2VP7A

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'MGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKFFHRICTGMTETAYGLLTAEASAVWGCDTCMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vp7A00
2YQLA 3PUQA 3N9QA 2YHOA 4LKAA 2D8SA 1T1HA 1WGMA 2LQ6A 3EB6A 4V3KC 2I50A 1CHCA 3HCSA 4GNGA 2Y1NA 2MUMA 5TDWA 2M85A 2G6QA 4GB0A 2C2VS 3FL2A 3EB5A 2FUUA 4NN2A 3ZPV1 5B76A 4F52B 3I2DA 2K17A 1IYMA 1WFKA 4B7YC 1WILA 3T7LA 2KFTA 4WZ0A 4CCGX 2ECJA 3VK6A 3O35A 4I7BA 3RTRB 2ECNA 4YBMA 5KH7A 2RI7A 2CKLB 3MHHA 1Z6UA 1Z2QA 1WEMA 2PNXA 4R2YA 3N9OA 2QIZA 3N9PA 2L80A 4FK5A 2YYRA 2L0BA 1LDJB 2MIQA 3RPGC 2JMDA 1G25A 1DVPA 4YC9A 2Y43A 1WEQA 2VP7A 5C13A 2CKLA 3SOXA 2LGVA 2MNZA 4WZ3B 4L7XA 5I3LA 1HYJA 5H1UA 2EA6A 3C6WA 3ZVZB 2KGGA 3O34A 2KIZA 1JM7B 4WZ2A 4V3LC 3GV4A 2KREA 2MNYA 4PTBA 4PPEA 5EYAF 3N9LA 1WEVA 3GL6A 2LXPC 4GNFA 3O7AA 2YSMA 1X4JA 2VPBA 1WEUA 4S3OC 3V43A 4UI9B 5LKUA 3ZVYA 4QF3A 3IHPA 5G04B 2ZETC 2YREA 5J3XA 4AYCB 4C9ZA 1VYXA 5G0FA 2LRIC 2LGGA 1WEEA 2H0DB 3U5OA 2LDRA 5G05B 3HTKC 2VJFA 1HYIA 4N4FA 5H9MA 1K2FA 2FSAA 5AITA 2KU3A 2F6JA 4X3GA 2CSZA 2AN6A 4AYCA 2NAAA 3NG2A 4FO9A 3ZTGA 2K16A 2E6RA 5H1VA 3KV6A 2H0DA 4A49A 2KE1A 3PURA 5B8DA 4GNDA 4LLBA 4I7CA 2KR4A 3C5KA 3HCUA 2HYED 2K1JA 2G45A 1JOCA 3DPLR 4FJCA 3SOUA 3M62A 5C11A 3RPGB 3N9MA 4ZUXU 4LK9A 2E6SA 3MHSA 1WEWA 4R7EA 5TBNA 5TABA 2C2LA 3ASLA 2FUIA 5D1KB 1WENA 4FIPA 4IC3A 5B77A 5D1MB 4LADB 1BORA 3SHBA 4A4BA 3T6RA 2MT5A 3KV5A 2UZGA 3QZVA 1F62A 3M99A 4S3OB 3U5PA 1U6GB 2ECGA 2ECTA 3ZPVE 2YT5A 2F42A 2VPGA 3KQIA 2MA5A 2IDAA 2JRJA 2KYUA 2VJFB 3SOWA 2HDPA 1FBVA 4UP5A 2YHNA 2M3HA 1X4UA 5H1TA 1V87A 2ECVA 4ZDTA 2MD8C 1ZBDB 2L43A 2XEUA 2LGLA 1N87A 2L5UA 2BAYA 1WE9A 2M1RA 3DQVR 2QICA 4WA6A 2VJEB 1VD4A 4YAXA 2OXQC 5LKTA 3L1ZB 1VFYA 4YADA 2LN0A 5KH9A 2Y1MA 1X4IA 3M63A 2KGIA 4B86C 2CT2A 1FP0A 4BHWA 3LQHA 2YUCA 4O64A 2EODA 2VNFA 2KWNA 5LKZA 5D1LB 2MD7B 2VJEA 2XB1A 5TDRA 2ECIA 2YSJA 5JG6A 2LGKA 5FB1A 4R8PK 2JMIA 2G43A 4ZQLA 3LQJA 1WEPA 2KWOA 5KH3A 2VPEA 5B78A 4L58A 4MVTA 4AVXA 4BBQA 4TKPB 1WEOA 3LRQA 4A0CD 3N9NA 2KWKA 4GNEA 4AP4A 2QJ0A 4QF2A 2YU4A 2LV9A 4YATA 2DX8A 3L11A 4MSXA 4CA1A 4N3WA 4YBTA 4YABA 2ECWA 4Q6FA 2JMJA 2K4DA 2YQMA 2M6MA 3L1XA 3O33A 1WIMA 5FERA 1RMDA 2L75A 2VPDA 1MM2A 1MM3A 4IC2A 5DKAA 4LJNA 2YW8A 4XI1A 1XWHA 1WESA 5FEYA 1LDKC 2RSDA 3O36A 3O37A 2PUYA 5AIUA 2CSYA 3ZNIA 5FB0A 4UP0A 3O70A 3U5MA 2YURA 4AUQB 3LQIA 2MA6A 5LCWB 3KNVA 2F6NA 3ZYQA 5LKXA 4YBSA 4P5OB 3HCTA 4W4UA 1Z60A 2KWJA 2LXHC 4I7DA 3PHDA 5TRBA 5B79A 3U5NA 4A4CA 5DINA 5B75A 2EGPA 1JM7A 1E4UA
chains in the Genus database with same CATH superfamily
2YQLA 3PUQA 3N9QA 2YHOA 2XOCA 4LKAA 2D8SA 1T1HA 1WGMA 2XOZA 3M7KA 2LQ6A 3EB6A 4V3KC 2I50A 1CHCA 3HCSA 4GNGA 2Y1NA 2MUMA 5TDWA 2M85A 2G6QA 4GB0A 2C2VS 3FL2A 3EB5A 2FUUA 4NN2A 3ZPV1 5B76A 3FAOA 4F52B 3I2DA 2K17A 1IYMA 1WFKA 4B7YC 1WILA 3T7LA 2KFTA 4WZ0A 4CCGX 2ECJA 3VK6A 3SUBA 3O35A 4I7BA 3RTRB 2ECNA 4YBMA 5KH7A 2RI7A 3JUEA 2EGMA 2CKLB 3MHHA 3DWDA 1Z6UA 1Z2QA 1WEMA 2PNXA 4R2YA 3N9OA 2QIZA 3N9PA 4O62A 2L80A 4FK5A 2YYRA 2L0BA 1LDJB 2MIQA 3RPGC 2JMDA 1G25A 1DVPA 4YC9A 2Y43A 1WEQA 2VP7A 5C13A 2CKLA 3SOXA 2LGVA 2MNZA 4WZ3B 4L7XA 5I3LA 1HYJA 5H1UA 2EA6A 3C6WA 3ZVZB 2KGGA 3O34A 2KIZA 4F1PA 1JM7B 4WZ2A 4V3LC 3GV4A 3FEHA 2KREA 2MNYA 4PTBA 4PPEA 5EYAF 3N9LA 1WEVA 3GL6A 2OWAA 2LXPC 4GNFA 3O7AA 2YSMA 1X4JA 2VPBA 5SVXA 1WEUA 4S3OC 3V43A 4UI9B 5LKUA 3ZVYA 4QF3A 3IHPA 5G04B 2ZETC 2YREA 5J3XA 4AYCB 4C9ZA 1VYXA 2KKYA 5G0FA 2LAUA 2LRIC 2LGGA 1WEEA 2H0DB 3U5OA 2LDRA 5G05B 3HTKC 2VJFA 1HYIA 4N4FA 5H9MA 1K2FA 2D8UA 2FSAA 5AITA 2KU3A 2F6JA 4X3GA 2CSZA 2AN6A 2CSVA 4AYCA 2NAAA 3NG2A 4FO9A 3ZTGA 2K16A 2E6RA 3LVQE 5H1VA 3KV6A 2H0DA 3O47A 4A49A 2KE1A 2CONA 3PURA 5B8DA 4GNDA 4LLBA 4I7CA 2KR4A 3C5KA 3HCUA 2HYED 2KKXA 2K1JA 3LJUX 2G45A 1JOCA 3DPLR 4FJCA 3SOUA 3M62A 5C11A 3RPGB 3N9MA 4ZUXU 4LK9A 1MBMA 2E6SA 3MHSA 1WEWA 4R7EA 5TBNA 5TABA 3FJUB 2C2LA 3ASLA 2FUIA 5D1KB 1WENA 4FIPA 4IC3A 5B77A 5D1MB 4LADB 1BORA 2EXUA 3SHBA 4A4BA 3T6RA 2MT5A 3KV5A 2UZGA 3QZVA 4OGEA 1F62A 3M99A 4S3OB 3U5PA 1U6GB 2ECGA 2ECTA 3ZPVE 3Q1DA 2YT5A 2F42A 2VPGA 3KQIA 2MA5A 2IDAA 2P57A 2DSMA 2JRJA 2KYUA 2MKEA 2VJFB 3SOWA 2HDPA 2RR4A 2M13A 1FBVA 4UP5A 2YHNA 4OGCA 2M3HA 1X4UA 5H1TA 2FFWA 1V87A 1DCQA 2ECVA 2XOYA 4ZDTA 2MD8C 1ZBDB 2L43A 2XEUA 2LGLA 5K3QA 1N87A 4Z0OA 2L5UA 2BAYA 1WE9A 2M1RA 3DQVR 2QICA 4WA6A 2VJEB 1VD4A 4YAXA 2JM3A 2OXQC 5LKTA 3L1ZB 3FANA 3T9KA 1VFYA 4YADA 2LN0A 2DJAA 3KDEC 5KH9A 2Y1MA 1X4IA 3M63A 2KGIA 4B86C 2CT2A 1FP0A 4BHWA 3LQHA 2YUCA 4O64A 2EODA 3E2DA 2VNFA 2KWNA 5LKZA 5D1LB 2MD7B 2VJEA 2XB1A 5TDRA 2ECIA 2YSJA 5JG6A 3LDYA 2XP0A 2LGKA 2CRWA 5FB1A 4QQ4A 4R8PK 2JMIA 2G43A 2JUNA 4ZQLA 3LQJA 1WEPA 2KWOA 3H7HA 5KH3A 2VPEA 5B78A 4L58A 4MVTA 4AVXA 4BBQA 4TKPB 1WEOA 2IQJA 3LRQA 4A0CD 3N9NA 2KWKA 4GNEA 4AP4A 2QJ0A 4QF2A 2YU4A 2LV9A 4YATA 2DX8A 3L11A 4MSXA 4CA1A 2FD4A 4N3WA 4YBTA 4YABA 5SVIB 2ECWA 4Q6FA 2JMJA 2K4DA 2YQMA 2M6MA 3L1XA 3DDTA 3O33A 3PLWA 1WIMA 5FERA 1RMDA 2L75A 2VPDA 1MM2A 4H9DA 4Z0RA 1MM3A 4IC2A 5DKAA 4LJNA 2YW8A 4XI1A 1XWHA 1WESA 5FEYA 5SVIA 1LDKC 2RSDA 3O36A 3O37A 2YVRA 2PUYA 5AIUA 2CSYA 3ZNIA 5FB0A 4UP0A 3O70A 3U5MA 2YURA 4AUQB 3LQIA 2MA6A 5LCWB 3KNVA 2F6NA 2EGPA 3ZYQA 5LKXA 3FM8C 4YBSA 4P5OB 3HCTA 4W4UA 1Z60A 2KWJA 3LVRE 2LXHC 4I7DA 3PHDA 2E61A 2B0OE 5TRBA 5B79A 3U5NA 4A4CA 2CRRA 2L7PA 5DINA 5SVYA 5B75A 3MDBC 1JM7A 1E4UA
chains in the Genus database with same CATH topology
2YQLA 3PUQA 3N9QA 2YHOA 4LKAA 2D8SA 1T1HA 1WGMA 2LQ6A 3EB6A 4V3KC 2I50A 1CHCA 3HCSA 4GNGA 2Y1NA 2MUMA 5TDWA 2M85A 2G6QA 4GB0A 2C2VS 3FL2A 3EB5A 2FUUA 4NN2A 3ZPV1 5B76A 4F52B 3I2DA 2K17A 1IYMA 1WFKA 4B7YC 1WILA 3T7LA 2KFTA 4WZ0A 4CCGX 2ECJA 3VK6A 3O35A 4I7BA 3RTRB 2ECNA 4YBMA 5KH7A 2RI7A 2CKLB 3MHHA 1Z6UA 1Z2QA 1WEMA 2PNXA 4R2YA 3N9OA 2QIZA 3N9PA 2L80A 4FK5A 2YYRA 2L0BA 1LDJB 2MIQA 3RPGC 2JMDA 1G25A 1DVPA 4YC9A 2Y43A 1WEQA 2VP7A 5C13A 2CKLA 3SOXA 2LGVA 2MNZA 4WZ3B 4L7XA 5I3LA 1HYJA 5H1UA 2EA6A 3C6WA 3ZVZB 2KGGA 3O34A 2KIZA 1JM7B 4WZ2A 4V3LC 3GV4A 2KREA 2MNYA 4PTBA 4PPEA 5EYAF 3N9LA 1WEVA 3GL6A 2LXPC 4GNFA 3O7AA 2YSMA 1X4JA 2VPBA 1WEUA 4S3OC 3V43A 4UI9B 5LKUA 3ZVYA 4QF3A 3IHPA 5G04B 2ZETC 2YREA 5J3XA 4AYCB 4C9ZA 1VYXA 5G0FA 2LRIC 2LGGA 1WEEA 2H0DB 3U5OA 2LDRA 5G05B 3HTKC 2VJFA 1HYIA 4N4FA 5H9MA 1K2FA 2FSAA 5AITA 2KU3A 2F6JA 4X3GA 2CSZA 2AN6A 4AYCA 2NAAA 3NG2A 4FO9A 3ZTGA 2K16A 2E6RA 5H1VA 3KV6A 2H0DA 4A49A 2KE1A 3PURA 5B8DA 4GNDA 4LLBA 4I7CA 2KR4A 3C5KA 3HCUA 2HYED 2K1JA 2G45A 1JOCA 3DPLR 4FJCA 3SOUA 3M62A 5C11A 3RPGB 3N9MA 4ZUXU 4LK9A 2E6SA 3MHSA 1WEWA 4R7EA 5TBNA 5TABA 2C2LA 3ASLA 2FUIA 5D1KB 1WENA 4FIPA 4IC3A 5B77A 5D1MB 4LADB 1BORA 3SHBA 4A4BA 3T6RA 2MT5A 3KV5A 2UZGA 3QZVA 1F62A 3M99A 4S3OB 3U5PA 1U6GB 2ECGA 2ECTA 3ZPVE 2YT5A 2F42A 2VPGA 3KQIA 2MA5A 2IDAA 2JRJA 2KYUA 2VJFB 3SOWA 2HDPA 1FBVA 4UP5A 2YHNA 2M3HA 1X4UA 5H1TA 1V87A 2ECVA 4ZDTA 2MD8C 1ZBDB 2L43A 2XEUA 2LGLA 1N87A 2L5UA 2BAYA 1WE9A 2M1RA 3DQVR 2QICA 4WA6A 2VJEB 1VD4A 4YAXA 2OXQC 5LKTA 3L1ZB 1VFYA 4YADA 2LN0A 5KH9A 2Y1MA 1X4IA 3M63A 2KGIA 4B86C 2CT2A 1FP0A 4BHWA 3LQHA 2YUCA 4O64A 2EODA 2VNFA 2KWNA 5LKZA 5D1LB 2MD7B 2VJEA 2XB1A 5TDRA 2ECIA 2YSJA 5JG6A 2LGKA 5FB1A 4R8PK 2JMIA 2G43A 4ZQLA 3LQJA 1WEPA 2KWOA 5KH3A 2VPEA 5B78A 4L58A 4MVTA 4AVXA 4BBQA 4TKPB 1WEOA 3LRQA 4A0CD 3N9NA 2KWKA 4GNEA 4AP4A 2QJ0A 4QF2A 2YU4A 2LV9A 4YATA 2DX8A 3L11A 4MSXA 4CA1A 4N3WA 4YBTA 4YABA 2ECWA 4Q6FA 2JMJA 2K4DA 2YQMA 2M6MA 3L1XA 3O33A 1WIMA 5FERA 1RMDA 2L75A 2VPDA 1MM2A 1MM3A 4IC2A 5DKAA 4LJNA 2YW8A 4XI1A 1XWHA 1WESA 5FEYA 1LDKC 2RSDA 3O36A 3O37A 2PUYA 5AIUA 2CSYA 3ZNIA 5FB0A 4UP0A 3O70A 3U5MA 2YURA 4AUQB 3LQIA 2MA6A 5LCWB 3KNVA 2F6NA 3ZYQA 5LKXA 4YBSA 4P5OB 3HCTA 4W4UA 1Z60A 2KWJA 2LXHC 4I7DA 3PHDA 5TRBA 5B79A 3U5NA 4A4CA 5DINA 5B75A 2EGPA 1JM7A 1E4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQL A;  3PUQ A;  3N9Q A;  2YHO A;  4LKA A;  2D8S A;  1T1H A;  1WGM A;  2LQ6 A;  3EB6 A;  4V3K C;  2I50 A;  1CHC A;  3HCS A;  4GNG A;  2Y1N A;  2MUM A;  5TDW A;  2M85 A;  2G6Q A;  4GB0 A;  2C2V S;  3FL2 A;  3EB5 A;  2FUU A;  4NN2 A;  3ZPV 1;  5B76 A;  4F52 B;  3I2D A;  2K17 A;  1IYM A;  1WFK A;  4B7Y C;  1WIL A;  3T7L A;  2KFT A;  4WZ0 A;  4CCG X;  2ECJ A;  3VK6 A;  3O35 A;  4I7B A;  3RTR B;  2ECN A;  4YBM A;  5KH7 A;  2RI7 A;  2CKL B;  3MHH A;  1Z6U A;  1Z2Q A;  1WEM A;  2PNX A;  4R2Y A;  3N9O A;  2QIZ A;  3N9P A;  2L80 A;  4FK5 A;  2YYR A;  2L0B A;  1LDJ B;  2MIQ A;  3RPG C;  2JMD A;  1G25 A;  1DVP A;  4YC9 A;  2Y43 A;  1WEQ A;  2VP7 A;  5C13 A;  2CKL A;  3SOX A;  2LGV A;  2MNZ A;  4WZ3 B;  4L7X A;  5I3L A;  1HYJ A;  5H1U A;  2EA6 A;  3C6W A;  3ZVZ B;  2KGG A;  3O34 A;  2KIZ A;  1JM7 B;  4WZ2 A;  4V3L C;  3GV4 A;  2KRE A;  2MNY A;  4PTB A;  4PPE A;  5EYA F;  3N9L A;  1WEV A;  3GL6 A;  2LXP C;  4GNF A;  3O7A A;  2YSM A;  1X4J A;  2VPB A;  1WEU A;  4S3O C;  3V43 A;  4UI9 B;  5LKU A;  3ZVY A;  4QF3 A;  3IHP A;  5G04 B;  2ZET C;  2YRE A;  5J3X A;  4AYC B;  4C9Z A;  1VYX A;  5G0F A;  2LRI C;  2LGG A;  1WEE A;  2H0D B;  3U5O A;  2LDR A;  5G05 B;  3HTK C;  2VJF A;  1HYI A;  4N4F A;  5H9M A;  1K2F A;  2FSA A;  5AIT A;  2KU3 A;  2F6J A;  4X3G A;  2CSZ A;  2AN6 A;  4AYC A;  2NAA A;  3NG2 A;  4FO9 A;  3ZTG A;  2K16 A;  2E6R A;  5H1V A;  3KV6 A;  2H0D A;  4A49 A;  2KE1 A;  3PUR A;  5B8D A;  4GND A;  4LLB A;  4I7C A;  2KR4 A;  3C5K A;  3HCU A;  2HYE D;  2K1J A;  2G45 A;  1JOC A;  3DPL R;  4FJC A;  3SOU A;  3M62 A;  5C11 A;  3RPG B;  3N9M A;  4ZUX U;  4LK9 A;  2E6S A;  3MHS A;  1WEW A;  4R7E A;  5TBN A;  5TAB A;  2C2L A;  3ASL A;  2FUI A;  5D1K B;  1WEN A;  4FIP A;  4IC3 A;  5B77 A;  5D1M B;  4LAD B;  1BOR A;  3SHB A;  4A4B A;  3T6R A;  2MT5 A;  3KV5 A;  2UZG A;  3QZV A;  1F62 A;  3M99 A;  4S3O B;  3U5P A;  1U6G B;  2ECG A;  2ECT A;  3ZPV E;  2YT5 A;  2F42 A;  2VPG A;  3KQI A;  2MA5 A;  2IDA A;  2JRJ A;  2KYU A;  2VJF B;  3SOW A;  2HDP A;  1FBV A;  4UP5 A;  2YHN A;  2M3H A;  1X4U A;  5H1T A;  1V87 A;  2ECV A;  4ZDT A;  2MD8 C;  1ZBD B;  2L43 A;  2XEU A;  2LGL A;  1N87 A;  2L5U A;  2BAY A;  1WE9 A;  2M1R A;  3DQV R;  2QIC A;  4WA6 A;  2VJE B;  1VD4 A;  4YAX A;  2OXQ C;  5LKT A;  3L1Z B;  1VFY A;  4YAD A;  2LN0 A;  5KH9 A;  2Y1M A;  1X4I A;  3M63 A;  2KGI A;  4B86 C;  2CT2 A;  1FP0 A;  4BHW A;  3LQH A;  2YUC A;  4O64 A;  2EOD A;  2VNF A;  2KWN A;  5LKZ A;  5D1L B;  2MD7 B;  2VJE A;  2XB1 A;  5TDR A;  2ECI A;  2YSJ A;  5JG6 A;  2LGK A;  5FB1 A;  4R8P K;  2JMI A;  2G43 A;  4ZQL A;  3LQJ A;  1WEP A;  2KWO A;  5KH3 A;  2VPE A;  5B78 A;  4L58 A;  4MVT A;  4AVX A;  4BBQ A;  4TKP B;  1WEO A;  3LRQ A;  4A0C D;  3N9N A;  2KWK A;  4GNE A;  4AP4 A;  2QJ0 A;  4QF2 A;  2YU4 A;  2LV9 A;  4YAT A;  2DX8 A;  3L11 A;  4MSX A;  4CA1 A;  4N3W A;  4YBT A;  4YAB A;  2ECW A;  4Q6F A;  2JMJ A;  2K4D A;  2YQM A;  2M6M A;  3L1X A;  3O33 A;  1WIM A;  5FER A;  1RMD A;  2L75 A;  2VPD A;  1MM2 A;  1MM3 A;  4IC2 A;  5DKA A;  4LJN A;  2YW8 A;  4XI1 A;  1XWH A;  1WES A;  5FEY A;  1LDK C;  2RSD A;  3O36 A;  3O37 A;  2PUY A;  5AIU A;  2CSY A;  3ZNI A;  5FB0 A;  4UP0 A;  3O70 A;  3U5M A;  2YUR A;  4AUQ B;  3LQI A;  2MA6 A;  5LCW B;  3KNV A;  2F6N A;  3ZYQ A;  5LKX A;  4YBS A;  4P5O B;  3HCT A;  4W4U A;  1Z60 A;  2KWJ A;  2LXH C;  4I7D A;  3PHD A;  5TRB A;  5B79 A;  3U5N A;  4A4C A;  5DIN A;  5B75 A;  2EGP A;  1JM7 A;  1E4U A; 
#chains in the Genus database with same CATH topology
 2YQL A;  3PUQ A;  3N9Q A;  2YHO A;  2XOC A;  4LKA A;  2D8S A;  1T1H A;  1WGM A;  2XOZ A;  3M7K A;  2LQ6 A;  3EB6 A;  4V3K C;  2I50 A;  1CHC A;  3HCS A;  4GNG A;  2Y1N A;  2MUM A;  5TDW A;  2M85 A;  2G6Q A;  4GB0 A;  2C2V S;  3FL2 A;  3EB5 A;  2FUU A;  4NN2 A;  3ZPV 1;  5B76 A;  3FAO A;  4F52 B;  3I2D A;  2K17 A;  1IYM A;  1WFK A;  4B7Y C;  1WIL A;  3T7L A;  2KFT A;  4WZ0 A;  4CCG X;  2ECJ A;  3VK6 A;  3SUB A;  3O35 A;  4I7B A;  3RTR B;  2ECN A;  4YBM A;  5KH7 A;  2RI7 A;  3JUE A;  2EGM A;  2CKL B;  3MHH A;  3DWD A;  1Z6U A;  1Z2Q A;  1WEM A;  2PNX A;  4R2Y A;  3N9O A;  2QIZ A;  3N9P A;  4O62 A;  2L80 A;  4FK5 A;  2YYR A;  2L0B A;  1LDJ B;  2MIQ A;  3RPG C;  2JMD A;  1G25 A;  1DVP A;  4YC9 A;  2Y43 A;  1WEQ A;  2VP7 A;  5C13 A;  2CKL A;  3SOX A;  2LGV A;  2MNZ A;  4WZ3 B;  4L7X A;  5I3L A;  1HYJ A;  5H1U A;  2EA6 A;  3C6W A;  3ZVZ B;  2KGG A;  3O34 A;  2KIZ A;  4F1P A;  1JM7 B;  4WZ2 A;  4V3L C;  3GV4 A;  3FEH A;  2KRE A;  2MNY A;  4PTB A;  4PPE A;  5EYA F;  3N9L A;  1WEV A;  3GL6 A;  2OWA A;  2LXP C;  4GNF A;  3O7A A;  2YSM A;  1X4J A;  2VPB A;  5SVX A;  1WEU A;  4S3O C;  3V43 A;  4UI9 B;  5LKU A;  3ZVY A;  4QF3 A;  3IHP A;  5G04 B;  2ZET C;  2YRE A;  5J3X A;  4AYC B;  4C9Z A;  1VYX A;  2KKY A;  5G0F A;  2LAU A;  2LRI C;  2LGG A;  1WEE A;  2H0D B;  3U5O A;  2LDR A;  5G05 B;  3HTK C;  2VJF A;  1HYI A;  4N4F A;  5H9M A;  1K2F A;  2D8U A;  2FSA A;  5AIT A;  2KU3 A;  2F6J A;  4X3G A;  2CSZ A;  2AN6 A;  2CSV A;  4AYC A;  2NAA A;  3NG2 A;  4FO9 A;  3ZTG A;  2K16 A;  2E6R A;  3LVQ E;  5H1V A;  3KV6 A;  2H0D A;  3O47 A;  4A49 A;  2KE1 A;  2CON A;  3PUR A;  5B8D A;  4GND A;  4LLB A;  4I7C A;  2KR4 A;  3C5K A;  3HCU A;  2HYE D;  2KKX A;  2K1J A;  3LJU X;  2G45 A;  1JOC A;  3DPL R;  4FJC A;  3SOU A;  3M62 A;  5C11 A;  3RPG B;  3N9M A;  4ZUX U;  4LK9 A;  1MBM A;  2E6S A;  3MHS A;  1WEW A;  4R7E A;  5TBN A;  5TAB A;  3FJU B;  2C2L A;  3ASL A;  2FUI A;  5D1K B;  1WEN A;  4FIP A;  4IC3 A;  5B77 A;  5D1M B;  4LAD B;  1BOR A;  2EXU A;  3SHB A;  4A4B A;  3T6R A;  2MT5 A;  3KV5 A;  2UZG A;  3QZV A;  4OGE A;  1F62 A;  3M99 A;  4S3O B;  3U5P A;  1U6G B;  2ECG A;  2ECT A;  3ZPV E;  3Q1D A;  2YT5 A;  2F42 A;  2VPG A;  3KQI A;  2MA5 A;  2IDA A;  2P57 A;  2DSM A;  2JRJ A;  2KYU A;  2MKE A;  2VJF B;  3SOW A;  2HDP A;  2RR4 A;  2M13 A;  1FBV A;  4UP5 A;  2YHN A;  4OGC A;  2M3H A;  1X4U A;  5H1T A;  2FFW A;  1V87 A;  1DCQ A;  2ECV A;  2XOY A;  4ZDT A;  2MD8 C;  1ZBD B;  2L43 A;  2XEU A;  2LGL A;  5K3Q A;  1N87 A;  4Z0O A;  2L5U A;  2BAY A;  1WE9 A;  2M1R A;  3DQV R;  2QIC A;  4WA6 A;  2VJE B;  1VD4 A;  4YAX A;  2JM3 A;  2OXQ C;  5LKT A;  3L1Z B;  3FAN A;  3T9K A;  1VFY A;  4YAD A;  2LN0 A;  2DJA A;  3KDE C;  5KH9 A;  2Y1M A;  1X4I A;  3M63 A;  2KGI A;  4B86 C;  2CT2 A;  1FP0 A;  4BHW A;  3LQH A;  2YUC A;  4O64 A;  2EOD A;  3E2D A;  2VNF A;  2KWN A;  5LKZ A;  5D1L B;  2MD7 B;  2VJE A;  2XB1 A;  5TDR A;  2ECI A;  2YSJ A;  5JG6 A;  3LDY A;  2XP0 A;  2LGK A;  2CRW A;  5FB1 A;  4QQ4 A;  4R8P K;  2JMI A;  2G43 A;  2JUN A;  4ZQL A;  3LQJ A;  1WEP A;  2KWO A;  3H7H A;  5KH3 A;  2VPE A;  5B78 A;  4L58 A;  4MVT A;  4AVX A;  4BBQ A;  4TKP B;  1WEO A;  2IQJ A;  3LRQ A;  4A0C D;  3N9N A;  2KWK A;  4GNE A;  4AP4 A;  2QJ0 A;  4QF2 A;  2YU4 A;  2LV9 A;  4YAT A;  2DX8 A;  3L11 A;  4MSX A;  4CA1 A;  2FD4 A;  4N3W A;  4YBT A;  4YAB A;  5SVI B;  2ECW A;  4Q6F A;  2JMJ A;  2K4D A;  2YQM A;  2M6M A;  3L1X A;  3DDT A;  3O33 A;  3PLW A;  1WIM A;  5FER A;  1RMD A;  2L75 A;  2VPD A;  1MM2 A;  4H9D A;  4Z0R A;  1MM3 A;  4IC2 A;  5DKA A;  4LJN A;  2YW8 A;  4XI1 A;  1XWH A;  1WES A;  5FEY A;  5SVI A;  1LDK C;  2RSD A;  3O36 A;  3O37 A;  2YVR A;  2PUY A;  5AIU A;  2CSY A;  3ZNI A;  5FB0 A;  4UP0 A;  3O70 A;  3U5M A;  2YUR A;  4AUQ B;  3LQI A;  2MA6 A;  5LCW B;  3KNV A;  2F6N A;  2EGP A;  3ZYQ A;  5LKX A;  3FM8 C;  4YBS A;  4P5O B;  3HCT A;  4W4U A;  1Z60 A;  2KWJ A;  3LVR E;  2LXH C;  4I7D A;  3PHD A;  2E61 A;  2B0O E;  5TRB A;  5B79 A;  3U5N A;  4A4C A;  2CRR A;  2L7P A;  5DIN A;  5SVY A;  5B75 A;  3MDB C;  1JM7 A;  1E4U A; 
#chains in the Genus database with same CATH homology
 2YQL A;  3PUQ A;  3N9Q A;  2YHO A;  4LKA A;  2D8S A;  1T1H A;  1WGM A;  2LQ6 A;  3EB6 A;  4V3K C;  2I50 A;  1CHC A;  3HCS A;  4GNG A;  2Y1N A;  2MUM A;  5TDW A;  2M85 A;  2G6Q A;  4GB0 A;  2C2V S;  3FL2 A;  3EB5 A;  2FUU A;  4NN2 A;  3ZPV 1;  5B76 A;  4F52 B;  3I2D A;  2K17 A;  1IYM A;  1WFK A;  4B7Y C;  1WIL A;  3T7L A;  2KFT A;  4WZ0 A;  4CCG X;  2ECJ A;  3VK6 A;  3O35 A;  4I7B A;  3RTR B;  2ECN A;  4YBM A;  5KH7 A;  2RI7 A;  2CKL B;  3MHH A;  1Z6U A;  1Z2Q A;  1WEM A;  2PNX A;  4R2Y A;  3N9O A;  2QIZ A;  3N9P A;  2L80 A;  4FK5 A;  2YYR A;  2L0B A;  1LDJ B;  2MIQ A;  3RPG C;  2JMD A;  1G25 A;  1DVP A;  4YC9 A;  2Y43 A;  1WEQ A;  2VP7 A;  5C13 A;  2CKL A;  3SOX A;  2LGV A;  2MNZ A;  4WZ3 B;  4L7X A;  5I3L A;  1HYJ A;  5H1U A;  2EA6 A;  3C6W A;  3ZVZ B;  2KGG A;  3O34 A;  2KIZ A;  1JM7 B;  4WZ2 A;  4V3L C;  3GV4 A;  2KRE A;  2MNY A;  4PTB A;  4PPE A;  5EYA F;  3N9L A;  1WEV A;  3GL6 A;  2LXP C;  4GNF A;  3O7A A;  2YSM A;  1X4J A;  2VPB A;  1WEU A;  4S3O C;  3V43 A;  4UI9 B;  5LKU A;  3ZVY A;  4QF3 A;  3IHP A;  5G04 B;  2ZET C;  2YRE A;  5J3X A;  4AYC B;  4C9Z A;  1VYX A;  5G0F A;  2LRI C;  2LGG A;  1WEE A;  2H0D B;  3U5O A;  2LDR A;  5G05 B;  3HTK C;  2VJF A;  1HYI A;  4N4F A;  5H9M A;  1K2F A;  2FSA A;  5AIT A;  2KU3 A;  2F6J A;  4X3G A;  2CSZ A;  2AN6 A;  4AYC A;  2NAA A;  3NG2 A;  4FO9 A;  3ZTG A;  2K16 A;  2E6R A;  5H1V A;  3KV6 A;  2H0D A;  4A49 A;  2KE1 A;  3PUR A;  5B8D A;  4GND A;  4LLB A;  4I7C A;  2KR4 A;  3C5K A;  3HCU A;  2HYE D;  2K1J A;  2G45 A;  1JOC A;  3DPL R;  4FJC A;  3SOU A;  3M62 A;  5C11 A;  3RPG B;  3N9M A;  4ZUX U;  4LK9 A;  2E6S A;  3MHS A;  1WEW A;  4R7E A;  5TBN A;  5TAB A;  2C2L A;  3ASL A;  2FUI A;  5D1K B;  1WEN A;  4FIP A;  4IC3 A;  5B77 A;  5D1M B;  4LAD B;  1BOR A;  3SHB A;  4A4B A;  3T6R A;  2MT5 A;  3KV5 A;  2UZG A;  3QZV A;  1F62 A;  3M99 A;  4S3O B;  3U5P A;  1U6G B;  2ECG A;  2ECT A;  3ZPV E;  2YT5 A;  2F42 A;  2VPG A;  3KQI A;  2MA5 A;  2IDA A;  2JRJ A;  2KYU A;  2VJF B;  3SOW A;  2HDP A;  1FBV A;  4UP5 A;  2YHN A;  2M3H A;  1X4U A;  5H1T A;  1V87 A;  2ECV A;  4ZDT A;  2MD8 C;  1ZBD B;  2L43 A;  2XEU A;  2LGL A;  1N87 A;  2L5U A;  2BAY A;  1WE9 A;  2M1R A;  3DQV R;  2QIC A;  4WA6 A;  2VJE B;  1VD4 A;  4YAX A;  2OXQ C;  5LKT A;  3L1Z B;  1VFY A;  4YAD A;  2LN0 A;  5KH9 A;  2Y1M A;  1X4I A;  3M63 A;  2KGI A;  4B86 C;  2CT2 A;  1FP0 A;  4BHW A;  3LQH A;  2YUC A;  4O64 A;  2EOD A;  2VNF A;  2KWN A;  5LKZ A;  5D1L B;  2MD7 B;  2VJE A;  2XB1 A;  5TDR A;  2ECI A;  2YSJ A;  5JG6 A;  2LGK A;  5FB1 A;  4R8P K;  2JMI A;  2G43 A;  4ZQL A;  3LQJ A;  1WEP A;  2KWO A;  5KH3 A;  2VPE A;  5B78 A;  4L58 A;  4MVT A;  4AVX A;  4BBQ A;  4TKP B;  1WEO A;  3LRQ A;  4A0C D;  3N9N A;  2KWK A;  4GNE A;  4AP4 A;  2QJ0 A;  4QF2 A;  2YU4 A;  2LV9 A;  4YAT A;  2DX8 A;  3L11 A;  4MSX A;  4CA1 A;  4N3W A;  4YBT A;  4YAB A;  2ECW A;  4Q6F A;  2JMJ A;  2K4D A;  2YQM A;  2M6M A;  3L1X A;  3O33 A;  1WIM A;  5FER A;  1RMD A;  2L75 A;  2VPD A;  1MM2 A;  1MM3 A;  4IC2 A;  5DKA A;  4LJN A;  2YW8 A;  4XI1 A;  1XWH A;  1WES A;  5FEY A;  1LDK C;  2RSD A;  3O36 A;  3O37 A;  2PUY A;  5AIU A;  2CSY A;  3ZNI A;  5FB0 A;  4UP0 A;  3O70 A;  3U5M A;  2YUR A;  4AUQ B;  3LQI A;  2MA6 A;  5LCW B;  3KNV A;  2F6N A;  3ZYQ A;  5LKX A;  4YBS A;  4P5O B;  3HCT A;  4W4U A;  1Z60 A;  2KWJ A;  2LXH C;  4I7D A;  3PHD A;  5TRB A;  5B79 A;  3U5N A;  4A4C A;  5DIN A;  5B75 A;  2EGP A;  1JM7 A;  1E4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...