2VP7A

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKFFHRICTGMTETAYGLLTAEASAVWGCDTCMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vp7A00
3U5NA 2H0DA 2MA6A 1WFKA 2I50A 5I3LA 2YHOA 2F6NA 3L1ZB 2MIQA 3ZYQA 1K2FA 2MT5A 5FERA 5D1KB 4YATA 4UP5A 4WZ0A 3VK6A 2ECNA 1WILA 2E6RA 4V3KC 2KR4A 5KH3A 3C5KA 4YBTA 5G0FA 2F42A 2EA6A 5D1MB 4C9ZA 4A49A 1IYMA 3ZVYA 2YSMA 5B79A 2YT5A 2KE1A 2M3HA 1VFYA 4UI9B 4LLBA 3LRQA 4P5OB 4CCGX 4F52B 2ECTA 2CSYA 1Z60A 2Y1NA 2AN6A 1U6GB 1WEWA 2KREA 2YW8A 2HDPA 1E4UA 2KWJA 4XI1A 4MSXA 2D8SA 3L1XA 2JMJA 4Q6FA 2KWKA 1WIMA 4WZ2A 2EGPA 3LQHA 4N3WA 2MD7B 5B78A 1JM7B 5LKUA 4L58A 2KYUA 4QF3A 3N9MA 3O36A 3T6RA 3SOWA 3DQVR 3ASLA 4LJNA 4A4BA 2VPEA 2VJEB 1N87A 3N9LA 2VP7A 2L0BA 4UP0A 4FO9A 4PTBA 1WEQA 3V43A 2ECVA 3SHBA 5FB1A 2MNYA 4FIPA 4AP4A 2YUCA 2L43A 5D1LB 1WEMA 4YBMA 2K17A 4ZDTA 5TDRA 2KWNA 3SOUA 3O35A 2Y1MA 3ZNIA 4IC2A 4WZ3B 4O64A 4R8PK 3ZVZB 4AYCB 2G43A 3NG2A 1X4UA 3O34A 2IDAA 3M62A 2CKLB 1HYJA 2OXQC 2VPBA 2LGLA 4GB0A 1ZBDB 1WEUA 2EODA 4NN2A 5LKZA 2MUMA 4GNFA 2K1JA 4R7EA 3LQJA 4IC3A 2M6MA 3I2DA 5C11A 5TRBA 5H1VA 3N9NA 2K4DA 3N9OA 3HTKC 3O33A 3HCUA 1LDJB 3ZPVE 3RTRB 2FSAA 4YAXA 2ZETC 2ECIA 2MNZA 4GNGA 1HYIA 4WA6A 1WE9A 3MHHA 1V87A 2YSJA 3HCSA 5JG6A 2ECJA 1XWHA 4N4FA 5TBNA 3ZTGA 2VJFB 5G05B 5B75A 1WEOA 1X4JA 2C2VS 3M99A 2LXHC 3QZVA 2G6QA 4L7XA 3GL6A 1MM2A 2M85A 3O37A 2QJ0A 4YADA 1G25A 4V3LC 3EB6A 5DINA 3O70A 3PURA 5DKAA 1VD4A 2PUYA 1DVPA 3KV5A 2QICA 4I7BA 2YHNA 2H0DB 1CHCA 1WGMA 3O7AA 1WENA 5EYAF 1WEEA 5TABA 1Z2QA 2LN0A 2RSDA 2JMDA 2HYED 2YQLA 4I7CA 3U5OA 3EB5A 2K16A 1WEPA 1RMDA 5B77A 3SOXA 5TDWA 1BORA 4W4UA 4GNDA 3N9PA 3LQIA 2BAYA 4ZUXU 3GV4A 4MVTA 2VNFA 2F6JA 3PHDA 3T7LA 5FEYA 2Y43A 2KIZA 3KNVA 2VPDA 5J3XA 5AITA 2JMIA 3ZPV1 4A4CA 5H9MA 2YYRA 3U5PA 2ECGA 4LADB 1JM7A 4AVXA 2LV9A 1WEVA 1WESA 1Z6UA 5KH9A 4YC9A 4FJCA 2CSZA 5H1UA 2VJEA 2RI7A 2LDRA 1LDKC 4I7DA 2PNXA 2LRIC 2G45A 4ZQLA 1F62A 3KQIA 2L75A 2LGVA 4LKAA 2QIZA 2KGGA 4CA1A 4BHWA 1MM3A 2KWOA 2NAAA 3RPGB 4FK5A 4BBQA 4AYCA 4B7YC 2CKLA 2KGIA 4PPEA 4S3OC 5FB0A 5H1TA 3L11A 2JRJA 2XB1A 5B8DA 5KH7A 2YU4A 2L5UA 4B86C 2MA5A 2DX8A 2KU3A 2LGGA 2ECWA 5G04B 5C13A 1X4IA 2KFTA 1JOCA 2CT2A 4YABA 3N9QA 2UZGA 4X3GA 2C2LA 2LGKA 1T1HA 4A0CD 5LCWB 4AUQB 3FL2A 4S3OB 2YREA 3U5MA 1VYXA 2YQMA 5B76A 2VJFA 3MHSA 5LKTA 4QF2A 4LK9A 2VPGA 2LXPC 4YBSA 4R2YA 5LKXA 3IHPA 2LQ6A 2FUUA 3HCTA 4TKPB 3C6WA 5AIUA 2YURA 2E6SA 3M63A 1FP0A 3PUQA 1FBVA 2MD8C 2M1RA 4GNEA 3KV6A 2XEUA 3RPGC 3DPLR 2L80A 2FUIA
chains in the Genus database with same CATH superfamily
4F1PA 3U5NA 2H0DA 2MA6A 3JUEA 1WFKA 2I50A 5I3LA 2YHOA 2F6NA 3L1ZB 2MIQA 3ZYQA 1K2FA 2MT5A 5FERA 5D1KB 4YATA 4QQ4A 4UP5A 4WZ0A 3VK6A 2ECNA 1WILA 2E6RA 4V3KC 3MDBC 2KR4A 5KH3A 3C5KA 4YBTA 5G0FA 2F42A 2EA6A 5D1MB 4C9ZA 4A49A 2FD4A 1IYMA 3ZVYA 2YSMA 5B79A 2YT5A 2KE1A 2M3HA 1VFYA 4UI9B 4LLBA 3LRQA 4P5OB 4CCGX 4F52B 2ECTA 2CSYA 2CONA 1Z60A 2Y1NA 2AN6A 1U6GB 1WEWA 2KREA 2YW8A 2HDPA 1E4UA 1MBMA 2KWJA 4XI1A 4MSXA 2D8SA 3L1XA 5K3QA 2JMJA 4Q6FA 2KWKA 1WIMA 3FAOA 4WZ2A 2EGPA 3LQHA 4N3WA 2MD7B 2DSMA 5B78A 1JM7B 5LKUA 2KKXA 2KYUA 4L58A 4QF3A 3N9MA 3O36A 3T6RA 3SOWA 3DQVR 3ASLA 4LJNA 4A4BA 2VPEA 2VJEB 3SUBA 1N87A 3N9LA 2VP7A 2L0BA 1DCQA 4UP0A 4FO9A 2YVRA 4PTBA 1WEQA 3V43A 3DWDA 2ECVA 3SHBA 5FB1A 2MNYA 4FIPA 5SVXA 4AP4A 2YUCA 2L43A 5D1LB 1WEMA 4YBMA 2K17A 3KDEC 4ZDTA 5TDRA 2KWNA 3SOUA 3O35A 2Y1MA 3FEHA 3ZNIA 4IC2A 4WZ3B 4O64A 4R8PK 2FFWA 3ZVZB 4AYCB 5SVYA 2G43A 3NG2A 1X4UA 3O34A 2IDAA 3M62A 2CKLB 3LDYA 1HYJA 3PLWA 2OXQC 2VPBA 2LGLA 3M7KA 2D8UA 4GB0A 1ZBDB 1WEUA 2EODA 4NN2A 5LKZA 2M13A 2MUMA 5SVIA 4GNFA 2K1JA 4OGCA 4R7EA 3LQJA 4IC3A 2M6MA 3I2DA 5C11A 5TRBA 5H1VA 3N9NA 2K4DA 4H9DA 3N9OA 3HTKC 3O33A 3HCUA 1LDJB 3ZPVE 3RTRB 2FSAA 4YAXA 2ZETC 2ECIA 2JUNA 2JM3A 2MNZA 4GNGA 1HYIA 4WA6A 1WE9A 3MHHA 1V87A 2YSJA 3HCSA 2XOYA 5JG6A 2ECJA 1XWHA 4N4FA 3DDTA 3Q1DA 5TBNA 3ZTGA 2VJFB 5G05B 5B75A 1WEOA 1X4JA 2C2VS 3M99A 2LXHC 3QZVA 2G6QA 4L7XA 3GL6A 1MM2A 2M85A 3O37A 2QJ0A 4YADA 1G25A 4V3LC 3EB6A 5DINA 3O70A 3PURA 2KKYA 5DKAA 1VD4A 2PUYA 1DVPA 3KV5A 3FJUB 2QICA 2IQJA 4I7BA 2YHNA 2H0DB 1CHCA 1WGMA 3LVRE 3O7AA 1WENA 5EYAF 1WEEA 5TABA 1Z2QA 2LN0A 2RSDA 2JMDA 2HYED 2YQLA 4I7CA 3U5OA 3EB5A 2K16A 1WEPA 1RMDA 5B77A 3SOXA 2CSVA 5TDWA 1BORA 4W4UA 2XOCA 4GNDA 3N9PA 3LQIA 2BAYA 2CRWA 4ZUXU 3GV4A 2E61A 4MVTA 2VNFA 2F6JA 3PHDA 3T7LA 5FEYA 2Y43A 2OWAA 2KIZA 3KNVA 2VPDA 5J3XA 5AITA 2JMIA 3ZPV1 4A4CA 5H9MA 2YYRA 3U5PA 2ECGA 2EGMA 4LADB 1JM7A 4AVXA 3FANA 2LV9A 1WEVA 2L7PA 2B0OE 1WESA 1Z6UA 2XP0A 5KH9A 4YC9A 4FJCA 2CSZA 5H1UA 2VJEA 2RI7A 2LDRA 4Z0OA 1LDKC 4I7DA 2PNXA 2LRIC 2G45A 4ZQLA 1F62A 3KQIA 2L75A 2LGVA 4LKAA 2QIZA 3FM8C 4O62A 2KGGA 4CA1A 4BHWA 1MM3A 3E2DA 2KWOA 2NAAA 3RPGB 4FK5A 4BBQA 4AYCA 4B7YC 3LVQE 2CKLA 2KGIA 2MKEA 4PPEA 4S3OC 3LJUX 5FB0A 5H1TA 2P57A 3H7HA 3L11A 2JRJA 2XB1A 5B8DA 5KH7A 2YU4A 2L5UA 4B86C 2EXUA 4OGEA 2MA5A 2DX8A 2KU3A 2LGGA 2ECWA 5G04B 5SVIB 5C13A 1X4IA 2KFTA 1JOCA 2CT2A 4YABA 3N9QA 2UZGA 4X3GA 2C2LA 2LGKA 1T1HA 4A0CD 2LAUA 5LCWB 2RR4A 4AUQB 3FL2A 4S3OB 2YREA 3U5MA 2DJAA 1VYXA 2YQMA 3O47A 2XOZA 5B76A 4Z0RA 3T9KA 2VJFA 3MHSA 2CRRA 4QF2A 4LK9A 2VPGA 5LKTA 2LXPC 4YBSA 4R2YA 5LKXA 3IHPA 2LQ6A 2FUUA 3HCTA 4TKPB 3C6WA 5AIUA 2YURA 2E6SA 3M63A 1FP0A 3PUQA 1FBVA 2MD8C 2M1RA 4GNEA 3KV6A 2XEUA 3RPGC 3DPLR 2L80A 2FUIA
chains in the Genus database with same CATH topology
3U5NA 2H0DA 2MA6A 1WFKA 2I50A 5I3LA 2YHOA 2F6NA 3L1ZB 2MIQA 3ZYQA 1K2FA 2MT5A 5FERA 5D1KB 4YATA 4UP5A 4WZ0A 3VK6A 2ECNA 1WILA 2E6RA 4V3KC 2KR4A 5KH3A 3C5KA 4YBTA 5G0FA 2F42A 2EA6A 5D1MB 4C9ZA 4A49A 1IYMA 3ZVYA 2YSMA 5B79A 2YT5A 2KE1A 2M3HA 1VFYA 4UI9B 4LLBA 3LRQA 4P5OB 4CCGX 4F52B 2ECTA 2CSYA 1Z60A 2Y1NA 2AN6A 1U6GB 1WEWA 2KREA 2YW8A 2HDPA 1E4UA 2KWJA 4XI1A 4MSXA 2D8SA 3L1XA 2JMJA 4Q6FA 2KWKA 1WIMA 4WZ2A 2EGPA 3LQHA 4N3WA 2MD7B 5B78A 1JM7B 5LKUA 4L58A 2KYUA 4QF3A 3N9MA 3O36A 3T6RA 3SOWA 3DQVR 3ASLA 4LJNA 4A4BA 2VPEA 2VJEB 1N87A 3N9LA 2VP7A 2L0BA 4UP0A 4FO9A 4PTBA 1WEQA 3V43A 2ECVA 3SHBA 5FB1A 2MNYA 4FIPA 4AP4A 2YUCA 2L43A 5D1LB 1WEMA 4YBMA 2K17A 4ZDTA 5TDRA 2KWNA 3SOUA 3O35A 2Y1MA 3ZNIA 4IC2A 4WZ3B 4O64A 4R8PK 3ZVZB 4AYCB 2G43A 3NG2A 1X4UA 3O34A 2IDAA 3M62A 2CKLB 1HYJA 2OXQC 2VPBA 2LGLA 4GB0A 1ZBDB 1WEUA 2EODA 4NN2A 5LKZA 2MUMA 4GNFA 2K1JA 4R7EA 3LQJA 4IC3A 2M6MA 3I2DA 5C11A 5TRBA 5H1VA 3N9NA 2K4DA 3N9OA 3HTKC 3O33A 3HCUA 1LDJB 3ZPVE 3RTRB 2FSAA 4YAXA 2ZETC 2ECIA 2MNZA 4GNGA 1HYIA 4WA6A 1WE9A 3MHHA 1V87A 2YSJA 3HCSA 5JG6A 2ECJA 1XWHA 4N4FA 5TBNA 3ZTGA 2VJFB 5G05B 5B75A 1WEOA 1X4JA 2C2VS 3M99A 2LXHC 3QZVA 2G6QA 4L7XA 3GL6A 1MM2A 2M85A 3O37A 2QJ0A 4YADA 1G25A 4V3LC 3EB6A 5DINA 3O70A 3PURA 5DKAA 1VD4A 2PUYA 1DVPA 3KV5A 2QICA 4I7BA 2YHNA 2H0DB 1CHCA 1WGMA 3O7AA 1WENA 5EYAF 1WEEA 5TABA 1Z2QA 2LN0A 2RSDA 2JMDA 2HYED 2YQLA 4I7CA 3U5OA 3EB5A 2K16A 1WEPA 1RMDA 5B77A 3SOXA 5TDWA 1BORA 4W4UA 4GNDA 3N9PA 3LQIA 2BAYA 4ZUXU 3GV4A 4MVTA 2VNFA 2F6JA 3PHDA 3T7LA 5FEYA 2Y43A 2KIZA 3KNVA 2VPDA 5J3XA 5AITA 2JMIA 3ZPV1 4A4CA 5H9MA 2YYRA 3U5PA 2ECGA 4LADB 1JM7A 4AVXA 2LV9A 1WEVA 1WESA 1Z6UA 5KH9A 4YC9A 4FJCA 2CSZA 5H1UA 2VJEA 2RI7A 2LDRA 1LDKC 4I7DA 2PNXA 2LRIC 2G45A 4ZQLA 1F62A 3KQIA 2L75A 2LGVA 4LKAA 2QIZA 2KGGA 4CA1A 4BHWA 1MM3A 2KWOA 2NAAA 3RPGB 4FK5A 4BBQA 4AYCA 4B7YC 2CKLA 2KGIA 4PPEA 4S3OC 5FB0A 5H1TA 3L11A 2JRJA 2XB1A 5B8DA 5KH7A 2YU4A 2L5UA 4B86C 2MA5A 2DX8A 2KU3A 2LGGA 2ECWA 5G04B 5C13A 1X4IA 2KFTA 1JOCA 2CT2A 4YABA 3N9QA 2UZGA 4X3GA 2C2LA 2LGKA 1T1HA 4A0CD 5LCWB 4AUQB 3FL2A 4S3OB 2YREA 3U5MA 1VYXA 2YQMA 5B76A 2VJFA 3MHSA 5LKTA 4QF2A 4LK9A 2VPGA 2LXPC 4YBSA 4R2YA 5LKXA 3IHPA 2LQ6A 2FUUA 3HCTA 4TKPB 3C6WA 5AIUA 2YURA 2E6SA 3M63A 1FP0A 3PUQA 1FBVA 2MD8C 2M1RA 4GNEA 3KV6A 2XEUA 3RPGC 3DPLR 2L80A 2FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5N A;  2H0D A;  2MA6 A;  1WFK A;  2I50 A;  5I3L A;  2YHO A;  2F6N A;  3L1Z B;  2MIQ A;  3ZYQ A;  1K2F A;  2MT5 A;  5FER A;  5D1K B;  4YAT A;  4UP5 A;  4WZ0 A;  3VK6 A;  2ECN A;  1WIL A;  2E6R A;  4V3K C;  2KR4 A;  5KH3 A;  3C5K A;  4YBT A;  5G0F A;  2F42 A;  2EA6 A;  5D1M B;  4C9Z A;  4A49 A;  1IYM A;  3ZVY A;  2YSM A;  5B79 A;  2YT5 A;  2KE1 A;  2M3H A;  1VFY A;  4UI9 B;  4LLB A;  3LRQ A;  4P5O B;  4CCG X;  4F52 B;  2ECT A;  2CSY A;  1Z60 A;  2Y1N A;  2AN6 A;  1U6G B;  1WEW A;  2KRE A;  2YW8 A;  2HDP A;  1E4U A;  2KWJ A;  4XI1 A;  4MSX A;  2D8S A;  3L1X A;  2JMJ A;  4Q6F A;  2KWK A;  1WIM A;  4WZ2 A;  2EGP A;  3LQH A;  4N3W A;  2MD7 B;  5B78 A;  1JM7 B;  5LKU A;  4L58 A;  2KYU A;  4QF3 A;  3N9M A;  3O36 A;  3T6R A;  3SOW A;  3DQV R;  3ASL A;  4LJN A;  4A4B A;  2VPE A;  2VJE B;  1N87 A;  3N9L A;  2VP7 A;  2L0B A;  4UP0 A;  4FO9 A;  4PTB A;  1WEQ A;  3V43 A;  2ECV A;  3SHB A;  5FB1 A;  2MNY A;  4FIP A;  4AP4 A;  2YUC A;  2L43 A;  5D1L B;  1WEM A;  4YBM A;  2K17 A;  4ZDT A;  5TDR A;  2KWN A;  3SOU A;  3O35 A;  2Y1M A;  3ZNI A;  4IC2 A;  4WZ3 B;  4O64 A;  4R8P K;  3ZVZ B;  4AYC B;  2G43 A;  3NG2 A;  1X4U A;  3O34 A;  2IDA A;  3M62 A;  2CKL B;  1HYJ A;  2OXQ C;  2VPB A;  2LGL A;  4GB0 A;  1ZBD B;  1WEU A;  2EOD A;  4NN2 A;  5LKZ A;  2MUM A;  4GNF A;  2K1J A;  4R7E A;  3LQJ A;  4IC3 A;  2M6M A;  3I2D A;  5C11 A;  5TRB A;  5H1V A;  3N9N A;  2K4D A;  3N9O A;  3HTK C;  3O33 A;  3HCU A;  1LDJ B;  3ZPV E;  3RTR B;  2FSA A;  4YAX A;  2ZET C;  2ECI A;  2MNZ A;  4GNG A;  1HYI A;  4WA6 A;  1WE9 A;  3MHH A;  1V87 A;  2YSJ A;  3HCS A;  5JG6 A;  2ECJ A;  1XWH A;  4N4F A;  5TBN A;  3ZTG A;  2VJF B;  5G05 B;  5B75 A;  1WEO A;  1X4J A;  2C2V S;  3M99 A;  2LXH C;  3QZV A;  2G6Q A;  4L7X A;  3GL6 A;  1MM2 A;  2M85 A;  3O37 A;  2QJ0 A;  4YAD A;  1G25 A;  4V3L C;  3EB6 A;  5DIN A;  3O70 A;  3PUR A;  5DKA A;  1VD4 A;  2PUY A;  1DVP A;  3KV5 A;  2QIC A;  4I7B A;  2YHN A;  2H0D B;  1CHC A;  1WGM A;  3O7A A;  1WEN A;  5EYA F;  1WEE A;  5TAB A;  1Z2Q A;  2LN0 A;  2RSD A;  2JMD A;  2HYE D;  2YQL A;  4I7C A;  3U5O A;  3EB5 A;  2K16 A;  1WEP A;  1RMD A;  5B77 A;  3SOX A;  5TDW A;  1BOR A;  4W4U A;  4GND A;  3N9P A;  3LQI A;  2BAY A;  4ZUX U;  3GV4 A;  4MVT A;  2VNF A;  2F6J A;  3PHD A;  3T7L A;  5FEY A;  2Y43 A;  2KIZ A;  3KNV A;  2VPD A;  5J3X A;  5AIT A;  2JMI A;  3ZPV 1;  4A4C A;  5H9M A;  2YYR A;  3U5P A;  2ECG A;  4LAD B;  1JM7 A;  4AVX A;  2LV9 A;  1WEV A;  1WES A;  1Z6U A;  5KH9 A;  4YC9 A;  4FJC A;  2CSZ A;  5H1U A;  2VJE A;  2RI7 A;  2LDR A;  1LDK C;  4I7D A;  2PNX A;  2LRI C;  2G45 A;  4ZQL A;  1F62 A;  3KQI A;  2L75 A;  2LGV A;  4LKA A;  2QIZ A;  2KGG A;  4CA1 A;  4BHW A;  1MM3 A;  2KWO A;  2NAA A;  3RPG B;  4FK5 A;  4BBQ A;  4AYC A;  4B7Y C;  2CKL A;  2KGI A;  4PPE A;  4S3O C;  5FB0 A;  5H1T A;  3L11 A;  2JRJ A;  2XB1 A;  5B8D A;  5KH7 A;  2YU4 A;  2L5U A;  4B86 C;  2MA5 A;  2DX8 A;  2KU3 A;  2LGG A;  2ECW A;  5G04 B;  5C13 A;  1X4I A;  2KFT A;  1JOC A;  2CT2 A;  4YAB A;  3N9Q A;  2UZG A;  4X3G A;  2C2L A;  2LGK A;  1T1H A;  4A0C D;  5LCW B;  4AUQ B;  3FL2 A;  4S3O B;  2YRE A;  3U5M A;  1VYX A;  2YQM A;  5B76 A;  2VJF A;  3MHS A;  5LKT A;  4QF2 A;  4LK9 A;  2VPG A;  2LXP C;  4YBS A;  4R2Y A;  5LKX A;  3IHP A;  2LQ6 A;  2FUU A;  3HCT A;  4TKP B;  3C6W A;  5AIU A;  2YUR A;  2E6S A;  3M63 A;  1FP0 A;  3PUQ A;  1FBV A;  2MD8 C;  2M1R A;  4GNE A;  3KV6 A;  2XEU A;  3RPG C;  3DPL R;  2L80 A;  2FUI A; 
#chains in the Genus database with same CATH topology
 4F1P A;  3U5N A;  2H0D A;  2MA6 A;  3JUE A;  1WFK A;  2I50 A;  5I3L A;  2YHO A;  2F6N A;  3L1Z B;  2MIQ A;  3ZYQ A;  1K2F A;  2MT5 A;  5FER A;  5D1K B;  4YAT A;  4QQ4 A;  4UP5 A;  4WZ0 A;  3VK6 A;  2ECN A;  1WIL A;  2E6R A;  4V3K C;  3MDB C;  2KR4 A;  5KH3 A;  3C5K A;  4YBT A;  5G0F A;  2F42 A;  2EA6 A;  5D1M B;  4C9Z A;  4A49 A;  2FD4 A;  1IYM A;  3ZVY A;  2YSM A;  5B79 A;  2YT5 A;  2KE1 A;  2M3H A;  1VFY A;  4UI9 B;  4LLB A;  3LRQ A;  4P5O B;  4CCG X;  4F52 B;  2ECT A;  2CSY A;  2CON A;  1Z60 A;  2Y1N A;  2AN6 A;  1U6G B;  1WEW A;  2KRE A;  2YW8 A;  2HDP A;  1E4U A;  1MBM A;  2KWJ A;  4XI1 A;  4MSX A;  2D8S A;  3L1X A;  5K3Q A;  2JMJ A;  4Q6F A;  2KWK A;  1WIM A;  3FAO A;  4WZ2 A;  2EGP A;  3LQH A;  4N3W A;  2MD7 B;  2DSM A;  5B78 A;  1JM7 B;  5LKU A;  2KKX A;  2KYU A;  4L58 A;  4QF3 A;  3N9M A;  3O36 A;  3T6R A;  3SOW A;  3DQV R;  3ASL A;  4LJN A;  4A4B A;  2VPE A;  2VJE B;  3SUB A;  1N87 A;  3N9L A;  2VP7 A;  2L0B A;  1DCQ A;  4UP0 A;  4FO9 A;  2YVR A;  4PTB A;  1WEQ A;  3V43 A;  3DWD A;  2ECV A;  3SHB A;  5FB1 A;  2MNY A;  4FIP A;  5SVX A;  4AP4 A;  2YUC A;  2L43 A;  5D1L B;  1WEM A;  4YBM A;  2K17 A;  3KDE C;  4ZDT A;  5TDR A;  2KWN A;  3SOU A;  3O35 A;  2Y1M A;  3FEH A;  3ZNI A;  4IC2 A;  4WZ3 B;  4O64 A;  4R8P K;  2FFW A;  3ZVZ B;  4AYC B;  5SVY A;  2G43 A;  3NG2 A;  1X4U A;  3O34 A;  2IDA A;  3M62 A;  2CKL B;  3LDY A;  1HYJ A;  3PLW A;  2OXQ C;  2VPB A;  2LGL A;  3M7K A;  2D8U A;  4GB0 A;  1ZBD B;  1WEU A;  2EOD A;  4NN2 A;  5LKZ A;  2M13 A;  2MUM A;  5SVI A;  4GNF A;  2K1J A;  4OGC A;  4R7E A;  3LQJ A;  4IC3 A;  2M6M A;  3I2D A;  5C11 A;  5TRB A;  5H1V A;  3N9N A;  2K4D A;  4H9D A;  3N9O A;  3HTK C;  3O33 A;  3HCU A;  1LDJ B;  3ZPV E;  3RTR B;  2FSA A;  4YAX A;  2ZET C;  2ECI A;  2JUN A;  2JM3 A;  2MNZ A;  4GNG A;  1HYI A;  4WA6 A;  1WE9 A;  3MHH A;  1V87 A;  2YSJ A;  3HCS A;  2XOY A;  5JG6 A;  2ECJ A;  1XWH A;  4N4F A;  3DDT A;  3Q1D A;  5TBN A;  3ZTG A;  2VJF B;  5G05 B;  5B75 A;  1WEO A;  1X4J A;  2C2V S;  3M99 A;  2LXH C;  3QZV A;  2G6Q A;  4L7X A;  3GL6 A;  1MM2 A;  2M85 A;  3O37 A;  2QJ0 A;  4YAD A;  1G25 A;  4V3L C;  3EB6 A;  5DIN A;  3O70 A;  3PUR A;  2KKY A;  5DKA A;  1VD4 A;  2PUY A;  1DVP A;  3KV5 A;  3FJU B;  2QIC A;  2IQJ A;  4I7B A;  2YHN A;  2H0D B;  1CHC A;  1WGM A;  3LVR E;  3O7A A;  1WEN A;  5EYA F;  1WEE A;  5TAB A;  1Z2Q A;  2LN0 A;  2RSD A;  2JMD A;  2HYE D;  2YQL A;  4I7C A;  3U5O A;  3EB5 A;  2K16 A;  1WEP A;  1RMD A;  5B77 A;  3SOX A;  2CSV A;  5TDW A;  1BOR A;  4W4U A;  2XOC A;  4GND A;  3N9P A;  3LQI A;  2BAY A;  2CRW A;  4ZUX U;  3GV4 A;  2E61 A;  4MVT A;  2VNF A;  2F6J A;  3PHD A;  3T7L A;  5FEY A;  2Y43 A;  2OWA A;  2KIZ A;  3KNV A;  2VPD A;  5J3X A;  5AIT A;  2JMI A;  3ZPV 1;  4A4C A;  5H9M A;  2YYR A;  3U5P A;  2ECG A;  2EGM A;  4LAD B;  1JM7 A;  4AVX A;  3FAN A;  2LV9 A;  1WEV A;  2L7P A;  2B0O E;  1WES A;  1Z6U A;  2XP0 A;  5KH9 A;  4YC9 A;  4FJC A;  2CSZ A;  5H1U A;  2VJE A;  2RI7 A;  2LDR A;  4Z0O A;  1LDK C;  4I7D A;  2PNX A;  2LRI C;  2G45 A;  4ZQL A;  1F62 A;  3KQI A;  2L75 A;  2LGV A;  4LKA A;  2QIZ A;  3FM8 C;  4O62 A;  2KGG A;  4CA1 A;  4BHW A;  1MM3 A;  3E2D A;  2KWO A;  2NAA A;  3RPG B;  4FK5 A;  4BBQ A;  4AYC A;  4B7Y C;  3LVQ E;  2CKL A;  2KGI A;  2MKE A;  4PPE A;  4S3O C;  3LJU X;  5FB0 A;  5H1T A;  2P57 A;  3H7H A;  3L11 A;  2JRJ A;  2XB1 A;  5B8D A;  5KH7 A;  2YU4 A;  2L5U A;  4B86 C;  2EXU A;  4OGE A;  2MA5 A;  2DX8 A;  2KU3 A;  2LGG A;  2ECW A;  5G04 B;  5SVI B;  5C13 A;  1X4I A;  2KFT A;  1JOC A;  2CT2 A;  4YAB A;  3N9Q A;  2UZG A;  4X3G A;  2C2L A;  2LGK A;  1T1H A;  4A0C D;  2LAU A;  5LCW B;  2RR4 A;  4AUQ B;  3FL2 A;  4S3O B;  2YRE A;  3U5M A;  2DJA A;  1VYX A;  2YQM A;  3O47 A;  2XOZ A;  5B76 A;  4Z0R A;  3T9K A;  2VJF A;  3MHS A;  2CRR A;  4QF2 A;  4LK9 A;  2VPG A;  5LKT A;  2LXP C;  4YBS A;  4R2Y A;  5LKX A;  3IHP A;  2LQ6 A;  2FUU A;  3HCT A;  4TKP B;  3C6W A;  5AIU A;  2YUR A;  2E6S A;  3M63 A;  1FP0 A;  3PUQ A;  1FBV A;  2MD8 C;  2M1R A;  4GNE A;  3KV6 A;  2XEU A;  3RPG C;  3DPL R;  2L80 A;  2FUI A; 
#chains in the Genus database with same CATH homology
 3U5N A;  2H0D A;  2MA6 A;  1WFK A;  2I50 A;  5I3L A;  2YHO A;  2F6N A;  3L1Z B;  2MIQ A;  3ZYQ A;  1K2F A;  2MT5 A;  5FER A;  5D1K B;  4YAT A;  4UP5 A;  4WZ0 A;  3VK6 A;  2ECN A;  1WIL A;  2E6R A;  4V3K C;  2KR4 A;  5KH3 A;  3C5K A;  4YBT A;  5G0F A;  2F42 A;  2EA6 A;  5D1M B;  4C9Z A;  4A49 A;  1IYM A;  3ZVY A;  2YSM A;  5B79 A;  2YT5 A;  2KE1 A;  2M3H A;  1VFY A;  4UI9 B;  4LLB A;  3LRQ A;  4P5O B;  4CCG X;  4F52 B;  2ECT A;  2CSY A;  1Z60 A;  2Y1N A;  2AN6 A;  1U6G B;  1WEW A;  2KRE A;  2YW8 A;  2HDP A;  1E4U A;  2KWJ A;  4XI1 A;  4MSX A;  2D8S A;  3L1X A;  2JMJ A;  4Q6F A;  2KWK A;  1WIM A;  4WZ2 A;  2EGP A;  3LQH A;  4N3W A;  2MD7 B;  5B78 A;  1JM7 B;  5LKU A;  4L58 A;  2KYU A;  4QF3 A;  3N9M A;  3O36 A;  3T6R A;  3SOW A;  3DQV R;  3ASL A;  4LJN A;  4A4B A;  2VPE A;  2VJE B;  1N87 A;  3N9L A;  2VP7 A;  2L0B A;  4UP0 A;  4FO9 A;  4PTB A;  1WEQ A;  3V43 A;  2ECV A;  3SHB A;  5FB1 A;  2MNY A;  4FIP A;  4AP4 A;  2YUC A;  2L43 A;  5D1L B;  1WEM A;  4YBM A;  2K17 A;  4ZDT A;  5TDR A;  2KWN A;  3SOU A;  3O35 A;  2Y1M A;  3ZNI A;  4IC2 A;  4WZ3 B;  4O64 A;  4R8P K;  3ZVZ B;  4AYC B;  2G43 A;  3NG2 A;  1X4U A;  3O34 A;  2IDA A;  3M62 A;  2CKL B;  1HYJ A;  2OXQ C;  2VPB A;  2LGL A;  4GB0 A;  1ZBD B;  1WEU A;  2EOD A;  4NN2 A;  5LKZ A;  2MUM A;  4GNF A;  2K1J A;  4R7E A;  3LQJ A;  4IC3 A;  2M6M A;  3I2D A;  5C11 A;  5TRB A;  5H1V A;  3N9N A;  2K4D A;  3N9O A;  3HTK C;  3O33 A;  3HCU A;  1LDJ B;  3ZPV E;  3RTR B;  2FSA A;  4YAX A;  2ZET C;  2ECI A;  2MNZ A;  4GNG A;  1HYI A;  4WA6 A;  1WE9 A;  3MHH A;  1V87 A;  2YSJ A;  3HCS A;  5JG6 A;  2ECJ A;  1XWH A;  4N4F A;  5TBN A;  3ZTG A;  2VJF B;  5G05 B;  5B75 A;  1WEO A;  1X4J A;  2C2V S;  3M99 A;  2LXH C;  3QZV A;  2G6Q A;  4L7X A;  3GL6 A;  1MM2 A;  2M85 A;  3O37 A;  2QJ0 A;  4YAD A;  1G25 A;  4V3L C;  3EB6 A;  5DIN A;  3O70 A;  3PUR A;  5DKA A;  1VD4 A;  2PUY A;  1DVP A;  3KV5 A;  2QIC A;  4I7B A;  2YHN A;  2H0D B;  1CHC A;  1WGM A;  3O7A A;  1WEN A;  5EYA F;  1WEE A;  5TAB A;  1Z2Q A;  2LN0 A;  2RSD A;  2JMD A;  2HYE D;  2YQL A;  4I7C A;  3U5O A;  3EB5 A;  2K16 A;  1WEP A;  1RMD A;  5B77 A;  3SOX A;  5TDW A;  1BOR A;  4W4U A;  4GND A;  3N9P A;  3LQI A;  2BAY A;  4ZUX U;  3GV4 A;  4MVT A;  2VNF A;  2F6J A;  3PHD A;  3T7L A;  5FEY A;  2Y43 A;  2KIZ A;  3KNV A;  2VPD A;  5J3X A;  5AIT A;  2JMI A;  3ZPV 1;  4A4C A;  5H9M A;  2YYR A;  3U5P A;  2ECG A;  4LAD B;  1JM7 A;  4AVX A;  2LV9 A;  1WEV A;  1WES A;  1Z6U A;  5KH9 A;  4YC9 A;  4FJC A;  2CSZ A;  5H1U A;  2VJE A;  2RI7 A;  2LDR A;  1LDK C;  4I7D A;  2PNX A;  2LRI C;  2G45 A;  4ZQL A;  1F62 A;  3KQI A;  2L75 A;  2LGV A;  4LKA A;  2QIZ A;  2KGG A;  4CA1 A;  4BHW A;  1MM3 A;  2KWO A;  2NAA A;  3RPG B;  4FK5 A;  4BBQ A;  4AYC A;  4B7Y C;  2CKL A;  2KGI A;  4PPE A;  4S3O C;  5FB0 A;  5H1T A;  3L11 A;  2JRJ A;  2XB1 A;  5B8D A;  5KH7 A;  2YU4 A;  2L5U A;  4B86 C;  2MA5 A;  2DX8 A;  2KU3 A;  2LGG A;  2ECW A;  5G04 B;  5C13 A;  1X4I A;  2KFT A;  1JOC A;  2CT2 A;  4YAB A;  3N9Q A;  2UZG A;  4X3G A;  2C2L A;  2LGK A;  1T1H A;  4A0C D;  5LCW B;  4AUQ B;  3FL2 A;  4S3O B;  2YRE A;  3U5M A;  1VYX A;  2YQM A;  5B76 A;  2VJF A;  3MHS A;  5LKT A;  4QF2 A;  4LK9 A;  2VPG A;  2LXP C;  4YBS A;  4R2Y A;  5LKX A;  3IHP A;  2LQ6 A;  2FUU A;  3HCT A;  4TKP B;  3C6W A;  5AIU A;  2YUR A;  2E6S A;  3M63 A;  1FP0 A;  3PUQ A;  1FBV A;  2MD8 C;  2M1R A;  4GNE A;  3KV6 A;  2XEU A;  3RPG C;  3DPL R;  2L80 A;  2FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...