2D8SA

Solution structure of the ring domain of the human cellular modulator of immune recognition protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
80
structure length
80
Chain Sequence
GSSGSSGTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RING domain of the human cellular modulator of immune recognition protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords cellular modulator of immune recognition
total genus 5
structure length 80
sequence length 80
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2d8sA00
2VJEB 5DKAA 1FBVA 1DVPA 1HYIA 1BORA 4GNDA 4R7EA 2LGGA 5LKUA 2H0DB 5H1UA 1WEMA 4F52B 3RTRB 2YU4A 2E6RA 3ZPV1 2YW8A 5H9MA 2LDRA 4FIPA 2QICA 2K1JA 4P5OB 5TRBA 4V3KC 1WFKA 2F6NA 1Z2QA 5EYAF 4GB0A 2ECIA 4FK5A 4A4BA 1Z60A 3ZYQA 3SHBA 4R8PK 1JM7B 3N9PA 4WZ3B 2KFTA 2YSMA 2CSYA 1WEEA 2LXPC 2YURA 4L7XA 3N9OA 2EA6A 4YADA 2L75A 1LDJB 1F62A 4ZQLA 1Z6UA 1U6GB 5LKXA 4AVXA 3LQIA 2YHNA 3ZPVE 5C13A 5I3LA 4PTBA 5D1MB 3LQHA 3GL6A 4TKPB 2M85A 2VPBA 2LXHC 4I7DA 1VFYA 2F6JA 4LLBA 2YREA 4IC2A 4ZUXU 2G45A 2RSDA 2OXQC 4YC9A 2YHOA 2MT5A 3U5PA 5B8DA 1MM3A 2M6MA 3O35A 3DPLR 2PUYA 1WEQA 5D1KB 2MIQA 4C9ZA 1RMDA 2KGIA 2UZGA 2MNYA 5DINA 4GNEA 1WEUA 2FSAA 3N9QA 3LRQA 4WA6A 3M63A 4I7CA 2CKLB 4PPEA 2JMJA 2MD7B 4AYCB 2BAYA 4GNGA 5B79A 3NG2A 4YATA 3L1XA 2K17A 2Y1NA 3HCTA 2YSJA 2KWJA 1WGMA 3LQJA 1WEPA 3T6RA 4W4UA 2KE1A 4MVTA 4N3WA 4NN2A 5LCWB 2ECGA 1WEOA 3PUQA 5FB1A 4R2YA 2DX8A 2YQMA 1WESA 2E6SA 2ECTA 2LQ6A 4LADB 3N9MA 2YYRA 2KIZA 1K2FA 2M1RA 4BHWA 2KGGA 3KV5A 4YBMA 2CT2A 2G6QA 2VJEA 4GNFA 3N9NA 3SOWA 4FO9A 2C2LA 3O34A 3HCUA 1JOCA 2K4DA 2KR4A 2H0DA 4YAXA 2XB1A 2KWNA 2L43A 2VJFA 3O36A 2LN0A 4LKAA 5J3XA 5LKZA 5FEYA 4WZ0A 2AN6A 1N87A 2I50A 3MHSA 3ZVZB 4S3OB 1X4JA 1CHCA 2LRIC 4ZDTA 4YBSA 2LGVA 4QF3A 1JM7A 2EODA 4YABA 5TDRA 3O70A 5H1TA 1WEVA 2VPDA 4CA1A 2QIZA 5TABA 4XI1A 2ECNA 1HYJA 2F42A 3EB5A 4AP4A 3PHDA 2FUUA 2FUIA 2QJ0A 4FJCA 1T1HA 5KH7A 2MA6A 2XEUA 2ECJA 5B75A 1WEWA 5B76A 3U5NA 1XWHA 3M99A 3V43A 5AITA 1VD4A 2ZETC 3KV6A 2CSZA 5G0FA 2ECVA 1WENA 2KWOA 2KYUA 2NAAA 3C6WA 4IC3A 3ZNIA 3IHPA 1WILA 2YUCA 3I2DA 2JRJA 3RPGB 2JMIA 5B77A 1WIMA 2VPGA 5D1LB 4A0CD 1LDKC 2D8SA 4L58A 4A4CA 2L0BA 4CCGX 2M3HA 4B86C 3U5OA 3SOUA 2PNXA 5TBNA 1G25A 3O33A 2Y1MA 4S3OC 2RI7A 2CKLA 2L5UA 2LV9A 5TDWA 2ECWA 4AYCA 1V87A 4UP0A 4LK9A 1VYXA 4QF2A 4N4FA 1IYMA 2IDAA 3HCSA 2Y43A 3KQIA 2LGKA 3DQVR 2JMDA 5AIUA 4B7YC 5FB0A 2MA5A 3KNVA 5LKTA 4LJNA 1WE9A 2EGPA 2VNFA 4MSXA 4UI9B 2K16A 3ASLA 4Q6FA 1FP0A 5KH9A 4AUQB 2L80A 5H1VA 1X4UA 5G05B 2HYED 3EB6A 3RPGC 5C11A 2HDPA 4WZ2A 3T7LA 3VK6A 3HTKC 4I7BA 4O64A 5FERA 2KWKA 2YT5A 2VJFB 4BBQA 4UP5A 3C5KA 4X3GA 3L1ZB 5KH3A 5B78A 3FL2A 1ZBDB 2KU3A 3ZVYA 2LGLA 3O37A 3ZTGA 2VP7A 3SOXA 3PURA 5JG6A 3M62A 2MUMA 3MHHA 1MM2A 1X4IA 2MNZA 3O7AA 4A49A 3L11A 3QZVA 4YBTA 2G43A 1E4UA 2MD8C 2YQLA 3N9LA 2C2VS 2KREA 2VPEA 4V3LC 5G04B 3U5MA 3GV4A
chains in the Genus database with same CATH superfamily
2VJEB 5DKAA 3M7KA 1FBVA 1DVPA 1HYIA 1BORA 2EGMA 4GNDA 4R7EA 2LGGA 5LKUA 2H0DB 5H1UA 2RR4A 1WEMA 4F52B 3RTRB 2YU4A 2IQJA 2E6RA 3ZPV1 2YW8A 5H9MA 2LDRA 4FIPA 2QICA 2K1JA 3FANA 3Q1DA 4P5OB 5TRBA 4V3KC 1WFKA 2F6NA 1Z2QA 5EYAF 4H9DA 4GB0A 2ECIA 4FK5A 4A4BA 1Z60A 2XOZA 3ZYQA 3SHBA 4R8PK 1JM7B 3N9PA 4WZ3B 2KFTA 2YSMA 2CSYA 1WEEA 2LXPC 2YURA 4L7XA 3N9OA 2EA6A 4YADA 2L75A 1LDJB 3H7HA 1F62A 4ZQLA 1Z6UA 1U6GB 5LKXA 4AVXA 3LQIA 2YHNA 3ZPVE 5C13A 5I3LA 2D8UA 4PTBA 5D1MB 3KDEC 2XOYA 3LQHA 3GL6A 4TKPB 2M85A 3SUBA 2VPBA 2LXHC 4I7DA 1VFYA 2F6JA 4LLBA 2YREA 4IC2A 4ZUXU 2G45A 2RSDA 2OXQC 4YC9A 2YHOA 2MT5A 3U5PA 5B8DA 4O62A 1MM3A 2M6MA 3O35A 3DPLR 2PUYA 1WEQA 5D1KB 2MIQA 4C9ZA 5SVYA 1RMDA 2KGIA 2UZGA 2MNYA 5DINA 4GNEA 2CONA 1WEUA 2FSAA 3N9QA 3LRQA 4WA6A 3M63A 4I7CA 2CKLB 4PPEA 2JMJA 2MD7B 4AYCB 3MDBC 2BAYA 4GNGA 5B79A 3NG2A 4YATA 3L1XA 2K17A 3DDTA 2Y1NA 3HCTA 2YSJA 2KWJA 1WGMA 3LQJA 1WEPA 3T6RA 4W4UA 2KE1A 4MVTA 4N3WA 4NN2A 5LCWB 2ECGA 2M13A 1WEOA 3PUQA 5FB1A 4R2YA 2DX8A 2YQMA 1WESA 2E6SA 2ECTA 2LQ6A 4LADB 3N9MA 2YYRA 2KIZA 1K2FA 2M1RA 4BHWA 3FM8C 2KGGA 3KV5A 4YBMA 2CT2A 2G6QA 2VJEA 4GNFA 3N9NA 2EXUA 3SOWA 4FO9A 2C2LA 3O34A 3HCUA 1JOCA 2K4DA 2KR4A 2H0DA 4YAXA 2XB1A 2CRRA 4QQ4A 2KWNA 2L43A 2VJFA 3O36A 1MBMA 2LN0A 4LKAA 5J3XA 5LKZA 3FAOA 5FEYA 4WZ0A 2AN6A 1N87A 2I50A 3MHSA 3ZVZB 4S3OB 1X4JA 1CHCA 2LRIC 4Z0OA 2OWAA 4ZDTA 4YBSA 2LGVA 3LDYA 4QF3A 1JM7A 2EODA 4YABA 5TDRA 3O70A 5H1TA 1WEVA 3LVQE 2VPDA 4CA1A 2QIZA 2XOCA 5TABA 4XI1A 2ECNA 1HYJA 2F42A 3EB5A 4AP4A 3PHDA 2FUUA 2MKEA 2FUIA 2QJ0A 4FJCA 1T1HA 5KH7A 4OGEA 2MA6A 2XEUA 2ECJA 5B75A 1WEWA 5B76A 3U5NA 2B0OE 1XWHA 3M99A 2LAUA 3V43A 5AITA 1VD4A 2ZETC 3KV6A 2CSZA 5G0FA 2ECVA 5SVIB 1WENA 2KWOA 2KYUA 2NAAA 3C6WA 4IC3A 3ZNIA 3IHPA 1WILA 2YUCA 3I2DA 2JRJA 5SVIA 3RPGB 2JMIA 5B77A 1WIMA 2VPGA 3FEHA 2JUNA 5D1LB 4A0CD 1LDKC 2D8SA 4L58A 4A4CA 2L0BA 4CCGX 2M3HA 4B86C 3U5OA 3SOUA 2PNXA 2E61A 3E2DA 5TBNA 1G25A 3O33A 3DWDA 2Y1MA 2CRWA 3JUEA 4S3OC 2RI7A 2CKLA 2L5UA 2L7PA 2LV9A 5TDWA 2ECWA 4AYCA 1V87A 4UP0A 4LK9A 2JM3A 1VYXA 1DCQA 4QF2A 4N4FA 3PLWA 1IYMA 2IDAA 3HCSA 2Y43A 3LJUX 3KQIA 3FJUB 2LGKA 3DQVR 2JMDA 5AIUA 2KKYA 2YVRA 3T9KA 4B7YC 5FB0A 2MA5A 3KNVA 5LKTA 2P57A 4LJNA 1WE9A 2EGPA 2VNFA 4MSXA 4UI9B 2K16A 3ASLA 4Q6FA 1FP0A 5KH9A 4AUQB 2L80A 5H1VA 4OGCA 1X4UA 5G05B 2HYED 3EB6A 3RPGC 5C11A 2HDPA 4WZ2A 3T7LA 5K3QA 3VK6A 2XP0A 3LVRE 3HTKC 4I7BA 4O64A 5FERA 2KWKA 2YT5A 2VJFB 4BBQA 4UP5A 3C5KA 4X3GA 2FD4A 3L1ZB 5KH3A 2DJAA 5B78A 3FL2A 1ZBDB 2KU3A 3ZVYA 2LGLA 2KKXA 3O37A 3ZTGA 2VP7A 3SOXA 3PURA 5JG6A 4Z0RA 3M62A 2MUMA 3MHHA 1MM2A 3O47A 1X4IA 2MNZA 3O7AA 4A49A 5SVXA 3L11A 3QZVA 4YBTA 2FFWA 2G43A 4F1PA 1E4UA 2MD8C 2YQLA 3N9LA 2CSVA 2DSMA 2C2VS 2KREA 4V3LC 2VPEA 5G04B 3U5MA 3GV4A
chains in the Genus database with same CATH topology
2VJEB 5DKAA 1FBVA 1DVPA 1HYIA 1BORA 4GNDA 4R7EA 2LGGA 5LKUA 2H0DB 5H1UA 1WEMA 4F52B 3RTRB 2YU4A 2E6RA 3ZPV1 2YW8A 5H9MA 2LDRA 4FIPA 2QICA 2K1JA 4P5OB 5TRBA 4V3KC 1WFKA 2F6NA 1Z2QA 5EYAF 4GB0A 2ECIA 4FK5A 4A4BA 1Z60A 3ZYQA 3SHBA 4R8PK 1JM7B 3N9PA 4WZ3B 2KFTA 2YSMA 2CSYA 1WEEA 2LXPC 2YURA 4L7XA 3N9OA 2EA6A 4YADA 2L75A 1LDJB 1F62A 4ZQLA 1Z6UA 1U6GB 5LKXA 4AVXA 3LQIA 2YHNA 3ZPVE 5C13A 5I3LA 4PTBA 5D1MB 3LQHA 3GL6A 4TKPB 2M85A 2VPBA 2LXHC 4I7DA 1VFYA 2F6JA 4LLBA 2YREA 4IC2A 4ZUXU 2G45A 2RSDA 2OXQC 4YC9A 2YHOA 2MT5A 3U5PA 5B8DA 1MM3A 2M6MA 3O35A 3DPLR 2PUYA 1WEQA 5D1KB 2MIQA 4C9ZA 1RMDA 2KGIA 2UZGA 2MNYA 5DINA 4GNEA 1WEUA 2FSAA 3N9QA 3LRQA 4WA6A 3M63A 4I7CA 2CKLB 4PPEA 2JMJA 2MD7B 4AYCB 2BAYA 4GNGA 5B79A 3NG2A 4YATA 3L1XA 2K17A 2Y1NA 3HCTA 2YSJA 2KWJA 1WGMA 3LQJA 1WEPA 3T6RA 4W4UA 2KE1A 4MVTA 4N3WA 4NN2A 5LCWB 2ECGA 1WEOA 3PUQA 5FB1A 4R2YA 2DX8A 2YQMA 1WESA 2E6SA 2ECTA 2LQ6A 4LADB 3N9MA 2YYRA 2KIZA 1K2FA 2M1RA 4BHWA 2KGGA 3KV5A 4YBMA 2CT2A 2G6QA 2VJEA 4GNFA 3N9NA 3SOWA 4FO9A 2C2LA 3O34A 3HCUA 1JOCA 2K4DA 2KR4A 2H0DA 4YAXA 2XB1A 2KWNA 2L43A 2VJFA 3O36A 2LN0A 4LKAA 5J3XA 5LKZA 5FEYA 4WZ0A 2AN6A 1N87A 2I50A 3MHSA 3ZVZB 4S3OB 1X4JA 1CHCA 2LRIC 4ZDTA 4YBSA 2LGVA 4QF3A 1JM7A 2EODA 4YABA 5TDRA 3O70A 5H1TA 1WEVA 2VPDA 4CA1A 2QIZA 5TABA 4XI1A 2ECNA 1HYJA 2F42A 3EB5A 4AP4A 3PHDA 2FUUA 2FUIA 2QJ0A 4FJCA 1T1HA 5KH7A 2MA6A 2XEUA 2ECJA 5B75A 1WEWA 5B76A 3U5NA 1XWHA 3M99A 3V43A 5AITA 1VD4A 2ZETC 3KV6A 2CSZA 5G0FA 2ECVA 1WENA 2KWOA 2KYUA 2NAAA 3C6WA 4IC3A 3ZNIA 3IHPA 1WILA 2YUCA 3I2DA 2JRJA 3RPGB 2JMIA 5B77A 1WIMA 2VPGA 5D1LB 4A0CD 1LDKC 2D8SA 4L58A 4A4CA 2L0BA 4CCGX 2M3HA 4B86C 3U5OA 3SOUA 2PNXA 5TBNA 1G25A 3O33A 2Y1MA 4S3OC 2RI7A 2CKLA 2L5UA 2LV9A 5TDWA 2ECWA 4AYCA 1V87A 4UP0A 4LK9A 1VYXA 4QF2A 4N4FA 1IYMA 2IDAA 3HCSA 2Y43A 3KQIA 2LGKA 3DQVR 2JMDA 5AIUA 4B7YC 5FB0A 2MA5A 3KNVA 5LKTA 4LJNA 1WE9A 2EGPA 2VNFA 4MSXA 4UI9B 2K16A 3ASLA 4Q6FA 1FP0A 5KH9A 4AUQB 2L80A 5H1VA 1X4UA 5G05B 2HYED 3EB6A 3RPGC 5C11A 2HDPA 4WZ2A 3T7LA 3VK6A 3HTKC 4I7BA 4O64A 5FERA 2KWKA 2YT5A 2VJFB 4BBQA 4UP5A 3C5KA 4X3GA 3L1ZB 5KH3A 5B78A 3FL2A 1ZBDB 2KU3A 3ZVYA 2LGLA 3O37A 3ZTGA 2VP7A 3SOXA 3PURA 5JG6A 3M62A 2MUMA 3MHHA 1MM2A 1X4IA 2MNZA 3O7AA 4A49A 3L11A 3QZVA 4YBTA 2G43A 1E4UA 2MD8C 2YQLA 3N9LA 2C2VS 2KREA 2VPEA 4V3LC 5G04B 3U5MA 3GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  5DKA A;  1FBV A;  1DVP A;  1HYI A;  1BOR A;  4GND A;  4R7E A;  2LGG A;  5LKU A;  2H0D B;  5H1U A;  1WEM A;  4F52 B;  3RTR B;  2YU4 A;  2E6R A;  3ZPV 1;  2YW8 A;  5H9M A;  2LDR A;  4FIP A;  2QIC A;  2K1J A;  4P5O B;  5TRB A;  4V3K C;  1WFK A;  2F6N A;  1Z2Q A;  5EYA F;  4GB0 A;  2ECI A;  4FK5 A;  4A4B A;  1Z60 A;  3ZYQ A;  3SHB A;  4R8P K;  1JM7 B;  3N9P A;  4WZ3 B;  2KFT A;  2YSM A;  2CSY A;  1WEE A;  2LXP C;  2YUR A;  4L7X A;  3N9O A;  2EA6 A;  4YAD A;  2L75 A;  1LDJ B;  1F62 A;  4ZQL A;  1Z6U A;  1U6G B;  5LKX A;  4AVX A;  3LQI A;  2YHN A;  3ZPV E;  5C13 A;  5I3L A;  4PTB A;  5D1M B;  3LQH A;  3GL6 A;  4TKP B;  2M85 A;  2VPB A;  2LXH C;  4I7D A;  1VFY A;  2F6J A;  4LLB A;  2YRE A;  4IC2 A;  4ZUX U;  2G45 A;  2RSD A;  2OXQ C;  4YC9 A;  2YHO A;  2MT5 A;  3U5P A;  5B8D A;  1MM3 A;  2M6M A;  3O35 A;  3DPL R;  2PUY A;  1WEQ A;  5D1K B;  2MIQ A;  4C9Z A;  1RMD A;  2KGI A;  2UZG A;  2MNY A;  5DIN A;  4GNE A;  1WEU A;  2FSA A;  3N9Q A;  3LRQ A;  4WA6 A;  3M63 A;  4I7C A;  2CKL B;  4PPE A;  2JMJ A;  2MD7 B;  4AYC B;  2BAY A;  4GNG A;  5B79 A;  3NG2 A;  4YAT A;  3L1X A;  2K17 A;  2Y1N A;  3HCT A;  2YSJ A;  2KWJ A;  1WGM A;  3LQJ A;  1WEP A;  3T6R A;  4W4U A;  2KE1 A;  4MVT A;  4N3W A;  4NN2 A;  5LCW B;  2ECG A;  1WEO A;  3PUQ A;  5FB1 A;  4R2Y A;  2DX8 A;  2YQM A;  1WES A;  2E6S A;  2ECT A;  2LQ6 A;  4LAD B;  3N9M A;  2YYR A;  2KIZ A;  1K2F A;  2M1R A;  4BHW A;  2KGG A;  3KV5 A;  4YBM A;  2CT2 A;  2G6Q A;  2VJE A;  4GNF A;  3N9N A;  3SOW A;  4FO9 A;  2C2L A;  3O34 A;  3HCU A;  1JOC A;  2K4D A;  2KR4 A;  2H0D A;  4YAX A;  2XB1 A;  2KWN A;  2L43 A;  2VJF A;  3O36 A;  2LN0 A;  4LKA A;  5J3X A;  5LKZ A;  5FEY A;  4WZ0 A;  2AN6 A;  1N87 A;  2I50 A;  3MHS A;  3ZVZ B;  4S3O B;  1X4J A;  1CHC A;  2LRI C;  4ZDT A;  4YBS A;  2LGV A;  4QF3 A;  1JM7 A;  2EOD A;  4YAB A;  5TDR A;  3O70 A;  5H1T A;  1WEV A;  2VPD A;  4CA1 A;  2QIZ A;  5TAB A;  4XI1 A;  2ECN A;  1HYJ A;  2F42 A;  3EB5 A;  4AP4 A;  3PHD A;  2FUU A;  2FUI A;  2QJ0 A;  4FJC A;  1T1H A;  5KH7 A;  2MA6 A;  2XEU A;  2ECJ A;  5B75 A;  1WEW A;  5B76 A;  3U5N A;  1XWH A;  3M99 A;  3V43 A;  5AIT A;  1VD4 A;  2ZET C;  3KV6 A;  2CSZ A;  5G0F A;  2ECV A;  1WEN A;  2KWO A;  2KYU A;  2NAA A;  3C6W A;  4IC3 A;  3ZNI A;  3IHP A;  1WIL A;  2YUC A;  3I2D A;  2JRJ A;  3RPG B;  2JMI A;  5B77 A;  1WIM A;  2VPG A;  5D1L B;  4A0C D;  1LDK C;  2D8S A;  4L58 A;  4A4C A;  2L0B A;  4CCG X;  2M3H A;  4B86 C;  3U5O A;  3SOU A;  2PNX A;  5TBN A;  1G25 A;  3O33 A;  2Y1M A;  4S3O C;  2RI7 A;  2CKL A;  2L5U A;  2LV9 A;  5TDW A;  2ECW A;  4AYC A;  1V87 A;  4UP0 A;  4LK9 A;  1VYX A;  4QF2 A;  4N4F A;  1IYM A;  2IDA A;  3HCS A;  2Y43 A;  3KQI A;  2LGK A;  3DQV R;  2JMD A;  5AIU A;  4B7Y C;  5FB0 A;  2MA5 A;  3KNV A;  5LKT A;  4LJN A;  1WE9 A;  2EGP A;  2VNF A;  4MSX A;  4UI9 B;  2K16 A;  3ASL A;  4Q6F A;  1FP0 A;  5KH9 A;  4AUQ B;  2L80 A;  5H1V A;  1X4U A;  5G05 B;  2HYE D;  3EB6 A;  3RPG C;  5C11 A;  2HDP A;  4WZ2 A;  3T7L A;  3VK6 A;  3HTK C;  4I7B A;  4O64 A;  5FER A;  2KWK A;  2YT5 A;  2VJF B;  4BBQ A;  4UP5 A;  3C5K A;  4X3G A;  3L1Z B;  5KH3 A;  5B78 A;  3FL2 A;  1ZBD B;  2KU3 A;  3ZVY A;  2LGL A;  3O37 A;  3ZTG A;  2VP7 A;  3SOX A;  3PUR A;  5JG6 A;  3M62 A;  2MUM A;  3MHH A;  1MM2 A;  1X4I A;  2MNZ A;  3O7A A;  4A49 A;  3L11 A;  3QZV A;  4YBT A;  2G43 A;  1E4U A;  2MD8 C;  2YQL A;  3N9L A;  2C2V S;  2KRE A;  2VPE A;  4V3L C;  5G04 B;  3U5M A;  3GV4 A; 
#chains in the Genus database with same CATH topology
 2VJE B;  5DKA A;  3M7K A;  1FBV A;  1DVP A;  1HYI A;  1BOR A;  2EGM A;  4GND A;  4R7E A;  2LGG A;  5LKU A;  2H0D B;  5H1U A;  2RR4 A;  1WEM A;  4F52 B;  3RTR B;  2YU4 A;  2IQJ A;  2E6R A;  3ZPV 1;  2YW8 A;  5H9M A;  2LDR A;  4FIP A;  2QIC A;  2K1J A;  3FAN A;  3Q1D A;  4P5O B;  5TRB A;  4V3K C;  1WFK A;  2F6N A;  1Z2Q A;  5EYA F;  4H9D A;  4GB0 A;  2ECI A;  4FK5 A;  4A4B A;  1Z60 A;  2XOZ A;  3ZYQ A;  3SHB A;  4R8P K;  1JM7 B;  3N9P A;  4WZ3 B;  2KFT A;  2YSM A;  2CSY A;  1WEE A;  2LXP C;  2YUR A;  4L7X A;  3N9O A;  2EA6 A;  4YAD A;  2L75 A;  1LDJ B;  3H7H A;  1F62 A;  4ZQL A;  1Z6U A;  1U6G B;  5LKX A;  4AVX A;  3LQI A;  2YHN A;  3ZPV E;  5C13 A;  5I3L A;  2D8U A;  4PTB A;  5D1M B;  3KDE C;  2XOY A;  3LQH A;  3GL6 A;  4TKP B;  2M85 A;  3SUB A;  2VPB A;  2LXH C;  4I7D A;  1VFY A;  2F6J A;  4LLB A;  2YRE A;  4IC2 A;  4ZUX U;  2G45 A;  2RSD A;  2OXQ C;  4YC9 A;  2YHO A;  2MT5 A;  3U5P A;  5B8D A;  4O62 A;  1MM3 A;  2M6M A;  3O35 A;  3DPL R;  2PUY A;  1WEQ A;  5D1K B;  2MIQ A;  4C9Z A;  5SVY A;  1RMD A;  2KGI A;  2UZG A;  2MNY A;  5DIN A;  4GNE A;  2CON A;  1WEU A;  2FSA A;  3N9Q A;  3LRQ A;  4WA6 A;  3M63 A;  4I7C A;  2CKL B;  4PPE A;  2JMJ A;  2MD7 B;  4AYC B;  3MDB C;  2BAY A;  4GNG A;  5B79 A;  3NG2 A;  4YAT A;  3L1X A;  2K17 A;  3DDT A;  2Y1N A;  3HCT A;  2YSJ A;  2KWJ A;  1WGM A;  3LQJ A;  1WEP A;  3T6R A;  4W4U A;  2KE1 A;  4MVT A;  4N3W A;  4NN2 A;  5LCW B;  2ECG A;  2M13 A;  1WEO A;  3PUQ A;  5FB1 A;  4R2Y A;  2DX8 A;  2YQM A;  1WES A;  2E6S A;  2ECT A;  2LQ6 A;  4LAD B;  3N9M A;  2YYR A;  2KIZ A;  1K2F A;  2M1R A;  4BHW A;  3FM8 C;  2KGG A;  3KV5 A;  4YBM A;  2CT2 A;  2G6Q A;  2VJE A;  4GNF A;  3N9N A;  2EXU A;  3SOW A;  4FO9 A;  2C2L A;  3O34 A;  3HCU A;  1JOC A;  2K4D A;  2KR4 A;  2H0D A;  4YAX A;  2XB1 A;  2CRR A;  4QQ4 A;  2KWN A;  2L43 A;  2VJF A;  3O36 A;  1MBM A;  2LN0 A;  4LKA A;  5J3X A;  5LKZ A;  3FAO A;  5FEY A;  4WZ0 A;  2AN6 A;  1N87 A;  2I50 A;  3MHS A;  3ZVZ B;  4S3O B;  1X4J A;  1CHC A;  2LRI C;  4Z0O A;  2OWA A;  4ZDT A;  4YBS A;  2LGV A;  3LDY A;  4QF3 A;  1JM7 A;  2EOD A;  4YAB A;  5TDR A;  3O70 A;  5H1T A;  1WEV A;  3LVQ E;  2VPD A;  4CA1 A;  2QIZ A;  2XOC A;  5TAB A;  4XI1 A;  2ECN A;  1HYJ A;  2F42 A;  3EB5 A;  4AP4 A;  3PHD A;  2FUU A;  2MKE A;  2FUI A;  2QJ0 A;  4FJC A;  1T1H A;  5KH7 A;  4OGE A;  2MA6 A;  2XEU A;  2ECJ A;  5B75 A;  1WEW A;  5B76 A;  3U5N A;  2B0O E;  1XWH A;  3M99 A;  2LAU A;  3V43 A;  5AIT A;  1VD4 A;  2ZET C;  3KV6 A;  2CSZ A;  5G0F A;  2ECV A;  5SVI B;  1WEN A;  2KWO A;  2KYU A;  2NAA A;  3C6W A;  4IC3 A;  3ZNI A;  3IHP A;  1WIL A;  2YUC A;  3I2D A;  2JRJ A;  5SVI A;  3RPG B;  2JMI A;  5B77 A;  1WIM A;  2VPG A;  3FEH A;  2JUN A;  5D1L B;  4A0C D;  1LDK C;  2D8S A;  4L58 A;  4A4C A;  2L0B A;  4CCG X;  2M3H A;  4B86 C;  3U5O A;  3SOU A;  2PNX A;  2E61 A;  3E2D A;  5TBN A;  1G25 A;  3O33 A;  3DWD A;  2Y1M A;  2CRW A;  3JUE A;  4S3O C;  2RI7 A;  2CKL A;  2L5U A;  2L7P A;  2LV9 A;  5TDW A;  2ECW A;  4AYC A;  1V87 A;  4UP0 A;  4LK9 A;  2JM3 A;  1VYX A;  1DCQ A;  4QF2 A;  4N4F A;  3PLW A;  1IYM A;  2IDA A;  3HCS A;  2Y43 A;  3LJU X;  3KQI A;  3FJU B;  2LGK A;  3DQV R;  2JMD A;  5AIU A;  2KKY A;  2YVR A;  3T9K A;  4B7Y C;  5FB0 A;  2MA5 A;  3KNV A;  5LKT A;  2P57 A;  4LJN A;  1WE9 A;  2EGP A;  2VNF A;  4MSX A;  4UI9 B;  2K16 A;  3ASL A;  4Q6F A;  1FP0 A;  5KH9 A;  4AUQ B;  2L80 A;  5H1V A;  4OGC A;  1X4U A;  5G05 B;  2HYE D;  3EB6 A;  3RPG C;  5C11 A;  2HDP A;  4WZ2 A;  3T7L A;  5K3Q A;  3VK6 A;  2XP0 A;  3LVR E;  3HTK C;  4I7B A;  4O64 A;  5FER A;  2KWK A;  2YT5 A;  2VJF B;  4BBQ A;  4UP5 A;  3C5K A;  4X3G A;  2FD4 A;  3L1Z B;  5KH3 A;  2DJA A;  5B78 A;  3FL2 A;  1ZBD B;  2KU3 A;  3ZVY A;  2LGL A;  2KKX A;  3O37 A;  3ZTG A;  2VP7 A;  3SOX A;  3PUR A;  5JG6 A;  4Z0R A;  3M62 A;  2MUM A;  3MHH A;  1MM2 A;  3O47 A;  1X4I A;  2MNZ A;  3O7A A;  4A49 A;  5SVX A;  3L11 A;  3QZV A;  4YBT A;  2FFW A;  2G43 A;  4F1P A;  1E4U A;  2MD8 C;  2YQL A;  3N9L A;  2CSV A;  2DSM A;  2C2V S;  2KRE A;  4V3L C;  2VPE A;  5G04 B;  3U5M A;  3GV4 A; 
#chains in the Genus database with same CATH homology
 2VJE B;  5DKA A;  1FBV A;  1DVP A;  1HYI A;  1BOR A;  4GND A;  4R7E A;  2LGG A;  5LKU A;  2H0D B;  5H1U A;  1WEM A;  4F52 B;  3RTR B;  2YU4 A;  2E6R A;  3ZPV 1;  2YW8 A;  5H9M A;  2LDR A;  4FIP A;  2QIC A;  2K1J A;  4P5O B;  5TRB A;  4V3K C;  1WFK A;  2F6N A;  1Z2Q A;  5EYA F;  4GB0 A;  2ECI A;  4FK5 A;  4A4B A;  1Z60 A;  3ZYQ A;  3SHB A;  4R8P K;  1JM7 B;  3N9P A;  4WZ3 B;  2KFT A;  2YSM A;  2CSY A;  1WEE A;  2LXP C;  2YUR A;  4L7X A;  3N9O A;  2EA6 A;  4YAD A;  2L75 A;  1LDJ B;  1F62 A;  4ZQL A;  1Z6U A;  1U6G B;  5LKX A;  4AVX A;  3LQI A;  2YHN A;  3ZPV E;  5C13 A;  5I3L A;  4PTB A;  5D1M B;  3LQH A;  3GL6 A;  4TKP B;  2M85 A;  2VPB A;  2LXH C;  4I7D A;  1VFY A;  2F6J A;  4LLB A;  2YRE A;  4IC2 A;  4ZUX U;  2G45 A;  2RSD A;  2OXQ C;  4YC9 A;  2YHO A;  2MT5 A;  3U5P A;  5B8D A;  1MM3 A;  2M6M A;  3O35 A;  3DPL R;  2PUY A;  1WEQ A;  5D1K B;  2MIQ A;  4C9Z A;  1RMD A;  2KGI A;  2UZG A;  2MNY A;  5DIN A;  4GNE A;  1WEU A;  2FSA A;  3N9Q A;  3LRQ A;  4WA6 A;  3M63 A;  4I7C A;  2CKL B;  4PPE A;  2JMJ A;  2MD7 B;  4AYC B;  2BAY A;  4GNG A;  5B79 A;  3NG2 A;  4YAT A;  3L1X A;  2K17 A;  2Y1N A;  3HCT A;  2YSJ A;  2KWJ A;  1WGM A;  3LQJ A;  1WEP A;  3T6R A;  4W4U A;  2KE1 A;  4MVT A;  4N3W A;  4NN2 A;  5LCW B;  2ECG A;  1WEO A;  3PUQ A;  5FB1 A;  4R2Y A;  2DX8 A;  2YQM A;  1WES A;  2E6S A;  2ECT A;  2LQ6 A;  4LAD B;  3N9M A;  2YYR A;  2KIZ A;  1K2F A;  2M1R A;  4BHW A;  2KGG A;  3KV5 A;  4YBM A;  2CT2 A;  2G6Q A;  2VJE A;  4GNF A;  3N9N A;  3SOW A;  4FO9 A;  2C2L A;  3O34 A;  3HCU A;  1JOC A;  2K4D A;  2KR4 A;  2H0D A;  4YAX A;  2XB1 A;  2KWN A;  2L43 A;  2VJF A;  3O36 A;  2LN0 A;  4LKA A;  5J3X A;  5LKZ A;  5FEY A;  4WZ0 A;  2AN6 A;  1N87 A;  2I50 A;  3MHS A;  3ZVZ B;  4S3O B;  1X4J A;  1CHC A;  2LRI C;  4ZDT A;  4YBS A;  2LGV A;  4QF3 A;  1JM7 A;  2EOD A;  4YAB A;  5TDR A;  3O70 A;  5H1T A;  1WEV A;  2VPD A;  4CA1 A;  2QIZ A;  5TAB A;  4XI1 A;  2ECN A;  1HYJ A;  2F42 A;  3EB5 A;  4AP4 A;  3PHD A;  2FUU A;  2FUI A;  2QJ0 A;  4FJC A;  1T1H A;  5KH7 A;  2MA6 A;  2XEU A;  2ECJ A;  5B75 A;  1WEW A;  5B76 A;  3U5N A;  1XWH A;  3M99 A;  3V43 A;  5AIT A;  1VD4 A;  2ZET C;  3KV6 A;  2CSZ A;  5G0F A;  2ECV A;  1WEN A;  2KWO A;  2KYU A;  2NAA A;  3C6W A;  4IC3 A;  3ZNI A;  3IHP A;  1WIL A;  2YUC A;  3I2D A;  2JRJ A;  3RPG B;  2JMI A;  5B77 A;  1WIM A;  2VPG A;  5D1L B;  4A0C D;  1LDK C;  2D8S A;  4L58 A;  4A4C A;  2L0B A;  4CCG X;  2M3H A;  4B86 C;  3U5O A;  3SOU A;  2PNX A;  5TBN A;  1G25 A;  3O33 A;  2Y1M A;  4S3O C;  2RI7 A;  2CKL A;  2L5U A;  2LV9 A;  5TDW A;  2ECW A;  4AYC A;  1V87 A;  4UP0 A;  4LK9 A;  1VYX A;  4QF2 A;  4N4F A;  1IYM A;  2IDA A;  3HCS A;  2Y43 A;  3KQI A;  2LGK A;  3DQV R;  2JMD A;  5AIU A;  4B7Y C;  5FB0 A;  2MA5 A;  3KNV A;  5LKT A;  4LJN A;  1WE9 A;  2EGP A;  2VNF A;  4MSX A;  4UI9 B;  2K16 A;  3ASL A;  4Q6F A;  1FP0 A;  5KH9 A;  4AUQ B;  2L80 A;  5H1V A;  1X4U A;  5G05 B;  2HYE D;  3EB6 A;  3RPG C;  5C11 A;  2HDP A;  4WZ2 A;  3T7L A;  3VK6 A;  3HTK C;  4I7B A;  4O64 A;  5FER A;  2KWK A;  2YT5 A;  2VJF B;  4BBQ A;  4UP5 A;  3C5K A;  4X3G A;  3L1Z B;  5KH3 A;  5B78 A;  3FL2 A;  1ZBD B;  2KU3 A;  3ZVY A;  2LGL A;  3O37 A;  3ZTG A;  2VP7 A;  3SOX A;  3PUR A;  5JG6 A;  3M62 A;  2MUM A;  3MHH A;  1MM2 A;  1X4I A;  2MNZ A;  3O7A A;  4A49 A;  3L11 A;  3QZV A;  4YBT A;  2G43 A;  1E4U A;  2MD8 C;  2YQL A;  3N9L A;  2C2V S;  2KRE A;  2VPE A;  4V3L C;  5G04 B;  3U5M A;  3GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...