2D8SA

Solution structure of the ring domain of the human cellular modulator of immune recognition protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
80
structure length
80
Chain Sequence
GSSGSSGTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellular modulator of immune recognition
publication title Solution structure of the RING domain of the human cellular modulator of immune recognition protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 5
structure length 80
sequence length 80
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2d8sA00
1WEVA 3VK6A 4I7DA 4GNFA 5B8DA 1FBVA 3M63A 1X4JA 3NG2A 4V3KC 5KH7A 2E6SA 2L43A 2IDAA 2JMIA 1F62A 2KWOA 2FUUA 3O35A 2L0BA 4YATA 1G25A 2VPGA 2ECTA 1WFKA 3C6WA 5B75A 1K2FA 4GNGA 4AUQB 4GNDA 2K17A 4QF2A 4WZ2A 3U5PA 4GNEA 4I7CA 2E6RA 2AN6A 4L7XA 2M1RA 3C5KA 2M3HA 2MA6A 2YSMA 2YREA 2PUYA 3N9OA 1Z2QA 5G05B 3L1XA 3SOWA 2K1JA 4FO9A 1MM2A 4PPEA 4O64A 5LCWB 1V87A 4I7BA 3MHSA 2ECVA 1JM7A 1WEMA 3RPGB 2YW8A 2CKLB 2LGGA 1X4IA 4AYCB 3PURA 3EB6A 3L11A 3SOXA 2KWNA 2EGPA 5TDWA 2F6JA 2ECGA 3HTKC 2XB1A 1HYIA 3U5OA 4R7EA 3O34A 2LQ6A 2MNZA 3DQVR 1WESA 5H1TA 3L1ZB 3O70A 2VP7A 1XWHA 1LDKC 4UP0A 4PTBA 3GL6A 4V3LC 4YBSA 3DPLR 5EYAF 2EA6A 2YYRA 2QIZA 3SOUA 3N9MA 2FSAA 3ZPV1 3IHPA 4IC3A 5H1VA 2Y43A 4FIPA 4BBQA 2HDPA 3KNVA 2KREA 5D1MB 2VJFA 5FB0A 3ZVYA 4TKPB 2FUIA 2L80A 2K4DA 2YU4A 2F6NA 2PNXA 3ZNIA 2RSDA 1BORA 4P5OB 2YQMA 2ECJA 2KWKA 3O33A 4MVTA 2ECWA 4X3GA 5DINA 2KGIA 4A0CD 1WEQA 5FB1A 5J3XA 3ASLA 3T6RA 4WZ0A 2OXQC 4N3WA 2MIQA 2HYED 2KIZA 2JMJA 4FK5A 2Y1NA 2LXHC 5TABA 2K16A 5LKTA 5C11A 2VPEA 4AP4A 3PHDA 1WIMA 2F42A 5FEYA 4A4BA 2C2LA 2LGLA 1X4UA 5AIUA 2BAYA 2YQLA 4S3OB 2LGKA 4A4CA 4B7YC 2CT2A 2YT5A 2YSJA 2VJEA 1WEWA 2L5UA 4N4FA 2YHNA 5AITA 2H0DB 5B78A 3M99A 1VD4A 1E4UA 4BHWA 2KWJA 2ECIA 5LKUA 1WGMA 4CCGX 2QJ0A 2KYUA 3T7LA 4CA1A 4A49A 3O36A 3HCTA 2VJFB 4YADA 3GV4A 5TRBA 1WEOA 5LKZA 1WEUA 2Y1MA 1ZBDB 4Q6FA 1VFYA 2LDRA 5DKAA 2D8SA 5C13A 2MD7B 1WENA 2EODA 3QZVA 4XI1A 5D1KB 2YURA 4LK9A 5LKXA 5I3LA 1MM3A 4C9ZA 2RI7A 3LQIA 3N9PA 2G43A 2M85A 4GB0A 2XEUA 2KGGA 4L58A 5JG6A 2DX8A 1FP0A 2CKLA 2JMDA 4AYCA 1U6GB 1Z60A 3KV5A 2KR4A 4AVXA 4MSXA 4LLBA 1LDJB 4ZQLA 1DVPA 2MT5A 4R8PK 4R2YA 4LKAA 1WILA 3RPGC 2C2VS 4FJCA 2KU3A 3ZVZB 4YABA 2MD8C 3LQHA 1WEEA 5G0FA 2NAAA 1VYXA 4LADB 3LRQA 1JM7B 2CSZA 1IYMA 2VPDA 3SHBA 2MNYA 1T1HA 2LRIC 2G6QA 4QF3A 4YBMA 2ECNA 3KQIA 5B79A 3ZPVE 2M6MA 3ZTGA 3PUQA 2LN0A 1N87A 1JOCA 1WE9A 2VNFA 4IC2A 4ZUXU 3N9NA 3FL2A 1Z6UA 4NN2A 1HYJA 5H9MA 4F52B 4B86C 2YUCA 4YBTA 5TBNA 1RMDA 4YC9A 5KH3A 3O7AA 2ZETC 4UP5A 4LJNA 2KE1A 2JRJA 3N9LA 3HCUA 3HCSA 5B76A 5KH9A 2MUMA 3LQJA 3EB5A 2UZGA 4WZ3B 3O37A 3KV6A 4YAXA 3U5MA 3ZYQA 5H1UA 2LV9A 4W4UA 4WA6A 2KFTA 3U5NA 2I50A 3N9QA 2H0DA 3M62A 3V43A 1CHCA 2LXPC 2L75A 3MHHA 2YHOA 2CSYA 5B77A 5D1LB 4S3OC 2QICA 1WEPA 2LGVA 3I2DA 2VPBA 2G45A 4UI9B 3RTRB 5TDRA 5G04B 5FERA 2MA5A 4ZDTA 2VJEB
chains in the Genus database with same CATH superfamily
1WEVA 3VK6A 4I7DA 4GNFA 2CSVA 5B8DA 1FBVA 3M63A 1X4JA 3NG2A 4V3KC 2JUNA 5KH7A 2E6SA 2L43A 2IDAA 2JMIA 1F62A 2KWOA 2FUUA 3O35A 2L0BA 4YATA 1G25A 2VPGA 2ECTA 1WFKA 3C6WA 5B75A 1K2FA 4GNGA 4AUQB 4GNDA 2YVRA 2K17A 4QF2A 4WZ2A 3U5PA 4GNEA 4I7CA 2IQJA 2E6RA 4L7XA 2AN6A 2M1RA 3C5KA 2M3HA 2MA6A 2YSMA 2YREA 2PUYA 3N9OA 1Z2QA 5G05B 3L1XA 3SOWA 2K1JA 2XOZA 4FO9A 1MM2A 4PPEA 4O64A 5LCWB 1V87A 4I7BA 3MHSA 2ECVA 1JM7A 1WEMA 3RPGB 2YW8A 2CKLB 2LGGA 1X4IA 4AYCB 3PURA 3EB6A 3L11A 2CRRA 3SOXA 2KWNA 2EGPA 5TDWA 2F6JA 4O62A 2ECGA 3LDYA 2RR4A 3HTKC 2XB1A 1HYIA 3U5OA 4R7EA 3O34A 2LQ6A 2MNZA 3DQVR 3KDEC 1WESA 5H1TA 3L1ZB 2JM3A 3O70A 2VP7A 1XWHA 1LDKC 4UP0A 3SUBA 4PTBA 3GL6A 4V3LC 4YBSA 3DPLR 5EYAF 2EA6A 2YYRA 2EXUA 2QIZA 3SOUA 3N9MA 2FSAA 3ZPV1 3IHPA 4IC3A 2DSMA 5H1VA 2Y43A 4Z0OA 4FIPA 4BBQA 4OGCA 2HDPA 3PLWA 3KNVA 2KREA 5D1MB 5SVIA 2VJFA 5FB0A 3ZVYA 4TKPB 2FUIA 2L80A 2K4DA 2YU4A 2F6NA 2PNXA 3ZNIA 2RSDA 1BORA 4P5OB 2YQMA 2ECJA 2KWKA 3O33A 4MVTA 2ECWA 3FJUB 4X3GA 5DINA 2KGIA 4A0CD 1WEQA 5K3QA 5FB1A 5J3XA 3E2DA 3ASLA 3T6RA 4WZ0A 2OXQC 4N3WA 2OWAA 3DWDA 2MIQA 2HYED 3FANA 2KIZA 2JMJA 4FK5A 2Y1NA 2LXHC 5TABA 2K16A 5LKTA 2CONA 5C11A 2VPEA 4AP4A 3PHDA 1WIMA 2F42A 2P57A 5FEYA 4A4BA 2C2LA 2LGLA 3FAOA 4OGEA 1X4UA 5AIUA 2XOYA 2BAYA 2YQLA 3Q1DA 2LGKA 4S3OB 4A4CA 4B7YC 2CT2A 2YT5A 2YSJA 2VJEA 1WEWA 2L5UA 4N4FA 2YHNA 5AITA 3O47A 2H0DB 5B78A 3M7KA 3M99A 1VD4A 1E4UA 4BHWA 2KWJA 2L7PA 2ECIA 5LKUA 1WGMA 4CCGX 2QJ0A 2KYUA 3T7LA 4CA1A 4A49A 3O36A 3HCTA 5SVIB 1DCQA 2VJFB 4YADA 3GV4A 5TRBA 1WEOA 5LKZA 1WEUA 2Y1MA 1ZBDB 4Q6FA 2B0OE 3JUEA 1VFYA 2LDRA 5DKAA 2D8SA 5C13A 2MD7B 2E61A 2XOCA 1WENA 2EODA 3QZVA 4XI1A 5D1KB 2YURA 4LK9A 5LKXA 5I3LA 2CRWA 1MM3A 4C9ZA 2RI7A 3LQIA 3N9PA 2G43A 2M85A 4GB0A 2KKXA 2XEUA 2KGGA 4L58A 3DDTA 5JG6A 2DX8A 1FP0A 4QQ4A 2CKLA 2JMDA 2M13A 4AYCA 3MDBC 1U6GB 1Z60A 4H9DA 3KV5A 2EGMA 4Z0RA 5SVXA 2KR4A 4AVXA 5SVYA 4MSXA 4LLBA 1LDJB 4ZQLA 1DVPA 3T9KA 3LVQE 2MT5A 4R8PK 4R2YA 4LKAA 1WILA 3RPGC 2C2VS 4FJCA 2KU3A 3ZVZB 4YABA 2MD8C 3LQHA 1WEEA 5G0FA 2NAAA 1VYXA 4LADB 3LRQA 1JM7B 2CSZA 1IYMA 2VPDA 2MKEA 3SHBA 2MNYA 3FEHA 1T1HA 2LRIC 2G6QA 4QF3A 4YBMA 2FFWA 2KKYA 2ECNA 3KQIA 5B79A 3ZPVE 2M6MA 3ZTGA 3PUQA 2LN0A 1N87A 1JOCA 1WE9A 2VNFA 4IC2A 4ZUXU 3N9NA 3FL2A 1Z6UA 4NN2A 1HYJA 5H9MA 4F52B 4B86C 2YUCA 4YBTA 5TBNA 1RMDA 4YC9A 5KH3A 3O7AA 4F1PA 2ZETC 4UP5A 4LJNA 2KE1A 3LJUX 2JRJA 3FM8C 2DJAA 3N9LA 3HCUA 3HCSA 5B76A 5KH9A 2MUMA 3LQJA 3EB5A 2UZGA 4WZ3B 3O37A 3KV6A 4YAXA 3U5MA 3ZYQA 3LVRE 5H1UA 2LV9A 3H7HA 4W4UA 4WA6A 2KFTA 3U5NA 2I50A 3N9QA 2H0DA 3M62A 3V43A 1MBMA 1CHCA 2FD4A 2LXPC 2D8UA 2L75A 3MHHA 2YHOA 2CSYA 2XP0A 5B77A 5D1LB 4S3OC 2QICA 1WEPA 2LGVA 3I2DA 2VPBA 2G45A 2LAUA 4UI9B 3RTRB 5TDRA 5G04B 5FERA 2MA5A 4ZDTA 2VJEB
chains in the Genus database with same CATH topology
1WEVA 3VK6A 4I7DA 4GNFA 5B8DA 1FBVA 3M63A 1X4JA 3NG2A 4V3KC 5KH7A 2E6SA 2L43A 2IDAA 2JMIA 1F62A 2KWOA 2FUUA 3O35A 2L0BA 4YATA 1G25A 2VPGA 2ECTA 1WFKA 3C6WA 5B75A 1K2FA 4GNGA 4AUQB 4GNDA 2K17A 4QF2A 4WZ2A 3U5PA 4GNEA 4I7CA 2E6RA 2AN6A 4L7XA 2M1RA 3C5KA 2M3HA 2MA6A 2YSMA 2YREA 2PUYA 3N9OA 1Z2QA 5G05B 3L1XA 3SOWA 2K1JA 4FO9A 1MM2A 4PPEA 4O64A 5LCWB 1V87A 4I7BA 3MHSA 2ECVA 1JM7A 1WEMA 3RPGB 2YW8A 2CKLB 2LGGA 1X4IA 4AYCB 3PURA 3EB6A 3L11A 3SOXA 2KWNA 2EGPA 5TDWA 2F6JA 2ECGA 3HTKC 2XB1A 1HYIA 3U5OA 4R7EA 3O34A 2LQ6A 2MNZA 3DQVR 1WESA 5H1TA 3L1ZB 3O70A 2VP7A 1XWHA 1LDKC 4UP0A 4PTBA 3GL6A 4V3LC 4YBSA 3DPLR 5EYAF 2EA6A 2YYRA 2QIZA 3SOUA 3N9MA 2FSAA 3ZPV1 3IHPA 4IC3A 5H1VA 2Y43A 4FIPA 4BBQA 2HDPA 3KNVA 2KREA 5D1MB 2VJFA 5FB0A 3ZVYA 4TKPB 2FUIA 2L80A 2K4DA 2YU4A 2F6NA 2PNXA 3ZNIA 2RSDA 1BORA 4P5OB 2YQMA 2ECJA 2KWKA 3O33A 4MVTA 2ECWA 4X3GA 5DINA 2KGIA 4A0CD 1WEQA 5FB1A 5J3XA 3ASLA 3T6RA 4WZ0A 2OXQC 4N3WA 2MIQA 2HYED 2KIZA 2JMJA 4FK5A 2Y1NA 2LXHC 5TABA 2K16A 5LKTA 5C11A 2VPEA 4AP4A 3PHDA 1WIMA 2F42A 5FEYA 4A4BA 2C2LA 2LGLA 1X4UA 5AIUA 2BAYA 2YQLA 4S3OB 2LGKA 4A4CA 4B7YC 2CT2A 2YT5A 2YSJA 2VJEA 1WEWA 2L5UA 4N4FA 2YHNA 5AITA 2H0DB 5B78A 3M99A 1VD4A 1E4UA 4BHWA 2KWJA 2ECIA 5LKUA 1WGMA 4CCGX 2QJ0A 2KYUA 3T7LA 4CA1A 4A49A 3O36A 3HCTA 2VJFB 4YADA 3GV4A 5TRBA 1WEOA 5LKZA 1WEUA 2Y1MA 1ZBDB 4Q6FA 1VFYA 2LDRA 5DKAA 2D8SA 5C13A 2MD7B 1WENA 2EODA 3QZVA 4XI1A 5D1KB 2YURA 4LK9A 5LKXA 5I3LA 1MM3A 4C9ZA 2RI7A 3LQIA 3N9PA 2G43A 2M85A 4GB0A 2XEUA 2KGGA 4L58A 5JG6A 2DX8A 1FP0A 2CKLA 2JMDA 4AYCA 1U6GB 1Z60A 3KV5A 2KR4A 4AVXA 4MSXA 4LLBA 1LDJB 4ZQLA 1DVPA 2MT5A 4R8PK 4R2YA 4LKAA 1WILA 3RPGC 2C2VS 4FJCA 2KU3A 3ZVZB 4YABA 2MD8C 3LQHA 1WEEA 5G0FA 2NAAA 1VYXA 4LADB 3LRQA 1JM7B 2CSZA 1IYMA 2VPDA 3SHBA 2MNYA 1T1HA 2LRIC 2G6QA 4QF3A 4YBMA 2ECNA 3KQIA 5B79A 3ZPVE 2M6MA 3ZTGA 3PUQA 2LN0A 1N87A 1JOCA 1WE9A 2VNFA 4IC2A 4ZUXU 3N9NA 3FL2A 1Z6UA 4NN2A 1HYJA 5H9MA 4F52B 4B86C 2YUCA 4YBTA 5TBNA 1RMDA 4YC9A 5KH3A 3O7AA 2ZETC 4UP5A 4LJNA 2KE1A 2JRJA 3N9LA 3HCUA 3HCSA 5B76A 5KH9A 2MUMA 3LQJA 3EB5A 2UZGA 4WZ3B 3O37A 3KV6A 4YAXA 3U5MA 3ZYQA 5H1UA 2LV9A 4W4UA 4WA6A 2KFTA 3U5NA 2I50A 3N9QA 2H0DA 3M62A 3V43A 1CHCA 2LXPC 2L75A 3MHHA 2YHOA 2CSYA 5B77A 5D1LB 4S3OC 2QICA 1WEPA 2LGVA 3I2DA 2VPBA 2G45A 4UI9B 3RTRB 5TDRA 5G04B 5FERA 2MA5A 4ZDTA 2VJEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEV A;  3VK6 A;  4I7D A;  4GNF A;  5B8D A;  1FBV A;  3M63 A;  1X4J A;  3NG2 A;  4V3K C;  5KH7 A;  2E6S A;  2L43 A;  2IDA A;  2JMI A;  1F62 A;  2KWO A;  2FUU A;  3O35 A;  2L0B A;  4YAT A;  1G25 A;  2VPG A;  2ECT A;  1WFK A;  3C6W A;  5B75 A;  1K2F A;  4GNG A;  4AUQ B;  4GND A;  2K17 A;  4QF2 A;  4WZ2 A;  3U5P A;  4GNE A;  4I7C A;  2E6R A;  2AN6 A;  4L7X A;  2M1R A;  3C5K A;  2M3H A;  2MA6 A;  2YSM A;  2YRE A;  2PUY A;  3N9O A;  1Z2Q A;  5G05 B;  3L1X A;  3SOW A;  2K1J A;  4FO9 A;  1MM2 A;  4PPE A;  4O64 A;  5LCW B;  1V87 A;  4I7B A;  3MHS A;  2ECV A;  1JM7 A;  1WEM A;  3RPG B;  2YW8 A;  2CKL B;  2LGG A;  1X4I A;  4AYC B;  3PUR A;  3EB6 A;  3L11 A;  3SOX A;  2KWN A;  2EGP A;  5TDW A;  2F6J A;  2ECG A;  3HTK C;  2XB1 A;  1HYI A;  3U5O A;  4R7E A;  3O34 A;  2LQ6 A;  2MNZ A;  3DQV R;  1WES A;  5H1T A;  3L1Z B;  3O70 A;  2VP7 A;  1XWH A;  1LDK C;  4UP0 A;  4PTB A;  3GL6 A;  4V3L C;  4YBS A;  3DPL R;  5EYA F;  2EA6 A;  2YYR A;  2QIZ A;  3SOU A;  3N9M A;  2FSA A;  3ZPV 1;  3IHP A;  4IC3 A;  5H1V A;  2Y43 A;  4FIP A;  4BBQ A;  2HDP A;  3KNV A;  2KRE A;  5D1M B;  2VJF A;  5FB0 A;  3ZVY A;  4TKP B;  2FUI A;  2L80 A;  2K4D A;  2YU4 A;  2F6N A;  2PNX A;  3ZNI A;  2RSD A;  1BOR A;  4P5O B;  2YQM A;  2ECJ A;  2KWK A;  3O33 A;  4MVT A;  2ECW A;  4X3G A;  5DIN A;  2KGI A;  4A0C D;  1WEQ A;  5FB1 A;  5J3X A;  3ASL A;  3T6R A;  4WZ0 A;  2OXQ C;  4N3W A;  2MIQ A;  2HYE D;  2KIZ A;  2JMJ A;  4FK5 A;  2Y1N A;  2LXH C;  5TAB A;  2K16 A;  5LKT A;  5C11 A;  2VPE A;  4AP4 A;  3PHD A;  1WIM A;  2F42 A;  5FEY A;  4A4B A;  2C2L A;  2LGL A;  1X4U A;  5AIU A;  2BAY A;  2YQL A;  4S3O B;  2LGK A;  4A4C A;  4B7Y C;  2CT2 A;  2YT5 A;  2YSJ A;  2VJE A;  1WEW A;  2L5U A;  4N4F A;  2YHN A;  5AIT A;  2H0D B;  5B78 A;  3M99 A;  1VD4 A;  1E4U A;  4BHW A;  2KWJ A;  2ECI A;  5LKU A;  1WGM A;  4CCG X;  2QJ0 A;  2KYU A;  3T7L A;  4CA1 A;  4A49 A;  3O36 A;  3HCT A;  2VJF B;  4YAD A;  3GV4 A;  5TRB A;  1WEO A;  5LKZ A;  1WEU A;  2Y1M A;  1ZBD B;  4Q6F A;  1VFY A;  2LDR A;  5DKA A;  2D8S A;  5C13 A;  2MD7 B;  1WEN A;  2EOD A;  3QZV A;  4XI1 A;  5D1K B;  2YUR A;  4LK9 A;  5LKX A;  5I3L A;  1MM3 A;  4C9Z A;  2RI7 A;  3LQI A;  3N9P A;  2G43 A;  2M85 A;  4GB0 A;  2XEU A;  2KGG A;  4L58 A;  5JG6 A;  2DX8 A;  1FP0 A;  2CKL A;  2JMD A;  4AYC A;  1U6G B;  1Z60 A;  3KV5 A;  2KR4 A;  4AVX A;  4MSX A;  4LLB A;  1LDJ B;  4ZQL A;  1DVP A;  2MT5 A;  4R8P K;  4R2Y A;  4LKA A;  1WIL A;  3RPG C;  2C2V S;  4FJC A;  2KU3 A;  3ZVZ B;  4YAB A;  2MD8 C;  3LQH A;  1WEE A;  5G0F A;  2NAA A;  1VYX A;  4LAD B;  3LRQ A;  1JM7 B;  2CSZ A;  1IYM A;  2VPD A;  3SHB A;  2MNY A;  1T1H A;  2LRI C;  2G6Q A;  4QF3 A;  4YBM A;  2ECN A;  3KQI A;  5B79 A;  3ZPV E;  2M6M A;  3ZTG A;  3PUQ A;  2LN0 A;  1N87 A;  1JOC A;  1WE9 A;  2VNF A;  4IC2 A;  4ZUX U;  3N9N A;  3FL2 A;  1Z6U A;  4NN2 A;  1HYJ A;  5H9M A;  4F52 B;  4B86 C;  2YUC A;  4YBT A;  5TBN A;  1RMD A;  4YC9 A;  5KH3 A;  3O7A A;  2ZET C;  4UP5 A;  4LJN A;  2KE1 A;  2JRJ A;  3N9L A;  3HCU A;  3HCS A;  5B76 A;  5KH9 A;  2MUM A;  3LQJ A;  3EB5 A;  2UZG A;  4WZ3 B;  3O37 A;  3KV6 A;  4YAX A;  3U5M A;  3ZYQ A;  5H1U A;  2LV9 A;  4W4U A;  4WA6 A;  2KFT A;  3U5N A;  2I50 A;  3N9Q A;  2H0D A;  3M62 A;  3V43 A;  1CHC A;  2LXP C;  2L75 A;  3MHH A;  2YHO A;  2CSY A;  5B77 A;  5D1L B;  4S3O C;  2QIC A;  1WEP A;  2LGV A;  3I2D A;  2VPB A;  2G45 A;  4UI9 B;  3RTR B;  5TDR A;  5G04 B;  5FER A;  2MA5 A;  4ZDT A;  2VJE B; 
#chains in the Genus database with same CATH topology
 1WEV A;  3VK6 A;  4I7D A;  4GNF A;  2CSV A;  5B8D A;  1FBV A;  3M63 A;  1X4J A;  3NG2 A;  4V3K C;  2JUN A;  5KH7 A;  2E6S A;  2L43 A;  2IDA A;  2JMI A;  1F62 A;  2KWO A;  2FUU A;  3O35 A;  2L0B A;  4YAT A;  1G25 A;  2VPG A;  2ECT A;  1WFK A;  3C6W A;  5B75 A;  1K2F A;  4GNG A;  4AUQ B;  4GND A;  2YVR A;  2K17 A;  4QF2 A;  4WZ2 A;  3U5P A;  4GNE A;  4I7C A;  2IQJ A;  2E6R A;  4L7X A;  2AN6 A;  2M1R A;  3C5K A;  2M3H A;  2MA6 A;  2YSM A;  2YRE A;  2PUY A;  3N9O A;  1Z2Q A;  5G05 B;  3L1X A;  3SOW A;  2K1J A;  2XOZ A;  4FO9 A;  1MM2 A;  4PPE A;  4O64 A;  5LCW B;  1V87 A;  4I7B A;  3MHS A;  2ECV A;  1JM7 A;  1WEM A;  3RPG B;  2YW8 A;  2CKL B;  2LGG A;  1X4I A;  4AYC B;  3PUR A;  3EB6 A;  3L11 A;  2CRR A;  3SOX A;  2KWN A;  2EGP A;  5TDW A;  2F6J A;  4O62 A;  2ECG A;  3LDY A;  2RR4 A;  3HTK C;  2XB1 A;  1HYI A;  3U5O A;  4R7E A;  3O34 A;  2LQ6 A;  2MNZ A;  3DQV R;  3KDE C;  1WES A;  5H1T A;  3L1Z B;  2JM3 A;  3O70 A;  2VP7 A;  1XWH A;  1LDK C;  4UP0 A;  3SUB A;  4PTB A;  3GL6 A;  4V3L C;  4YBS A;  3DPL R;  5EYA F;  2EA6 A;  2YYR A;  2EXU A;  2QIZ A;  3SOU A;  3N9M A;  2FSA A;  3ZPV 1;  3IHP A;  4IC3 A;  2DSM A;  5H1V A;  2Y43 A;  4Z0O A;  4FIP A;  4BBQ A;  4OGC A;  2HDP A;  3PLW A;  3KNV A;  2KRE A;  5D1M B;  5SVI A;  2VJF A;  5FB0 A;  3ZVY A;  4TKP B;  2FUI A;  2L80 A;  2K4D A;  2YU4 A;  2F6N A;  2PNX A;  3ZNI A;  2RSD A;  1BOR A;  4P5O B;  2YQM A;  2ECJ A;  2KWK A;  3O33 A;  4MVT A;  2ECW A;  3FJU B;  4X3G A;  5DIN A;  2KGI A;  4A0C D;  1WEQ A;  5K3Q A;  5FB1 A;  5J3X A;  3E2D A;  3ASL A;  3T6R A;  4WZ0 A;  2OXQ C;  4N3W A;  2OWA A;  3DWD A;  2MIQ A;  2HYE D;  3FAN A;  2KIZ A;  2JMJ A;  4FK5 A;  2Y1N A;  2LXH C;  5TAB A;  2K16 A;  5LKT A;  2CON A;  5C11 A;  2VPE A;  4AP4 A;  3PHD A;  1WIM A;  2F42 A;  2P57 A;  5FEY A;  4A4B A;  2C2L A;  2LGL A;  3FAO A;  4OGE A;  1X4U A;  5AIU A;  2XOY A;  2BAY A;  2YQL A;  3Q1D A;  2LGK A;  4S3O B;  4A4C A;  4B7Y C;  2CT2 A;  2YT5 A;  2YSJ A;  2VJE A;  1WEW A;  2L5U A;  4N4F A;  2YHN A;  5AIT A;  3O47 A;  2H0D B;  5B78 A;  3M7K A;  3M99 A;  1VD4 A;  1E4U A;  4BHW A;  2KWJ A;  2L7P A;  2ECI A;  5LKU A;  1WGM A;  4CCG X;  2QJ0 A;  2KYU A;  3T7L A;  4CA1 A;  4A49 A;  3O36 A;  3HCT A;  5SVI B;  1DCQ A;  2VJF B;  4YAD A;  3GV4 A;  5TRB A;  1WEO A;  5LKZ A;  1WEU A;  2Y1M A;  1ZBD B;  4Q6F A;  2B0O E;  3JUE A;  1VFY A;  2LDR A;  5DKA A;  2D8S A;  5C13 A;  2MD7 B;  2E61 A;  2XOC A;  1WEN A;  2EOD A;  3QZV A;  4XI1 A;  5D1K B;  2YUR A;  4LK9 A;  5LKX A;  5I3L A;  2CRW A;  1MM3 A;  4C9Z A;  2RI7 A;  3LQI A;  3N9P A;  2G43 A;  2M85 A;  4GB0 A;  2KKX A;  2XEU A;  2KGG A;  4L58 A;  3DDT A;  5JG6 A;  2DX8 A;  1FP0 A;  4QQ4 A;  2CKL A;  2JMD A;  2M13 A;  4AYC A;  3MDB C;  1U6G B;  1Z60 A;  4H9D A;  3KV5 A;  2EGM A;  4Z0R A;  5SVX A;  2KR4 A;  4AVX A;  5SVY A;  4MSX A;  4LLB A;  1LDJ B;  4ZQL A;  1DVP A;  3T9K A;  3LVQ E;  2MT5 A;  4R8P K;  4R2Y A;  4LKA A;  1WIL A;  3RPG C;  2C2V S;  4FJC A;  2KU3 A;  3ZVZ B;  4YAB A;  2MD8 C;  3LQH A;  1WEE A;  5G0F A;  2NAA A;  1VYX A;  4LAD B;  3LRQ A;  1JM7 B;  2CSZ A;  1IYM A;  2VPD A;  2MKE A;  3SHB A;  2MNY A;  3FEH A;  1T1H A;  2LRI C;  2G6Q A;  4QF3 A;  4YBM A;  2FFW A;  2KKY A;  2ECN A;  3KQI A;  5B79 A;  3ZPV E;  2M6M A;  3ZTG A;  3PUQ A;  2LN0 A;  1N87 A;  1JOC A;  1WE9 A;  2VNF A;  4IC2 A;  4ZUX U;  3N9N A;  3FL2 A;  1Z6U A;  4NN2 A;  1HYJ A;  5H9M A;  4F52 B;  4B86 C;  2YUC A;  4YBT A;  5TBN A;  1RMD A;  4YC9 A;  5KH3 A;  3O7A A;  4F1P A;  2ZET C;  4UP5 A;  4LJN A;  2KE1 A;  3LJU X;  2JRJ A;  3FM8 C;  2DJA A;  3N9L A;  3HCU A;  3HCS A;  5B76 A;  5KH9 A;  2MUM A;  3LQJ A;  3EB5 A;  2UZG A;  4WZ3 B;  3O37 A;  3KV6 A;  4YAX A;  3U5M A;  3ZYQ A;  3LVR E;  5H1U A;  2LV9 A;  3H7H A;  4W4U A;  4WA6 A;  2KFT A;  3U5N A;  2I50 A;  3N9Q A;  2H0D A;  3M62 A;  3V43 A;  1MBM A;  1CHC A;  2FD4 A;  2LXP C;  2D8U A;  2L75 A;  3MHH A;  2YHO A;  2CSY A;  2XP0 A;  5B77 A;  5D1L B;  4S3O C;  2QIC A;  1WEP A;  2LGV A;  3I2D A;  2VPB A;  2G45 A;  2LAU A;  4UI9 B;  3RTR B;  5TDR A;  5G04 B;  5FER A;  2MA5 A;  4ZDT A;  2VJE B; 
#chains in the Genus database with same CATH homology
 1WEV A;  3VK6 A;  4I7D A;  4GNF A;  5B8D A;  1FBV A;  3M63 A;  1X4J A;  3NG2 A;  4V3K C;  5KH7 A;  2E6S A;  2L43 A;  2IDA A;  2JMI A;  1F62 A;  2KWO A;  2FUU A;  3O35 A;  2L0B A;  4YAT A;  1G25 A;  2VPG A;  2ECT A;  1WFK A;  3C6W A;  5B75 A;  1K2F A;  4GNG A;  4AUQ B;  4GND A;  2K17 A;  4QF2 A;  4WZ2 A;  3U5P A;  4GNE A;  4I7C A;  2E6R A;  2AN6 A;  4L7X A;  2M1R A;  3C5K A;  2M3H A;  2MA6 A;  2YSM A;  2YRE A;  2PUY A;  3N9O A;  1Z2Q A;  5G05 B;  3L1X A;  3SOW A;  2K1J A;  4FO9 A;  1MM2 A;  4PPE A;  4O64 A;  5LCW B;  1V87 A;  4I7B A;  3MHS A;  2ECV A;  1JM7 A;  1WEM A;  3RPG B;  2YW8 A;  2CKL B;  2LGG A;  1X4I A;  4AYC B;  3PUR A;  3EB6 A;  3L11 A;  3SOX A;  2KWN A;  2EGP A;  5TDW A;  2F6J A;  2ECG A;  3HTK C;  2XB1 A;  1HYI A;  3U5O A;  4R7E A;  3O34 A;  2LQ6 A;  2MNZ A;  3DQV R;  1WES A;  5H1T A;  3L1Z B;  3O70 A;  2VP7 A;  1XWH A;  1LDK C;  4UP0 A;  4PTB A;  3GL6 A;  4V3L C;  4YBS A;  3DPL R;  5EYA F;  2EA6 A;  2YYR A;  2QIZ A;  3SOU A;  3N9M A;  2FSA A;  3ZPV 1;  3IHP A;  4IC3 A;  5H1V A;  2Y43 A;  4FIP A;  4BBQ A;  2HDP A;  3KNV A;  2KRE A;  5D1M B;  2VJF A;  5FB0 A;  3ZVY A;  4TKP B;  2FUI A;  2L80 A;  2K4D A;  2YU4 A;  2F6N A;  2PNX A;  3ZNI A;  2RSD A;  1BOR A;  4P5O B;  2YQM A;  2ECJ A;  2KWK A;  3O33 A;  4MVT A;  2ECW A;  4X3G A;  5DIN A;  2KGI A;  4A0C D;  1WEQ A;  5FB1 A;  5J3X A;  3ASL A;  3T6R A;  4WZ0 A;  2OXQ C;  4N3W A;  2MIQ A;  2HYE D;  2KIZ A;  2JMJ A;  4FK5 A;  2Y1N A;  2LXH C;  5TAB A;  2K16 A;  5LKT A;  5C11 A;  2VPE A;  4AP4 A;  3PHD A;  1WIM A;  2F42 A;  5FEY A;  4A4B A;  2C2L A;  2LGL A;  1X4U A;  5AIU A;  2BAY A;  2YQL A;  4S3O B;  2LGK A;  4A4C A;  4B7Y C;  2CT2 A;  2YT5 A;  2YSJ A;  2VJE A;  1WEW A;  2L5U A;  4N4F A;  2YHN A;  5AIT A;  2H0D B;  5B78 A;  3M99 A;  1VD4 A;  1E4U A;  4BHW A;  2KWJ A;  2ECI A;  5LKU A;  1WGM A;  4CCG X;  2QJ0 A;  2KYU A;  3T7L A;  4CA1 A;  4A49 A;  3O36 A;  3HCT A;  2VJF B;  4YAD A;  3GV4 A;  5TRB A;  1WEO A;  5LKZ A;  1WEU A;  2Y1M A;  1ZBD B;  4Q6F A;  1VFY A;  2LDR A;  5DKA A;  2D8S A;  5C13 A;  2MD7 B;  1WEN A;  2EOD A;  3QZV A;  4XI1 A;  5D1K B;  2YUR A;  4LK9 A;  5LKX A;  5I3L A;  1MM3 A;  4C9Z A;  2RI7 A;  3LQI A;  3N9P A;  2G43 A;  2M85 A;  4GB0 A;  2XEU A;  2KGG A;  4L58 A;  5JG6 A;  2DX8 A;  1FP0 A;  2CKL A;  2JMD A;  4AYC A;  1U6G B;  1Z60 A;  3KV5 A;  2KR4 A;  4AVX A;  4MSX A;  4LLB A;  1LDJ B;  4ZQL A;  1DVP A;  2MT5 A;  4R8P K;  4R2Y A;  4LKA A;  1WIL A;  3RPG C;  2C2V S;  4FJC A;  2KU3 A;  3ZVZ B;  4YAB A;  2MD8 C;  3LQH A;  1WEE A;  5G0F A;  2NAA A;  1VYX A;  4LAD B;  3LRQ A;  1JM7 B;  2CSZ A;  1IYM A;  2VPD A;  3SHB A;  2MNY A;  1T1H A;  2LRI C;  2G6Q A;  4QF3 A;  4YBM A;  2ECN A;  3KQI A;  5B79 A;  3ZPV E;  2M6M A;  3ZTG A;  3PUQ A;  2LN0 A;  1N87 A;  1JOC A;  1WE9 A;  2VNF A;  4IC2 A;  4ZUX U;  3N9N A;  3FL2 A;  1Z6U A;  4NN2 A;  1HYJ A;  5H9M A;  4F52 B;  4B86 C;  2YUC A;  4YBT A;  5TBN A;  1RMD A;  4YC9 A;  5KH3 A;  3O7A A;  2ZET C;  4UP5 A;  4LJN A;  2KE1 A;  2JRJ A;  3N9L A;  3HCU A;  3HCS A;  5B76 A;  5KH9 A;  2MUM A;  3LQJ A;  3EB5 A;  2UZG A;  4WZ3 B;  3O37 A;  3KV6 A;  4YAX A;  3U5M A;  3ZYQ A;  5H1U A;  2LV9 A;  4W4U A;  4WA6 A;  2KFT A;  3U5N A;  2I50 A;  3N9Q A;  2H0D A;  3M62 A;  3V43 A;  1CHC A;  2LXP C;  2L75 A;  3MHH A;  2YHO A;  2CSY A;  5B77 A;  5D1L B;  4S3O C;  2QIC A;  1WEP A;  2LGV A;  3I2D A;  2VPB A;  2G45 A;  4UI9 B;  3RTR B;  5TDR A;  5G04 B;  5FER A;  2MA5 A;  4ZDT A;  2VJE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...