MM3A 4N4FA 2VPBA 3SOWA 3KQIA 2H0DB 4A49A 5DKAA 4AYCB 4ZQLA 2YHNA 2ECWA 5D1LB 2LGLA 3O35A 2JMDA 1WEPA 2F6JA 3ZTGA 2ECTA 2MIQA 4I7BA 3T6RA 3T7LA 3ZVYA 4YADA 1JOCA 2DX8A 4ZDTA 5H1TA 2QICA 1XWHA 3QZVA 4R8PK 2VJFB 3ASLA 1WEUA 1WESA 3M99A 3N9MA 2EGPA 5TBNA 2YSMA 1WGMA 2VPGA 3HTKC 2CT2A 4B86C 3C5KA 1Z60A 2JRJA 5G04B 2FUIA 3ZYQA 2LXPC 3O33A 1Z6UA 3M62A 3L11A 3PURA 2YW8A 3NG2A 4O64A 1HYJA 5JG6A 2KFTA 3U5PA 2VNFA 1WEWA 5EYAF 2LQ6A 2CSYA 2Y43A 3MHSA 3U5MA 5B8DA 1WEVA 3EB6A 4YAXA 2OXQC 2LV9A 4AP4A 1WFKA 3RPGB 4Q6FA 3ZVZB 4WZ2A 3ZNIA 2M85A 2H0DA 4ZUXU 3O70A 4L7XA 2MD8C 2AN6A 1E4UA 1X4JA 2RI7A 2G6QA 2BAYA 5J3XA 3L1ZB 2E6SA 2K16A 2JMJA 3ZPVE 2KGGA 4BBQA 1FBVA 2VJFA 2PUYA 4LK9A 5AIUA 4WZ0A 5B76A 4LJNA 1WE9A 1ZBDB 2YYRA 2QIZA 1WEMA 1LDKC 1VYXA 4WA6A 2YUCA 4GNDA 1VFYA 1V87A 2LGGA 2KREA 2K1JA 5G05B 2CKLA 2FUUA 4R7EA 4I7CA 4YATA 2YU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3L C;  4P5O B;  2L75 A;  2L80 A;  5LKT A;  4LLB A;  2M1R A;  2VPD A;  4W4U A;  3LQI A;  1G25 A;  2YT5 A;  1MM2 A;  3RPG C;  3U5N A;  2ZET C;  1HYI A;  2MT5 A;  2IDA A;  2KE1 A;  2C2L A;  3LQJ A;  3EB5 A;  1VD4 A;  5TRB A;  4FK5 A;  4AUQ B;  1X4I A;  3ZPV 1;  1DVP A;  5TDW A;  2EOD A;  5TDR A;  3FL2 A;  1X4U A;  2M3H A;  2KR4 A;  2CKL B;  2LXH C;  1WEN A;  2KWN A;  2Y1M A;  5KH3 A;  1N87 A;  5D1M B;  2MA5 A;  4X3G A;  5B77 A;  4PPE A;  3O34 A;  2ECJ A;  2KIZ A;  3PUQ A;  5H1U A;  3O7A A;  2KGI A;  2CSZ A;  5FER A;  5LKX A;  4YBS A;  4I7D A;  2VPE A;  4BHW A;  4YC9 A;  1FP0 A;  2HDP A;  3N9N A;  2HYE D;  3LRQ A;  2JMI A;  3HCS A;  2MNZ A;  2C2V S;  1K2F A;  2KWK A;  4L58 A;  2E6R A;  4GNG A;  2VP7 A;  2RSD A;  1RMD A;  4XI1 A;  1WIM A;  2K4D A;  5FEY A;  4CA1 A;  1CHC A;  2LN0 A;  2FSA A;  3N9Q A;  1IYM A;  3SHB A;  4F52 B;  2ECI A;  5AIT A;  5DIN A;  3HCU A;  1LDJ B;  2ECN A;  2L5U A;  4V3K C;  5LKU A;  2NAA A;  5FB1 A;  3RTR B;  5LKZ A;  2YUR A;  2MNY A;  4YBT A;  5C13 A;  5C11 A;  2Y1N A;  4A4C A;  3KNV A;  3SOX A;  4GNE A;  2ECG A;  2M6M A;  4PTB A;  3MHH A;  5B78 A;  3N9O A;  1WEO A;  4FO9 A;  3SOU A;  4IC3 A;  5KH9 A;  3N9P A;  3GV4 A;  3M63 A;  2LGK A;  4MSX A;  4S3O B;  4TKP B;  4C9Z A;  2I50 A;  4YBM A;  4CCG X;  2MD7 B;  4A0C D;  2K17 A;  2G43 A;  2F42 A;  1WEQ A;  5D1K B;  3PHD A;  3KV5 A;  5B75 A;  2YQL A;  2VJE A;  3L1X A;  3N9L A;  5G0F A;  4IC2 A;  3DPL R;  2YQM A;  4R2Y A;  2L43 A;  4GB0 A;  4MVT A;  4FIP A;  2LGV A;  4UI9 B;  2KU3 A;  2KWO A;  3LQH A;  1Z2Q A;  3O36 A;  1JM7 A;  4UP0 A;  3I2D A;  2KYU A;  2YHO A;  4GNF A;  2G45 A;  4QF3 A;  5B79 A;  2L0B A;  1F62 A;  4YAB A;  4LKA A;  2QJ0 A;  1BOR A;  2YRE A;  5FB0 A;  5H1V A;  4WZ3 B;  3IHP A;  2VJE B;  4N3W A;  2LRI C;  4S3O C;  4LAD B;  4FJC A;  2XB1 A;  4NN2 A;  2XEU A;  3DQV R;  2ECV A;  4A4B A;  2UZG A;  3O37 A;  2MUM A;  4QF2 A;  4AYC A;  2KWJ A;  1JM7 B;  1T1H A;  2F6N A;  5I3L A;  3GL6 A;  2LDR A;  2PNX A;  5LCW B;  4AVX A;  2YSJ A;  2D8S A;  4UP5 A;  3VK6 A;  3KV6 A;  5TAB A;  2MA6 A;  1WEE A;  3U5O A;  1WIL A;  5KH7 A;  1U6G B;  2EA6 A;  4B7Y C;  3HCT A;  3C6W A;  3V43 A;  5H9M A;  1MM3 A;  4N4F A;  2VPB A;  3SOW A;  3KQI A;  2H0D B;  4A49 A;  5DKA A;  4AYC B;  4ZQL A;  2YHN A;  2ECW A;  5D1L B;  2LGL A;  3O35 A;  2JMD A;  1WEP A;  2F6J A;  3ZTG A;  2ECT A;  2MIQ A;  4I7B A;  3T6R A;  3T7L A;  3ZVY A;  4YAD A;  1JOC A;  2DX8 A;  4ZDT A;  5H1T A;  2QIC A;  1XWH A;  3QZV A;  4R8P K;  2VJF B;  3ASL A;  1WEU A;  1WES A;  3M99 A;  3N9M A;  2EGP A;  5TBN A;  2YSM A;  1WGM A;  2VPG A;  3HTK C;  2CT2 A;  4B86 C;  3C5K A;  1Z60 A;  2JRJ A;  5G04 B;  2FUI A;  3ZYQ A;  2LXP C;  3O33 A;  1Z6U A;  3M62 A;  3L11 A;  3PUR A;  2YW8 A;  3NG2 A;  4O64 A;  1HYJ A;  5JG6 A;  2KFT A;  3U5P A;  2VNF A;  1WEW A;  5EYA F;  2LQ6 A;  2CSY A;  2Y43 A;  3MHS A;  3U5M A;  5B8D A;  1WEV A;  3EB6 A;  4YAX A;  2OXQ C;  2LV9 A;  4AP4 A;  1WFK A;  3RPG B;  4Q6F A;  3ZVZ B;  4WZ2 A;  3ZNI A;  2M85 A;  2H0D A;  4ZUX U;  3O70 A;  4L7X A;  2MD8 C;  2AN6 A;  1E4U A;  1X4J A;  2RI7 A;  2G6Q A;  2BAY A;  5J3X A;  3L1Z B;  2E6S A;  2K16 A;  2JMJ A;  3ZPV E;  2KGG A;  4BBQ A;  1FBV A;  2VJF A;  2PUY A;  4LK9 A;  5AIU A;  4WZ0 A;  5B76 A;  4LJN A;  1WE9 A;  1ZBD B;  2YYR A;  2QIZ A;  1WEM A;  1LDK C;  1VYX A;  4WA6 A;  2YUC A;  4GND A;  1VFY A;  1V87 A;  2LGG A;  2KRE A;  2K1J A;  5G05 B;  2CKL A;  2FUU A;  4R7E A;  4I7C A;  4YAT A;  2YU4 A; 
#chains in the Genus database with same CATH topology
 4V3L C;  4P5O B;  2L75 A;  2L80 A;  5LKT A;  1DCQ A;  4LLB A;  2M1R A;  2VPD A;  4W4U A;  2L7P A;  3LQI A;  1G25 A;  2YT5 A;  1MM2 A;  3RPG C;  3U5N A;  2ZET C;  1HYI A;  2MT5 A;  2IDA A;  2KE1 A;  2C2L A;  5K3Q A;  3LQJ A;  3EB5 A;  1VD4 A;  5TRB A;  4FK5 A;  4AUQ B;  1X4I A;  5SVI B;  3LDY A;  3ZPV 1;  1DVP A;  5TDW A;  2EOD A;  5TDR A;  3FL2 A;  1X4U A;  3FAO A;  2M3H A;  2KR4 A;  2CKL B;  2LXH C;  1WEN A;  2KWN A;  2Y1M A;  5SVX A;  5KH3 A;  1N87 A;  5D1M B;  2MA5 A;  4X3G A;  5B77 A;  3E2D A;  4PPE A;  2FD4 A;  3O34 A;  2ECJ A;  2KIZ A;  3PUQ A;  5H1U A;  3O7A A;  2KGI A;  2CSZ A;  5FER A;  5LKX A;  4YBS A;  4I7D A;  2VPE A;  4BHW A;  4YC9 A;  3LJU X;  1FP0 A;  2HDP A;  3N9N A;  2HYE D;  3LRQ A;  2JMI A;  3HCS A;  2MNZ A;  2C2V S;  1K2F A;  2MKE A;  3DWD A;  2KWK A;  3FEH A;  4L58 A;  2E6R A;  4GNG A;  2VP7 A;  2RSD A;  2DJA A;  1RMD A;  4XI1 A;  1WIM A;  2K4D A;  5FEY A;  4CA1 A;  4F1P A;  1CHC A;  2LN0 A;  2FSA A;  3N9Q A;  1IYM A;  3SHB A;  4H9D A;  3MDB C;  4F52 B;  2ECI A;  5AIT A;  5DIN A;  2E61 A;  3HCU A;  1LDJ B;  2ECN A;  2L5U A;  4O62 A;  4V3K C;  5LKU A;  2NAA A;  5FB1 A;  3RTR B;  5LKZ A;  2YUR A;  2LAU A;  2MNY A;  4YBT A;  5C13 A;  5C11 A;  2Y1N A;  3SUB A;  4A4C A;  3KNV A;  3SOX A;  4GNE A;  2ECG A;  2M6M A;  4PTB A;  2IQJ A;  3MHH A;  5B78 A;  3N9O A;  1WEO A;  4FO9 A;  2XOC A;  2XOZ A;  3FM8 C;  2OWA A;  3SOU A;  2XOY A;  4OGE A;  4IC3 A;  5KH9 A;  3N9P A;  3GV4 A;  3M63 A;  1MBM A;  2LGK A;  4MSX A;  4S3O B;  4TKP B;  4C9Z A;  3FAN A;  3LVR E;  2I50 A;  4YBM A;  4CCG X;  2MD7 B;  3KDE C;  4A0C D;  2K17 A;  2G43 A;  2F42 A;  1WEQ A;  5D1K B;  3PHD A;  3KV5 A;  5B75 A;  2YQL A;  2VJE A;  3L1X A;  3N9L A;  5G0F A;  2CSV A;  4IC2 A;  2CRW A;  3DPL R;  2YQM A;  4R2Y A;  2L43 A;  4GB0 A;  4MVT A;  4FIP A;  2LGV A;  4UI9 B;  2KU3 A;  2KWO A;  3LQH A;  1Z2Q A;  3O36 A;  1JM7 A;  4UP0 A;  3I2D A;  2KYU A;  2YHO A;  4GNF A;  2G45 A;  4QF3 A;  5B79 A;  2L0B A;  1F62 A;  4YAB A;  4LKA A;  2QJ0 A;  1BOR A;  2YRE A;  5FB0 A;  5H1V A;  4WZ3 B;  3IHP A;  2VJE B;  4N3W A;  2LRI C;  4S3O C;  4LAD B;  4FJC A;  2XB1 A;  4NN2 A;  4Z0O A;  2XEU A;  3DQV R;  2ECV A;  4A4B A;  2YVR A;  2UZG A;  3O37 A;  3PLW A;  2MUM A;  4QF2 A;  2D8U A;  4AYC A;  2KWJ A;  1JM7 B;  2EXU A;  1T1H A;  2F6N A;  5I3L A;  3GL6 A;  2LDR A;  2PNX A;  5LCW B;  4AVX A;  2YSJ A;  2M13 A;  2D8S A;  4UP5 A;  3VK6 A;  3KV6 A;  5TAB A;  2MA6 A;  3LVQ E;  1WEE A;  2KKY A;  3U5O A;  1WIL A;  5KH7 A;  3DDT A;  1U6G B;  2EA6 A;  4B7Y C;  3HCT A;  3C6W A;  3O47 A;  2KKX A;  5H9M A;  3V43 A;  1MM3 A;  4N4F A;  2VPB A;  3SOW A;  3KQI A;  2H0D B;  4A49 A;  3M7K A;  5DKA A;  4AYC B;  4ZQL A;  2YHN A;  4Z0R A;  2ECW A;  5D1L B;  2LGL A;  3O35 A;  2B0O E;  2JMD A;  1WEP A;  2F6J A;  3ZTG A;  2ECT A;  2MIQ A;  4I7B A;  3T6R A;  3T7L A;  3ZVY A;  4YAD A;  1JOC A;  2DX8 A;  4ZDT A;  5H1T A;  2DSM A;  2QIC A;  1XWH A;  3QZV A;  4R8P K;  2VJF B;  3ASL A;  1WEU A;  1WES A;  3M99 A;  3N9M A;  2EGP A;  5TBN A;  2YSM A;  2CON A;  1WGM A;  3Q1D A;  2VPG A;  3HTK C;  2CT2 A;  4B86 C;  3JUE A;  3C5K A;  2JM3 A;  1Z60 A;  2JRJ A;  5G04 B;  2FUI A;  2JUN A;  3ZYQ A;  2LXP C;  3O33 A;  1Z6U A;  3M62 A;  2XP0 A;  3L11 A;  3PUR A;  2YW8 A;  3NG2 A;  4O64 A;  2RR4 A;  1HYJ A;  5JG6 A;  2KFT A;  3U5P A;  2VNF A;  1WEW A;  5EYA F;  2LQ6 A;  2CSY A;  2Y43 A;  3MHS A;  3U5M A;  5B8D A;  1WEV A;  3EB6 A;  4YAX A;  2OXQ C;  2LV9 A;  4AP4 A;  1WFK A;  2CRR A;  3RPG B;  4Q6F A;  3ZVZ B;  4WZ2 A;  5SVY A;  3ZNI A;  2M85 A;  2H0D A;  4ZUX U;  3O70 A;  4L7X A;  2MD8 C;  2AN6 A;  1E4U A;  4OGC A;  1X4J A;  2FFW A;  2RI7 A;  2G6Q A;  2BAY A;  5J3X A;  3L1Z B;  2E6S A;  2K16 A;  2JMJ A;  3ZPV E;  2KGG A;  4BBQ A;  3H7H A;  1FBV A;  2VJF A;  2PUY A;  4LK9 A;  5AIU A;  4WZ0 A;  5B76 A;  4LJN A;  1WE9 A;  1ZBD B;  2YYR A;  2QIZ A;  1WEM A;  1LDK C;  3T9K A;  1VYX A;  5SVI A;  2P57 A;  4WA6 A;  2YUC A;  4GND A;  1VFY A;  1V87 A;  2LGG A;  2EGM A;  2KRE A;  2K1J A;  3FJU B;  5G05 B;  2CKL A;  4QQ4 A;  2FUU A;  4R7E A;  4I7C A;  4YAT A;  2YU4 A; 
#chains in the Genus database with same CATH homology
 4V3L C;  4P5O B;  2L75 A;  2L80 A;  5LKT A;  4LLB A;  2M1R A;  2VPD A;  4W4U A;  3LQI A;  1G25 A;  2YT5 A;  1MM2 A;  3RPG C;  3U5N A;  2ZET C;  1HYI A;  2MT5 A;  2IDA A;  2KE1 A;  2C2L A;  3LQJ A;  3EB5 A;  1VD4 A;  5TRB A;  4FK5 A;  4AUQ B;  1X4I A;  3ZPV 1;  1DVP A;  5TDW A;  2EOD A;  5TDR A;  3FL2 A;  1X4U A;  2M3H A;  2KR4 A;  2CKL B;  2LXH C;  1WEN A;  2KWN A;  2Y1M A;  5KH3 A;  1N87 A;  5D1M B;  2MA5 A;  4X3G A;  5B77 A;  4PPE A;  3O34 A;  2ECJ A;  2KIZ A;  3PUQ A;  5H1U A;  3O7A A;  2KGI A;  2CSZ A;  5FER A;  5LKX A;  4YBS A;  4I7D A;  2VPE A;  4BHW A;  4YC9 A;  1FP0 A;  2HDP A;  3N9N A;  2HYE D;  3LRQ A;  2JMI A;  3HCS A;  2MNZ A;  2C2V S;  1K2F A;  2KWK A;  4L58 A;  2E6R A;  4GNG A;  2VP7 A;  2RSD A;  1RMD A;  4XI1 A;  1WIM A;  2K4D A;  5FEY A;  4CA1 A;  1CHC A;  2LN0 A;  2FSA A;  3N9Q A;  1IYM A;  3SHB A;  4F52 B;  2ECI A;  5AIT A;  5DIN A;  3HCU A;  1LDJ B;  2ECN A;  2L5U A;  4V3K C;  5LKU A;  2NAA A;  5FB1 A;  3RTR B;  5LKZ A;  2YUR A;  2MNY A;  4YBT A;  5C13 A;  5C11 A;  2Y1N A;  4A4C A;  3KNV A;  3SOX A;  4GNE A;  2ECG A;  2M6M A;  4PTB A;  3MHH A;  5B78 A;  3N9O A;  1WEO A;  4FO9 A;  3SOU A;  4IC3 A;  5KH9 A;  3N9P A;  3GV4 A;  3M63 A;  2LGK A;  4MSX A;  4S3O B;  4TKP B;  4C9Z A;  2I50 A;  4YBM A;  4CCG X;  2MD7 B;  4A0C D;  2K17 A;  2G43 A;  2F42 A;  1WEQ A;  5D1K B;  3PHD A;  3KV5 A;  5B75 A;  2YQL A;  2VJE A;  3L1X A;  3N9L A;  5G0F A;  4IC2 A;  3DPL R;  2YQM A;  4R2Y A;  2L43 A;  4GB0 A;  4MVT A;  4FIP A;  2LGV A;  4UI9 B;  2KU3 A;  2KWO A;  3LQH A;  1Z2Q A;  3O36 A;  1JM7 A;  4UP0 A;  3I2D A;  2KYU A;  2YHO A;  4GNF A;  2G45 A;  4QF3 A;  5B79 A;  2L0B A;  1F62 A;  4YAB A;  4LKA A;  2QJ0 A;  1BOR A;  2YRE A;  5FB0 A;  5H1V A;  4WZ3 B;  3IHP A;  2VJE B;  4N3W A;  2LRI C;  4S3O C;  4LAD B;  4FJC A;  2XB1 A;  4NN2 A;  2XEU A;  3DQV R;  2ECV A;  4A4B A;  2UZG A;  3O37 A;  2MUM A;  4QF2 A;  4AYC A;  2KWJ A;  1JM7 B;  1T1H A;  2F6N A;  5I3L A;  3GL6 A;  2LDR A;  2PNX A;  5LCW B;  4AVX A;  2YSJ A;  2D8S A;  4UP5 A;  3VK6 A;  3KV6 A;  5TAB A;  2MA6 A;  1WEE A;  3U5O A;  1WIL A;  5KH7 A;  1U6G B;  2EA6 A;  4B7Y C;  3HCT A;  3C6W A;  3V43 A;  5H9M A;  1MM3 A;  4N4F A;  2VPB A;  3SOW A;  3KQI A;  2H0D B;  4A49 A;  5DKA A;  4AYC B;  4ZQL A;  2YHN A;  2ECW A;  5D1L B;  2LGL A;  3O35 A;  2JMD A;  1WEP A;  2F6J A;  3ZTG A;  2ECT A;  2MIQ A;  4I7B A;  3T6R A;  3T7L A;  3ZVY A;  4YAD A;  1JOC A;  2DX8 A;  4ZDT A;  5H1T A;  2QIC A;  1XWH A;  3QZV A;  4R8P K;  2VJF B;  3ASL A;  1WEU A;  1WES A;  3M99 A;  3N9M A;  2EGP A;  5TBN A;  2YSM A;  1WGM A;  2VPG A;  3HTK C;  2CT2 A;  4B86 C;  3C5K A;  1Z60 A;  2JRJ A;  5G04 B;  2FUI A;  3ZYQ A;  2LXP C;  3O33 A;  1Z6U A;  3M62 A;  3L11 A;  3PUR A;  2YW8 A;  3NG2 A;  4O64 A;  1HYJ A;  5JG6 A;  2KFT A;  3U5P A;  2VNF A;  1WEW A;  5EYA F;  2LQ6 A;  2CSY A;  2Y43 A;  3MHS A;  3U5M A;  5B8D A;  1WEV A;  3EB6 A;  4YAX A;  2OXQ C;  2LV9 A;  4AP4 A;  1WFK A;  3RPG B;  4Q6F A;  3ZVZ B;  4WZ2 A;  3ZNI A;  2M85 A;  2H0D A;  4ZUX U;  3O70 A;  4L7X A;  2MD8 C;  2AN6 A;  1E4U A;  1X4J A;  2RI7 A;  2G6Q A;  2BAY A;  5J3X A;  3L1Z B;  2E6S A;  2K16 A;  2JMJ A;  3ZPV E;  2KGG A;  4BBQ A;  1FBV A;  2VJF A;  2PUY A;  4LK9 A;  5AIU A;  4WZ0 A;  5B76 A;  4LJN A;  1WE9 A;  1ZBD B;  2YYR A;  2QIZ A;  1WEM A;  1LDK C;  1VYX A;  4WA6 A;  2YUC A;  4GND A;  1VFY A;  1V87 A;  2LGG A;  2KRE A;  2K1J A;  5G05 B;  2CKL A;  2FUU A;  4R7E A;  4I7C A;  4YAT A;  2YU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...