2VP7A

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKFFHRICTGMTETAYGLLTAEASAVWGCDTCMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords PYGOPUS HOMOLOG 1
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vp7A00
2K1JA 2HYED 1IYMA 4GNDA 2XB1A 2MT5A 3I2DA 2KGIA 2Y1MA 3VK6A 2K17A 4L7XA 1X4IA 1FBVA 4YAXA 3U5NA 4QF2A 3O35A 1JM7A 3L1XA 3ZPVE 4AYCB 1E4UA 5LKUA 5J3XA 4CCGX 3HCUA 1WEUA 2LGVA 1WIMA 2IDAA 3DQVR 4LK9A 2YU4A 1WE9A 2H0DB 1WEQA 4A49A 3ZYQA 3U5PA 3L11A 5B78A 1K2FA 3M62A 4LJNA 5H9MA 2JRJA 2C2VS 4WZ2A 2E6SA 2MNYA 5G04B 2MD7B 3KQIA 2L75A 3ZVZB 4GNEA 2G45A 2M85A 1JOCA 4ZDTA 5TABA 4YC9A 4A4CA 4GB0A 1WEVA 4GNGA 4AYCA 2FSAA 2VP7A 5H1VA 2YHNA 1X4UA 3IHPA 3FL2A 4UI9B 3PUQA 2NAAA 2AN6A 2ECIA 4R7EA 3ZTGA 2LXPC 2VJFA 3M63A 2K16A 3SHBA 1WFKA 5B76A 2LGKA 5C11A 4N4FA 2QICA 5FERA 2JMIA 2VPBA 4L58A 2ECTA 1BORA 5D1LB 3HCSA 2D8SA 5DINA 3O36A 2RSDA 3HTKC 4FJCA 3LQIA 4A0CD 4LLBA 2JMJA 2KFTA 2LXHC 5B79A 4IC2A 5JG6A 3GV4A 4IC3A 2YREA 2YYRA 4FO9A 2VPDA 1U6GB 3N9OA 3O34A 2FUIA 2CSZA 1WEOA 4QF3A 3KV5A 2G6QA 2YUCA 2UZGA 1V87A 4BHWA 5FB1A 2JMDA 3O7AA 4MSXA 1F62A 4AVXA 2LGLA 4V3LC 3N9NA 1XWHA 4WZ0A 1Z6UA 2K4DA 4WA6A 1WEEA 2OXQC 3O70A 4PPEA 4LADB 1LDKC 2CKLA 2ZETC 3HCTA 5FEYA 5LKXA 5KH3A 3PURA 3GL6A 3LRQA 2LV9A 5H1TA 2LRIC 1ZBDB 2YQMA 1DVPA 1G25A 2KR4A 2M3HA 1WGMA 2G43A 2KIZA 2CT2A 2MIQA 2VPGA 4AP4A 2MUMA 3QZVA 4AUQB 2CKLB 2KWOA 5G05B 2M1RA 3N9LA 4B7YC 5KH7A 4XI1A 5KH9A 2LDRA 2VNFA 3SOXA 2LQ6A 4GNFA 1Z2QA 3EB6A 3M99A 3C6WA 2YT5A 5B8DA 4V3KC 1HYIA 2ECWA 3RPGC 3ZNIA 1T1HA 1CHCA 2YW8A 1X4JA 2Y43A 3SOWA 4TKPB 3KV6A 4I7BA 3DPLR 2CSYA 2YHOA 2QJ0A 2DX8A 2I50A 2Y1NA 4YABA 2MD8C 3U5MA 2KE1A 5EYAF 1JM7B 2EA6A 2EODA 2C2LA 4N3WA 4PTBA 1VD4A 5DKAA 2H0DA 3ZVYA 5FB0A 2ECGA 1WEMA 5LCWB 4C9ZA 3MHHA 2FUUA 2VJFB 1HYJA 3LQHA 3N9MA 2KWJA 2MNZA 2XEUA 2PUYA 3N9PA 3V43A 3N9QA 4CA1A 2VPEA 3RPGB 4YBMA 2L5UA 5B77A 3KNVA 4R2YA 2ECJA 2PNXA 4YBSA 4Q6FA 1WEPA 4YBTA 3T6RA 3ASLA 1WEWA 5AITA 1VYXA 3LQJA 3O37A 2L80A 1MM3A 4BBQA 4X3GA 3C5KA 4ZUXU 2RI7A 4W4UA 5LKTA 3RTRB 2KREA 3NG2A 2BAYA 2MA6A 2MA5A 3T7LA 4I7DA 5C13A 1VFYA 2M6MA 4FIPA 2LN0A 2YURA 2L0BA 1RMDA 1MM2A 4A4BA 5H1UA 5TBNA 4O64A 3U5OA 3MHSA 3EB5A 3ZPV1 4NN2A 5TDRA 2YSMA 2ECVA 4B86C 2VJEB 3L1ZB 5TDWA 5TRBA 2HDPA 1N87A 4FK5A 4S3OC 4UP0A 2KU3A 4MVTA 1FP0A 2KWKA 4R8PK 1WENA 2KYUA 1WESA 1WILA 3SOUA 2F6NA 2KWNA 1Z60A 4F52B 2VJEA 5AIUA 5D1KB 2ECNA 2F42A 3O33A 4UP5A 1LDJB 2KGGA 2L43A 4WZ3B 2E6RA 3PHDA 5I3LA 5LKZA 4YATA 2F6JA 2QIZA 5G0FA 2EGPA 2YQLA 2YSJA 5B75A 4I7CA 4P5OB 2LGGA 5D1MB 4ZQLA 4LKAA 4YADA 4S3OB
chains in the Genus database with same CATH superfamily
2K1JA 2HYED 2LAUA 1IYMA 2OWAA 4GNDA 2XB1A 2MT5A 3I2DA 2KGIA 2Y1MA 3VK6A 2K17A 4L7XA 1X4IA 1FBVA 4YAXA 2E61A 3U5NA 2CRRA 4QF2A 3O35A 1JM7A 3L1XA 3O47A 3ZPVE 4AYCB 2B0OE 3T9KA 1E4UA 5LKUA 5J3XA 4CCGX 3HCUA 1WEUA 2LGVA 1WIMA 2IDAA 3DQVR 4LK9A 2YU4A 1WE9A 2H0DB 1WEQA 4A49A 4OGEA 3ZYQA 3U5PA 3L11A 2EGMA 5B78A 1K2FA 3M62A 4LJNA 5H9MA 2JRJA 2C2VS 4WZ2A 2E6SA 2MNYA 5G04B 2MD7B 3KQIA 2L75A 3ZVZB 3E2DA 4GNEA 2G45A 2M85A 1JOCA 4ZDTA 5TABA 4YC9A 4A4CA 4GB0A 1WEVA 4GNGA 4AYCA 2FSAA 2VP7A 5H1VA 2YHNA 1X4UA 4UI9B 3FL2A 3IHPA 3PUQA 2NAAA 2AN6A 2ECIA 4R7EA 4H9DA 3ZTGA 2LXPC 5SVIB 2VJFA 3M63A 2K16A 3SHBA 1WFKA 5B76A 2MKEA 2LGKA 5C11A 4N4FA 2QICA 5FERA 2JMIA 2VPBA 4L58A 2ECTA 1BORA 2KKXA 5D1LB 3HCSA 2D8SA 5DINA 3O36A 2RSDA 3HTKC 4FJCA 3LQIA 4A0CD 2P57A 2EXUA 4LLBA 3LVRE 2JMJA 2KFTA 2LXHC 5B79A 4IC2A 5JG6A 3GV4A 4IC3A 2YREA 2YYRA 4FO9A 2VPDA 3M7KA 1U6GB 3N9OA 3O34A 4QQ4A 2FUIA 2CSZA 1WEOA 3DDTA 4F1PA 2XOCA 4OGCA 2YVRA 4QF3A 3KV5A 2G6QA 2YUCA 2UZGA 1V87A 4BHWA 5FB1A 2JMDA 2XP0A 3O7AA 5K3QA 5SVYA 4MSXA 3FJUB 1F62A 4AVXA 2LGLA 4V3LC 3N9NA 1XWHA 4WZ0A 1Z6UA 2K4DA 4WA6A 1WEEA 2OXQC 3O70A 4PPEA 4LADB 1LDKC 2CKLA 2FFWA 2ZETC 3HCTA 5FEYA 5LKXA 3JUEA 5KH3A 3PURA 3GL6A 3LRQA 2LV9A 5H1TA 2LRIC 1ZBDB 2YQMA 2JM3A 1DVPA 1G25A 2KR4A 2M3HA 1WGMA 2G43A 2KIZA 2CSVA 2CT2A 2MIQA 2VPGA 3FEHA 4AP4A 2MUMA 3QZVA 4AUQB 2CKLB 2KWOA 5G05B 2M1RA 3MDBC 3N9LA 4B7YC 5KH7A 4XI1A 5KH9A 2LDRA 2VNFA 3SOXA 2LQ6A 4GNFA 1Z2QA 3EB6A 3M99A 3C6WA 2YT5A 5B8DA 4V3KC 1HYIA 2ECWA 3RPGC 3ZNIA 1T1HA 1CHCA 4Z0OA 2YW8A 1X4JA 2Y43A 3FANA 3SOWA 4TKPB 3KV6A 2RR4A 4I7BA 1DCQA 2CSYA 3DPLR 2YHOA 2QJ0A 2DX8A 2I50A 2Y1NA 4YABA 2MD8C 3U5MA 2KE1A 5EYAF 3DWDA 2L7PA 3FM8C 1JM7B 2EA6A 2EODA 2C2LA 4N3WA 4PTBA 1VD4A 5DKAA 2FD4A 2H0DA 3ZVYA 5FB0A 2ECGA 4Z0RA 1WEMA 5LCWB 4C9ZA 3MHHA 3PLWA 2FUUA 2VJFB 1HYJA 2JUNA 3LQHA 3N9MA 2KWJA 2MNZA 2XEUA 2PUYA 3N9PA 3V43A 3N9QA 4CA1A 2VPEA 3RPGB 4YBMA 2DJAA 2M13A 2L5UA 2CONA 3FAOA 5B77A 2KKYA 3KNVA 4R2YA 2ECJA 5SVIA 2PNXA 4YBSA 4Q6FA 3H7HA 1WEPA 3SUBA 4YBTA 3T6RA 3ASLA 1WEWA 2CRWA 5AITA 1VYXA 3LQJA 3O37A 2L80A 1MM3A 4BBQA 5SVXA 4X3GA 3C5KA 4ZUXU 2RI7A 4W4UA 5LKTA 3RTRB 3KDEC 2KREA 3NG2A 2BAYA 2MA6A 2MA5A 3T7LA 4I7DA 5C13A 1VFYA 2M6MA 4FIPA 2LN0A 2YURA 2L0BA 1RMDA 1MM2A 4A4BA 5H1UA 5TBNA 4O64A 3U5OA 3MHSA 3EB5A 3ZPV1 4NN2A 3LVQE 5TDRA 2YSMA 2ECVA 2IQJA 4B86C 2VJEB 3L1ZB 4O62A 5TDWA 5TRBA 2HDPA 1N87A 4FK5A 3LJUX 4S3OC 4UP0A 2KU3A 4MVTA 1FP0A 2KWKA 4R8PK 1WENA 2KYUA 1WESA 2D8UA 1WILA 3SOUA 2F6NA 2KWNA 1Z60A 4F52B 2XOZA 2VJEA 5AIUA 5D1KB 2DSMA 2ECNA 3Q1DA 2F42A 3O33A 4UP5A 1LDJB 2KGGA 2L43A 4WZ3B 2E6RA 3LDYA 3PHDA 5I3LA 5LKZA 4YATA 2F6JA 1MBMA 2QIZA 5G0FA 2EGPA 2YQLA 2YSJA 5B75A 4I7CA 4P5OB 2LGGA 5D1MB 4ZQLA 2XOYA 4LKAA 4YADA 4S3OB
chains in the Genus database with same CATH topology
2K1JA 2HYED 1IYMA 4GNDA 2XB1A 2MT5A 3I2DA 2KGIA 2Y1MA 3VK6A 2K17A 4L7XA 1X4IA 1FBVA 4YAXA 3U5NA 4QF2A 3O35A 1JM7A 3L1XA 3ZPVE 4AYCB 1E4UA 5LKUA 5J3XA 4CCGX 3HCUA 1WEUA 2LGVA 1WIMA 2IDAA 3DQVR 4LK9A 2YU4A 1WE9A 2H0DB 1WEQA 4A49A 3ZYQA 3U5PA 3L11A 5B78A 1K2FA 3M62A 4LJNA 5H9MA 2JRJA 2C2VS 4WZ2A 2E6SA 2MNYA 5G04B 2MD7B 3KQIA 2L75A 3ZVZB 4GNEA 2G45A 2M85A 1JOCA 4ZDTA 5TABA 4YC9A 4A4CA 4GB0A 1WEVA 4GNGA 4AYCA 2FSAA 2VP7A 5H1VA 2YHNA 1X4UA 3IHPA 3FL2A 4UI9B 3PUQA 2NAAA 2AN6A 2ECIA 4R7EA 3ZTGA 2LXPC 2VJFA 3M63A 2K16A 3SHBA 1WFKA 5B76A 2LGKA 5C11A 4N4FA 2QICA 5FERA 2JMIA 2VPBA 4L58A 2ECTA 1BORA 5D1LB 3HCSA 2D8SA 5DINA 3O36A 2RSDA 3HTKC 4FJCA 3LQIA 4A0CD 4LLBA 2JMJA 2KFTA 2LXHC 5B79A 4IC2A 5JG6A 3GV4A 4IC3A 2YREA 2YYRA 4FO9A 2VPDA 1U6GB 3N9OA 3O34A 2FUIA 2CSZA 1WEOA 4QF3A 3KV5A 2G6QA 2YUCA 2UZGA 1V87A 4BHWA 5FB1A 2JMDA 3O7AA 4MSXA 1F62A 4AVXA 2LGLA 4V3LC 3N9NA 1XWHA 4WZ0A 1Z6UA 2K4DA 4WA6A 1WEEA 2OXQC 3O70A 4PPEA 4LADB 1LDKC 2CKLA 2ZETC 3HCTA 5FEYA 5LKXA 5KH3A 3PURA 3GL6A 3LRQA 2LV9A 5H1TA 2LRIC 1ZBDB 2YQMA 1DVPA 1G25A 2KR4A 2M3HA 1WGMA 2G43A 2KIZA 2CT2A 2MIQA 2VPGA 4AP4A 2MUMA 3QZVA 4AUQB 2CKLB 2KWOA 5G05B 2M1RA 3N9LA 4B7YC 5KH7A 4XI1A 5KH9A 2LDRA 2VNFA 3SOXA 2LQ6A 4GNFA 1Z2QA 3EB6A 3M99A 3C6WA 2YT5A 5B8DA 4V3KC 1HYIA 2ECWA 3RPGC 3ZNIA 1T1HA 1CHCA 2YW8A 1X4JA 2Y43A 3SOWA 4TKPB 3KV6A 4I7BA 3DPLR 2CSYA 2YHOA 2QJ0A 2DX8A 2I50A 2Y1NA 4YABA 2MD8C 3U5MA 2KE1A 5EYAF 1JM7B 2EA6A 2EODA 2C2LA 4N3WA 4PTBA 1VD4A 5DKAA 2H0DA 3ZVYA 5FB0A 2ECGA 1WEMA 5LCWB 4C9ZA 3MHHA 2FUUA 2VJFB 1HYJA 3LQHA 3N9MA 2KWJA 2MNZA 2XEUA 2PUYA 3N9PA 3V43A 3N9QA 4CA1A 2VPEA 3RPGB 4YBMA 2L5UA 5B77A 3KNVA 4R2YA 2ECJA 2PNXA 4YBSA 4Q6FA 1WEPA 4YBTA 3T6RA 3ASLA 1WEWA 5AITA 1VYXA 3LQJA 3O37A 2L80A 1MM3A 4BBQA 4X3GA 3C5KA 4ZUXU 2RI7A 4W4UA 5LKTA 3RTRB 2KREA 3NG2A 2BAYA 2MA6A 2MA5A 3T7LA 4I7DA 5C13A 1VFYA 2M6MA 4FIPA 2LN0A 2YURA 2L0BA 1RMDA 1MM2A 4A4BA 5H1UA 5TBNA 4O64A 3U5OA 3MHSA 3EB5A 3ZPV1 4NN2A 5TDRA 2YSMA 2ECVA 4B86C 2VJEB 3L1ZB 5TDWA 5TRBA 2HDPA 1N87A 4FK5A 4S3OC 4UP0A 2KU3A 4MVTA 1FP0A 2KWKA 4R8PK 1WENA 2KYUA 1WESA 1WILA 3SOUA 2F6NA 2KWNA 1Z60A 4F52B 2VJEA 5AIUA 5D1KB 2ECNA 2F42A 3O33A 4UP5A 1LDJB 2KGGA 2L43A 4WZ3B 2E6RA 3PHDA 5I3LA 5LKZA 4YATA 2F6JA 2QIZA 5G0FA 2EGPA 2YQLA 2YSJA 5B75A 4I7CA 4P5OB 2LGGA 5D1MB 4ZQLA 4LKAA 4YADA 4S3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1J A;  2HYE D;  1IYM A;  4GND A;  2XB1 A;  2MT5 A;  3I2D A;  2KGI A;  2Y1M A;  3VK6 A;  2K17 A;  4L7X A;  1X4I A;  1FBV A;  4YAX A;  3U5N A;  4QF2 A;  3O35 A;  1JM7 A;  3L1X A;  3ZPV E;  4AYC B;  1E4U A;  5LKU A;  5J3X A;  4CCG X;  3HCU A;  1WEU A;  2LGV A;  1WIM A;  2IDA A;  3DQV R;  4LK9 A;  2YU4 A;  1WE9 A;  2H0D B;  1WEQ A;  4A49 A;  3ZYQ A;  3U5P A;  3L11 A;  5B78 A;  1K2F A;  3M62 A;  4LJN A;  5H9M A;  2JRJ A;  2C2V S;  4WZ2 A;  2E6S A;  2MNY A;  5G04 B;  2MD7 B;  3KQI A;  2L75 A;  3ZVZ B;  4GNE A;  2G45 A;  2M85 A;  1JOC A;  4ZDT A;  5TAB A;  4YC9 A;  4A4C A;  4GB0 A;  1WEV A;  4GNG A;  4AYC A;  2FSA A;  2VP7 A;  5H1V A;  2YHN A;  1X4U A;  3IHP A;  3FL2 A;  4UI9 B;  3PUQ A;  2NAA A;  2AN6 A;  2ECI A;  4R7E A;  3ZTG A;  2LXP C;  2VJF A;  3M63 A;  2K16 A;  3SHB A;  1WFK A;  5B76 A;  2LGK A;  5C11 A;  4N4F A;  2QIC A;  5FER A;  2JMI A;  2VPB A;  4L58 A;  2ECT A;  1BOR A;  5D1L B;  3HCS A;  2D8S A;  5DIN A;  3O36 A;  2RSD A;  3HTK C;  4FJC A;  3LQI A;  4A0C D;  4LLB A;  2JMJ A;  2KFT A;  2LXH C;  5B79 A;  4IC2 A;  5JG6 A;  3GV4 A;  4IC3 A;  2YRE A;  2YYR A;  4FO9 A;  2VPD A;  1U6G B;  3N9O A;  3O34 A;  2FUI A;  2CSZ A;  1WEO A;  4QF3 A;  3KV5 A;  2G6Q A;  2YUC A;  2UZG A;  1V87 A;  4BHW A;  5FB1 A;  2JMD A;  3O7A A;  4MSX A;  1F62 A;  4AVX A;  2LGL A;  4V3L C;  3N9N A;  1XWH A;  4WZ0 A;  1Z6U A;  2K4D A;  4WA6 A;  1WEE A;  2OXQ C;  3O70 A;  4PPE A;  4LAD B;  1LDK C;  2CKL A;  2ZET C;  3HCT A;  5FEY A;  5LKX A;  5KH3 A;  3PUR A;  3GL6 A;  3LRQ A;  2LV9 A;  5H1T A;  2LRI C;  1ZBD B;  2YQM A;  1DVP A;  1G25 A;  2KR4 A;  2M3H A;  1WGM A;  2G43 A;  2KIZ A;  2CT2 A;  2MIQ A;  2VPG A;  4AP4 A;  2MUM A;  3QZV A;  4AUQ B;  2CKL B;  2KWO A;  5G05 B;  2M1R A;  3N9L A;  4B7Y C;  5KH7 A;  4XI1 A;  5KH9 A;  2LDR A;  2VNF A;  3SOX A;  2LQ6 A;  4GNF A;  1Z2Q A;  3EB6 A;  3M99 A;  3C6W A;  2YT5 A;  5B8D A;  4V3K C;  1HYI A;  2ECW A;  3RPG C;  3ZNI A;  1T1H A;  1CHC A;  2YW8 A;  1X4J A;  2Y43 A;  3SOW A;  4TKP B;  3KV6 A;  4I7B A;  3DPL R;  2CSY A;  2YHO A;  2QJ0 A;  2DX8 A;  2I50 A;  2Y1N A;  4YAB A;  2MD8 C;  3U5M A;  2KE1 A;  5EYA F;  1JM7 B;  2EA6 A;  2EOD A;  2C2L A;  4N3W A;  4PTB A;  1VD4 A;  5DKA A;  2H0D A;  3ZVY A;  5FB0 A;  2ECG A;  1WEM A;  5LCW B;  4C9Z A;  3MHH A;  2FUU A;  2VJF B;  1HYJ A;  3LQH A;  3N9M A;  2KWJ A;  2MNZ A;  2XEU A;  2PUY A;  3N9P A;  3V43 A;  3N9Q A;  4CA1 A;  2VPE A;  3RPG B;  4YBM A;  2L5U A;  5B77 A;  3KNV A;  4R2Y A;  2ECJ A;  2PNX A;  4YBS A;  4Q6F A;  1WEP A;  4YBT A;  3T6R A;  3ASL A;  1WEW A;  5AIT A;  1VYX A;  3LQJ A;  3O37 A;  2L80 A;  1MM3 A;  4BBQ A;  4X3G A;  3C5K A;  4ZUX U;  2RI7 A;  4W4U A;  5LKT A;  3RTR B;  2KRE A;  3NG2 A;  2BAY A;  2MA6 A;  2MA5 A;  3T7L A;  4I7D A;  5C13 A;  1VFY A;  2M6M A;  4FIP A;  2LN0 A;  2YUR A;  2L0B A;  1RMD A;  1MM2 A;  4A4B A;  5H1U A;  5TBN A;  4O64 A;  3U5O A;  3MHS A;  3EB5 A;  3ZPV 1;  4NN2 A;  5TDR A;  2YSM A;  2ECV A;  4B86 C;  2VJE B;  3L1Z B;  5TDW A;  5TRB A;  2HDP A;  1N87 A;  4FK5 A;  4S3O C;  4UP0 A;  2KU3 A;  4MVT A;  1FP0 A;  2KWK A;  4R8P K;  1WEN A;  2KYU A;  1WES A;  1WIL A;  3SOU A;  2F6N A;  2KWN A;  1Z60 A;  4F52 B;  2VJE A;  5AIU A;  5D1K B;  2ECN A;  2F42 A;  3O33 A;  4UP5 A;  1LDJ B;  2KGG A;  2L43 A;  4WZ3 B;  2E6R A;  3PHD A;  5I3L A;  5LKZ A;  4YAT A;  2F6J A;  2QIZ A;  5G0F A;  2EGP A;  2YQL A;  2YSJ A;  5B75 A;  4I7C A;  4P5O B;  2LGG A;  5D1M B;  4ZQL A;  4LKA A;  4YAD A;  4S3O B; 
#chains in the Genus database with same CATH topology
 2K1J A;  2HYE D;  2LAU A;  1IYM A;  2OWA A;  4GND A;  2XB1 A;  2MT5 A;  3I2D A;  2KGI A;  2Y1M A;  3VK6 A;  2K17 A;  4L7X A;  1X4I A;  1FBV A;  4YAX A;  2E61 A;  3U5N A;  2CRR A;  4QF2 A;  3O35 A;  1JM7 A;  3L1X A;  3O47 A;  3ZPV E;  4AYC B;  2B0O E;  3T9K A;  1E4U A;  5LKU A;  5J3X A;  4CCG X;  3HCU A;  1WEU A;  2LGV A;  1WIM A;  2IDA A;  3DQV R;  4LK9 A;  2YU4 A;  1WE9 A;  2H0D B;  1WEQ A;  4A49 A;  4OGE A;  3ZYQ A;  3U5P A;  3L11 A;  2EGM A;  5B78 A;  1K2F A;  3M62 A;  4LJN A;  5H9M A;  2JRJ A;  2C2V S;  4WZ2 A;  2E6S A;  2MNY A;  5G04 B;  2MD7 B;  3KQI A;  2L75 A;  3ZVZ B;  3E2D A;  4GNE A;  2G45 A;  2M85 A;  1JOC A;  4ZDT A;  5TAB A;  4YC9 A;  4A4C A;  4GB0 A;  1WEV A;  4GNG A;  4AYC A;  2FSA A;  2VP7 A;  5H1V A;  2YHN A;  1X4U A;  4UI9 B;  3FL2 A;  3IHP A;  3PUQ A;  2NAA A;  2AN6 A;  2ECI A;  4R7E A;  4H9D A;  3ZTG A;  2LXP C;  5SVI B;  2VJF A;  3M63 A;  2K16 A;  3SHB A;  1WFK A;  5B76 A;  2MKE A;  2LGK A;  5C11 A;  4N4F A;  2QIC A;  5FER A;  2JMI A;  2VPB A;  4L58 A;  2ECT A;  1BOR A;  2KKX A;  5D1L B;  3HCS A;  2D8S A;  5DIN A;  3O36 A;  2RSD A;  3HTK C;  4FJC A;  3LQI A;  4A0C D;  2P57 A;  2EXU A;  4LLB A;  3LVR E;  2JMJ A;  2KFT A;  2LXH C;  5B79 A;  4IC2 A;  5JG6 A;  3GV4 A;  4IC3 A;  2YRE A;  2YYR A;  4FO9 A;  2VPD A;  3M7K A;  1U6G B;  3N9O A;  3O34 A;  4QQ4 A;  2FUI A;  2CSZ A;  1WEO A;  3DDT A;  4F1P A;  2XOC A;  4OGC A;  2YVR A;  4QF3 A;  3KV5 A;  2G6Q A;  2YUC A;  2UZG A;  1V87 A;  4BHW A;  5FB1 A;  2JMD A;  2XP0 A;  3O7A A;  5K3Q A;  5SVY A;  4MSX A;  3FJU B;  1F62 A;  4AVX A;  2LGL A;  4V3L C;  3N9N A;  1XWH A;  4WZ0 A;  1Z6U A;  2K4D A;  4WA6 A;  1WEE A;  2OXQ C;  3O70 A;  4PPE A;  4LAD B;  1LDK C;  2CKL A;  2FFW A;  2ZET C;  3HCT A;  5FEY A;  5LKX A;  3JUE A;  5KH3 A;  3PUR A;  3GL6 A;  3LRQ A;  2LV9 A;  5H1T A;  2LRI C;  1ZBD B;  2YQM A;  2JM3 A;  1DVP A;  1G25 A;  2KR4 A;  2M3H A;  1WGM A;  2G43 A;  2KIZ A;  2CSV A;  2CT2 A;  2MIQ A;  2VPG A;  3FEH A;  4AP4 A;  2MUM A;  3QZV A;  4AUQ B;  2CKL B;  2KWO A;  5G05 B;  2M1R A;  3MDB C;  3N9L A;  4B7Y C;  5KH7 A;  4XI1 A;  5KH9 A;  2LDR A;  2VNF A;  3SOX A;  2LQ6 A;  4GNF A;  1Z2Q A;  3EB6 A;  3M99 A;  3C6W A;  2YT5 A;  5B8D A;  4V3K C;  1HYI A;  2ECW A;  3RPG C;  3ZNI A;  1T1H A;  1CHC A;  4Z0O A;  2YW8 A;  1X4J A;  2Y43 A;  3FAN A;  3SOW A;  4TKP B;  3KV6 A;  2RR4 A;  4I7B A;  1DCQ A;  2CSY A;  3DPL R;  2YHO A;  2QJ0 A;  2DX8 A;  2I50 A;  2Y1N A;  4YAB A;  2MD8 C;  3U5M A;  2KE1 A;  5EYA F;  3DWD A;  2L7P A;  3FM8 C;  1JM7 B;  2EA6 A;  2EOD A;  2C2L A;  4N3W A;  4PTB A;  1VD4 A;  5DKA A;  2FD4 A;  2H0D A;  3ZVY A;  5FB0 A;  2ECG A;  4Z0R A;  1WEM A;  5LCW B;  4C9Z A;  3MHH A;  3PLW A;  2FUU A;  2VJF B;  1HYJ A;  2JUN A;  3LQH A;  3N9M A;  2KWJ A;  2MNZ A;  2XEU A;  2PUY A;  3N9P A;  3V43 A;  3N9Q A;  4CA1 A;  2VPE A;  3RPG B;  4YBM A;  2DJA A;  2M13 A;  2L5U A;  2CON A;  3FAO A;  5B77 A;  2KKY A;  3KNV A;  4R2Y A;  2ECJ A;  5SVI A;  2PNX A;  4YBS A;  4Q6F A;  3H7H A;  1WEP A;  3SUB A;  4YBT A;  3T6R A;  3ASL A;  1WEW A;  2CRW A;  5AIT A;  1VYX A;  3LQJ A;  3O37 A;  2L80 A;  1MM3 A;  4BBQ A;  5SVX A;  4X3G A;  3C5K A;  4ZUX U;  2RI7 A;  4W4U A;  5LKT A;  3RTR B;  3KDE C;  2KRE A;  3NG2 A;  2BAY A;  2MA6 A;  2MA5 A;  3T7L A;  4I7D A;  5C13 A;  1VFY A;  2M6M A;  4FIP A;  2LN0 A;  2YUR A;  2L0B A;  1RMD A;  1MM2 A;  4A4B A;  5H1U A;  5TBN A;  4O64 A;  3U5O A;  3MHS A;  3EB5 A;  3ZPV 1;  4NN2 A;  3LVQ E;  5TDR A;  2YSM A;  2ECV A;  2IQJ A;  4B86 C;  2VJE B;  3L1Z B;  4O62 A;  5TDW A;  5TRB A;  2HDP A;  1N87 A;  4FK5 A;  3LJU X;  4S3O C;  4UP0 A;  2KU3 A;  4MVT A;  1FP0 A;  2KWK A;  4R8P K;  1WEN A;  2KYU A;  1WES A;  2D8U A;  1WIL A;  3SOU A;  2F6N A;  2KWN A;  1Z60 A;  4F52 B;  2XOZ A;  2VJE A;  5AIU A;  5D1K B;  2DSM A;  2ECN A;  3Q1D A;  2F42 A;  3O33 A;  4UP5 A;  1LDJ B;  2KGG A;  2L43 A;  4WZ3 B;  2E6R A;  3LDY A;  3PHD A;  5I3L A;  5LKZ A;  4YAT A;  2F6J A;  1MBM A;  2QIZ A;  5G0F A;  2EGP A;  2YQL A;  2YSJ A;  5B75 A;  4I7C A;  4P5O B;  2LGG A;  5D1M B;  4ZQL A;  2XOY A;  4LKA A;  4YAD A;  4S3O B; 
#chains in the Genus database with same CATH homology
 2K1J A;  2HYE D;  1IYM A;  4GND A;  2XB1 A;  2MT5 A;  3I2D A;  2KGI A;  2Y1M A;  3VK6 A;  2K17 A;  4L7X A;  1X4I A;  1FBV A;  4YAX A;  3U5N A;  4QF2 A;  3O35 A;  1JM7 A;  3L1X A;  3ZPV E;  4AYC B;  1E4U A;  5LKU A;  5J3X A;  4CCG X;  3HCU A;  1WEU A;  2LGV A;  1WIM A;  2IDA A;  3DQV R;  4LK9 A;  2YU4 A;  1WE9 A;  2H0D B;  1WEQ A;  4A49 A;  3ZYQ A;  3U5P A;  3L11 A;  5B78 A;  1K2F A;  3M62 A;  4LJN A;  5H9M A;  2JRJ A;  2C2V S;  4WZ2 A;  2E6S A;  2MNY A;  5G04 B;  2MD7 B;  3KQI A;  2L75 A;  3ZVZ B;  4GNE A;  2G45 A;  2M85 A;  1JOC A;  4ZDT A;  5TAB A;  4YC9 A;  4A4C A;  4GB0 A;  1WEV A;  4GNG A;  4AYC A;  2FSA A;  2VP7 A;  5H1V A;  2YHN A;  1X4U A;  3IHP A;  3FL2 A;  4UI9 B;  3PUQ A;  2NAA A;  2AN6 A;  2ECI A;  4R7E A;  3ZTG A;  2LXP C;  2VJF A;  3M63 A;  2K16 A;  3SHB A;  1WFK A;  5B76 A;  2LGK A;  5C11 A;  4N4F A;  2QIC A;  5FER A;  2JMI A;  2VPB A;  4L58 A;  2ECT A;  1BOR A;  5D1L B;  3HCS A;  2D8S A;  5DIN A;  3O36 A;  2RSD A;  3HTK C;  4FJC A;  3LQI A;  4A0C D;  4LLB A;  2JMJ A;  2KFT A;  2LXH C;  5B79 A;  4IC2 A;  5JG6 A;  3GV4 A;  4IC3 A;  2YRE A;  2YYR A;  4FO9 A;  2VPD A;  1U6G B;  3N9O A;  3O34 A;  2FUI A;  2CSZ A;  1WEO A;  4QF3 A;  3KV5 A;  2G6Q A;  2YUC A;  2UZG A;  1V87 A;  4BHW A;  5FB1 A;  2JMD A;  3O7A A;  4MSX A;  1F62 A;  4AVX A;  2LGL A;  4V3L C;  3N9N A;  1XWH A;  4WZ0 A;  1Z6U A;  2K4D A;  4WA6 A;  1WEE A;  2OXQ C;  3O70 A;  4PPE A;  4LAD B;  1LDK C;  2CKL A;  2ZET C;  3HCT A;  5FEY A;  5LKX A;  5KH3 A;  3PUR A;  3GL6 A;  3LRQ A;  2LV9 A;  5H1T A;  2LRI C;  1ZBD B;  2YQM A;  1DVP A;  1G25 A;  2KR4 A;  2M3H A;  1WGM A;  2G43 A;  2KIZ A;  2CT2 A;  2MIQ A;  2VPG A;  4AP4 A;  2MUM A;  3QZV A;  4AUQ B;  2CKL B;  2KWO A;  5G05 B;  2M1R A;  3N9L A;  4B7Y C;  5KH7 A;  4XI1 A;  5KH9 A;  2LDR A;  2VNF A;  3SOX A;  2LQ6 A;  4GNF A;  1Z2Q A;  3EB6 A;  3M99 A;  3C6W A;  2YT5 A;  5B8D A;  4V3K C;  1HYI A;  2ECW A;  3RPG C;  3ZNI A;  1T1H A;  1CHC A;  2YW8 A;  1X4J A;  2Y43 A;  3SOW A;  4TKP B;  3KV6 A;  4I7B A;  3DPL R;  2CSY A;  2YHO A;  2QJ0 A;  2DX8 A;  2I50 A;  2Y1N A;  4YAB A;  2MD8 C;  3U5M A;  2KE1 A;  5EYA F;  1JM7 B;  2EA6 A;  2EOD A;  2C2L A;  4N3W A;  4PTB A;  1VD4 A;  5DKA A;  2H0D A;  3ZVY A;  5FB0 A;  2ECG A;  1WEM A;  5LCW B;  4C9Z A;  3MHH A;  2FUU A;  2VJF B;  1HYJ A;  3LQH A;  3N9M A;  2KWJ A;  2MNZ A;  2XEU A;  2PUY A;  3N9P A;  3V43 A;  3N9Q A;  4CA1 A;  2VPE A;  3RPG B;  4YBM A;  2L5U A;  5B77 A;  3KNV A;  4R2Y A;  2ECJ A;  2PNX A;  4YBS A;  4Q6F A;  1WEP A;  4YBT A;  3T6R A;  3ASL A;  1WEW A;  5AIT A;  1VYX A;  3LQJ A;  3O37 A;  2L80 A;  1MM3 A;  4BBQ A;  4X3G A;  3C5K A;  4ZUX U;  2RI7 A;  4W4U A;  5LKT A;  3RTR B;  2KRE A;  3NG2 A;  2BAY A;  2MA6 A;  2MA5 A;  3T7L A;  4I7D A;  5C13 A;  1VFY A;  2M6M A;  4FIP A;  2LN0 A;  2YUR A;  2L0B A;  1RMD A;  1MM2 A;  4A4B A;  5H1U A;  5TBN A;  4O64 A;  3U5O A;  3MHS A;  3EB5 A;  3ZPV 1;  4NN2 A;  5TDR A;  2YSM A;  2ECV A;  4B86 C;  2VJE B;  3L1Z B;  5TDW A;  5TRB A;  2HDP A;  1N87 A;  4FK5 A;  4S3O C;  4UP0 A;  2KU3 A;  4MVT A;  1FP0 A;  2KWK A;  4R8P K;  1WEN A;  2KYU A;  1WES A;  1WIL A;  3SOU A;  2F6N A;  2KWN A;  1Z60 A;  4F52 B;  2VJE A;  5AIU A;  5D1K B;  2ECN A;  2F42 A;  3O33 A;  4UP5 A;  1LDJ B;  2KGG A;  2L43 A;  4WZ3 B;  2E6R A;  3PHD A;  5I3L A;  5LKZ A;  4YAT A;  2F6J A;  2QIZ A;  5G0F A;  2EGP A;  2YQL A;  2YSJ A;  5B75 A;  4I7C A;  4P5O B;  2LGG A;  5D1M B;  4ZQL A;  4LKA A;  4YAD A;  4S3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...