2D8SA

Solution structure of the ring domain of the human cellular modulator of immune recognition protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
80
structure length
80
Chain Sequence
b'GSSGSSGTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellular modulator of immune recognition
publication title Solution structure of the RING domain of the human cellular modulator of immune recognition protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 5
structure length 80
sequence length 80
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2d8sA00
3IHPA 2FUIA 2KGIA 2YUCA 2ZETC 4V3KC 5DINA 2M6MA 2ECJA 3O37A 2ECWA 1X4UA 2QIZA 4GNFA 2KWOA 4FK5A 2KWJA 3T6RA 5H9MA 4L7XA 4YABA 2UZGA 2K17A 4Q6FA 2JMJA 2VPBA 5DKAA 4CCGX 1VYXA 3GL6A 5B77A 2VNFA 5TDRA 3N9QA 2F6NA 2FUUA 2Y43A 1WGMA 2LGVA 1CHCA 2YREA 1FP0A 2M1RA 2K4DA 2LRIC 5KH9A 4R7EA 2KE1A 2ECVA 3PUQA 5B75A 1WEUA 5H1TA 3RPGC 5AIUA 2AN6A 4YBSA 5B78A 2KWKA 4YATA 1WFKA 2MUMA 1JM7A 1V87A 4P5OB 5AITA 5FB1A 3FL2A 5G04B 1JM7B 2H0DB 4WZ3B 1K2FA 3U5PA 2OXQC 4YBTA 2Y1NA 3M63A 2HDPA 2BAYA 1WEOA 2VJFB 2FSAA 5FB0A 2ECGA 4R8PK 4R2YA 1WILA 2KREA 4F52B 1RMDA 5D1LB 3ZNIA 5KH3A 1XWHA 2XEUA 2MA5A 3O34A 4LADB 4LK9A 2LN0A 1Z60A 4AP4A 5I3LA 3O7AA 4A0CD 2L0BA 5D1MB 2VJEB 2YHOA 3M99A 2ECIA 3RTRB 2KYUA 1F62A 2NAAA 1E4UA 1Z2QA 3KV5A 3ZPV1 2LXHC 3L11A 3LRQA 2LGKA 5JG6A 3SOWA 5C11A 5TBNA 2LGLA 2CSZA 2MIQA 4ZUXU 4QF3A 4B86C 1WEMA 2G6QA 2I50A 4I7DA 4TKPB 1X4JA 2L80A 3SOUA 2XB1A 2Y1MA 3L1XA 2MA6A 3HCUA 1X4IA 4PPEA 2CSYA 3LQIA 2RI7A 2ECTA 5KH7A 3SOXA 2YYRA 3N9NA 3T7LA 4FO9A 3EB6A 2M85A 3NG2A 2MNZA 2VPEA 2ECNA 2KFTA 3ZPVE 1MM3A 4LKAA 5FEYA 5LKUA 4BHWA 1WE9A 5TDWA 2EGPA 4IC2A 3V43A 3HCSA 5D1KB 1WEWA 1DVPA 2F6JA 4YAXA 2LV9A 2YU4A 4XI1A 3ZYQA 1HYIA 2QICA 2YHNA 2YQLA 2L75A 2YSJA 4B7YC 2YSMA 3O33A 3LQHA 2MD7B 4W4UA 2YT5A 2LDRA 3MHSA 1WIMA 2H0DA 2L43A 4I7CA 3O36A 2JRJA 4YBMA 3LQJA 5LKTA 4A4CA 4MSXA 2VJFA 3N9OA 4WA6A 4AYCB 5TABA 3KQIA 2MT5A 2EODA 2PUYA 2G43A 3U5OA 3N9MA 1FBVA 3O70A 2IDAA 1BORA 3PHDA 3HCTA 4BBQA 2VJEA 3C6WA 1HYJA 4I7BA 4UI9B 5H1UA 3I2DA 3O35A 2CKLB 3EB5A 5B76A 2LQ6A 3PURA 2D8SA 2KIZA 3VK6A 2VPGA 2CT2A 5G05B 5C13A 1ZBDB 1WEEA 2KWNA 4CA1A 2YURA 4YC9A 2E6SA 1VFYA 4YADA 2E6RA 1U6GB 4PTBA 5LKZA 4UP0A 5LCWB 2VPDA 5J3XA 4C9ZA 4WZ0A 4UP5A 3M62A 2YQMA 2MD8C 2C2LA 4GNDA 1N87A 4GB0A 1VD4A 1JOCA 5LKXA 3KV6A 3HTKC 2KR4A 2C2VS 4MVTA 1LDKC 3ZVZB 3QZVA 3ASLA 3RPGB 4L58A 1WEVA 3L1ZB 4ZQLA 1IYMA 2VP7A 1T1HA 4GNEA 3ZVYA 3KNVA 1WEPA 2PNXA 4AVXA 2M3HA 1WEQA 4GNGA 2JMDA 4N3WA 2DX8A 4V3LC 3DQVR 2K1JA 1Z6UA 3ZTGA 2KU3A 5EYAF 2G45A 2JMIA 4S3OB 2F42A 2HYED 4AYCA 2LXPC 4LLBA 2EA6A 4O64A 4QF2A 3N9PA 5G0FA 4ZDTA 3MHHA 4N4FA 1WESA 2LGGA 5TRBA 3U5NA 2K16A 4X3GA 2KGGA 1LDJB 1MM2A 3DPLR 5H1VA 1G25A 5FERA 3C5KA 3GV4A 3SHBA 5B79A 4LJNA 2CKLA 4A4BA 5B8DA 4S3OC 2YW8A 4FJCA 2QJ0A 4AUQB 1WENA 2RSDA 2MNYA 2L5UA 4IC3A 4NN2A 3N9LA 3U5MA 4WZ2A 4FIPA 4A49A
chains in the Genus database with same CATH superfamily
3IHPA 2FUIA 2KGIA 2YUCA 2ZETC 4V3KC 5DINA 2M6MA 2ECJA 3O37A 2ECWA 1X4UA 2JM3A 2QIZA 4GNFA 2KWOA 4FK5A 2KWJA 3T6RA 5H9MA 4L7XA 4YABA 2UZGA 2K17A 2D8UA 3FANA 1MBMA 4Q6FA 2JMJA 2VPBA 5DKAA 4CCGX 1VYXA 3GL6A 2XOYA 5B77A 2RR4A 5SVIB 3LVQE 3LDYA 2VNFA 5TDRA 3N9QA 2F6NA 2FUUA 2Y43A 1WGMA 2LGVA 1CHCA 2YREA 1FP0A 2M1RA 2XOZA 2K4DA 2LRIC 5KH9A 4R7EA 2KE1A 2ECVA 2KKXA 3PUQA 5B75A 1WEUA 5H1TA 3RPGC 5AIUA 4Z0RA 2AN6A 4YBSA 5B78A 2KWKA 4YATA 2CRWA 1WFKA 2MUMA 1JM7A 1V87A 3DDTA 4P5OB 5AITA 5FB1A 3FL2A 5G04B 1JM7B 2H0DB 4WZ3B 1K2FA 5SVXA 3U5PA 2OXQC 4YBTA 2Y1NA 3M63A 3SUBA 2HDPA 3JUEA 2BAYA 1WEOA 2VJFB 2FSAA 5FB0A 2ECGA 4R8PK 4R2YA 1WILA 2KREA 4F52B 1RMDA 5D1LB 2EXUA 3ZNIA 5KH3A 2CRRA 1XWHA 2XEUA 2MA5A 3PLWA 3O34A 4LADB 4LK9A 2LN0A 1Z60A 4AP4A 5I3LA 3O7AA 4A0CD 2L0BA 5D1MB 2VJEB 2YHOA 3M99A 2ECIA 2XOCA 3RTRB 2KYUA 1F62A 2NAAA 1E4UA 1Z2QA 3KV5A 3ZPV1 2LXHC 3L11A 3LRQA 2LGKA 5JG6A 3SOWA 5C11A 5TBNA 2LGLA 2CSZA 2MIQA 4ZUXU 4QF3A 2L7PA 4B86C 1WEMA 2G6QA 2I50A 4I7DA 3FJUB 4TKPB 1X4JA 2L80A 3SOUA 3E2DA 2CSVA 2XB1A 2Y1MA 3L1XA 2MA6A 3HCUA 1X4IA 4PPEA 2CSYA 2CONA 3LQIA 2RI7A 2E61A 2ECTA 5KH7A 3SOXA 2YYRA 3N9NA 3T7LA 4FO9A 3EB6A 2M85A 3NG2A 2MNZA 2VPEA 5SVIA 2ECNA 2KFTA 3ZPVE 4O62A 1MM3A 4LKAA 5FEYA 5LKUA 4BHWA 1WE9A 5TDWA 2EGPA 4QQ4A 4IC2A 3V43A 3HCSA 5D1KB 1WEWA 1DVPA 2F6JA 4YAXA 2LV9A 2YU4A 2MKEA 4XI1A 3ZYQA 3M7KA 1HYIA 2QICA 2YHNA 2YQLA 2L75A 2YSJA 2IQJA 4B7YC 2YSMA 3O33A 3LQHA 2MD7B 4W4UA 2YT5A 2LDRA 3MHSA 1WIMA 2H0DA 2L43A 4I7CA 3O36A 2JRJA 4YBMA 3LQJA 5LKTA 4A4CA 4MSXA 2VJFA 3N9OA 4WA6A 5SVYA 4AYCB 1DCQA 3KDEC 5TABA 3KQIA 2MT5A 2FFWA 2EODA 2PUYA 2G43A 3U5OA 3N9MA 1FBVA 2OWAA 3O70A 2IDAA 1BORA 3PHDA 3HCTA 4BBQA 2VJEA 3C6WA 3LVRE 3O47A 1HYJA 4I7BA 4UI9B 5H1UA 3I2DA 3O35A 2CKLB 3EB5A 5B76A 4F1PA 2LQ6A 3PURA 2D8SA 2KIZA 3FAOA 3VK6A 2VPGA 2CT2A 5G05B 5C13A 1ZBDB 1WEEA 2KWNA 4CA1A 2YURA 4YC9A 2E6SA 3T9KA 1VFYA 4YADA 2E6RA 1U6GB 4PTBA 5LKZA 4UP0A 5LCWB 2VPDA 5J3XA 4C9ZA 3DWDA 2LAUA 4WZ0A 4UP5A 3M62A 4Z0OA 2YQMA 2MD8C 2JUNA 2C2LA 4GNDA 1N87A 4GB0A 1VD4A 3LJUX 1JOCA 5LKXA 3KV6A 3FM8C 3HTKC 2KR4A 3FEHA 2C2VS 4MVTA 1LDKC 3ZVZB 3QZVA 3ASLA 4OGEA 3RPGB 4L58A 2XP0A 1WEVA 2EGMA 3L1ZB 4ZQLA 3H7HA 1IYMA 3MDBC 2VP7A 4OGCA 2FD4A 2M13A 1T1HA 4GNEA 3ZVYA 3KNVA 1WEPA 2PNXA 4AVXA 2M3HA 1WEQA 4GNGA 2JMDA 4N3WA 2DX8A 4V3LC 3DQVR 2K1JA 1Z6UA 3ZTGA 2KU3A 5EYAF 2G45A 2JMIA 4S3OB 2F42A 2HYED 4AYCA 2LXPC 4LLBA 2EA6A 2P57A 4O64A 4QF2A 3N9PA 5G0FA 4ZDTA 3MHHA 4N4FA 1WESA 2LGGA 5TRBA 3U5NA 2K16A 4X3GA 5K3QA 2KGGA 1LDJB 2DJAA 1MM2A 3DPLR 2DSMA 5H1VA 1G25A 5FERA 3C5KA 3GV4A 3SHBA 5B79A 4LJNA 2CKLA 4H9DA 4A4BA 5B8DA 2YVRA 4S3OC 2KKYA 2YW8A 4FJCA 2QJ0A 4AUQB 1WENA 2RSDA 2B0OE 2MNYA 2L5UA 4IC3A 4NN2A 3N9LA 3U5MA 4WZ2A 3Q1DA 4FIPA 4A49A
chains in the Genus database with same CATH topology
3IHPA 2FUIA 2KGIA 2YUCA 2ZETC 4V3KC 5DINA 2M6MA 2ECJA 3O37A 2ECWA 1X4UA 2QIZA 4GNFA 2KWOA 4FK5A 2KWJA 3T6RA 5H9MA 4L7XA 4YABA 2UZGA 2K17A 4Q6FA 2JMJA 2VPBA 5DKAA 4CCGX 1VYXA 3GL6A 5B77A 2VNFA 5TDRA 3N9QA 2F6NA 2FUUA 2Y43A 1WGMA 2LGVA 1CHCA 2YREA 1FP0A 2M1RA 2K4DA 2LRIC 5KH9A 4R7EA 2KE1A 2ECVA 3PUQA 5B75A 1WEUA 5H1TA 3RPGC 5AIUA 2AN6A 4YBSA 5B78A 2KWKA 4YATA 1WFKA 2MUMA 1JM7A 1V87A 4P5OB 5AITA 5FB1A 3FL2A 5G04B 1JM7B 2H0DB 4WZ3B 1K2FA 3U5PA 2OXQC 4YBTA 2Y1NA 3M63A 2HDPA 2BAYA 1WEOA 2VJFB 2FSAA 5FB0A 2ECGA 4R8PK 4R2YA 1WILA 2KREA 4F52B 1RMDA 5D1LB 3ZNIA 5KH3A 1XWHA 2XEUA 2MA5A 3O34A 4LADB 4LK9A 2LN0A 1Z60A 4AP4A 5I3LA 3O7AA 4A0CD 2L0BA 5D1MB 2VJEB 2YHOA 3M99A 2ECIA 3RTRB 2KYUA 1F62A 2NAAA 1E4UA 1Z2QA 3KV5A 3ZPV1 2LXHC 3L11A 3LRQA 2LGKA 5JG6A 3SOWA 5C11A 5TBNA 2LGLA 2CSZA 2MIQA 4ZUXU 4QF3A 4B86C 1WEMA 2G6QA 2I50A 4I7DA 4TKPB 1X4JA 2L80A 3SOUA 2XB1A 2Y1MA 3L1XA 2MA6A 3HCUA 1X4IA 4PPEA 2CSYA 3LQIA 2RI7A 2ECTA 5KH7A 3SOXA 2YYRA 3N9NA 3T7LA 4FO9A 3EB6A 2M85A 3NG2A 2MNZA 2VPEA 2ECNA 2KFTA 3ZPVE 1MM3A 4LKAA 5FEYA 5LKUA 4BHWA 1WE9A 5TDWA 2EGPA 4IC2A 3V43A 3HCSA 5D1KB 1WEWA 1DVPA 2F6JA 4YAXA 2LV9A 2YU4A 4XI1A 3ZYQA 1HYIA 2QICA 2YHNA 2YQLA 2L75A 2YSJA 4B7YC 2YSMA 3O33A 3LQHA 2MD7B 4W4UA 2YT5A 2LDRA 3MHSA 1WIMA 2H0DA 2L43A 4I7CA 3O36A 2JRJA 4YBMA 3LQJA 5LKTA 4A4CA 4MSXA 2VJFA 3N9OA 4WA6A 4AYCB 5TABA 3KQIA 2MT5A 2EODA 2PUYA 2G43A 3U5OA 3N9MA 1FBVA 3O70A 2IDAA 1BORA 3PHDA 3HCTA 4BBQA 2VJEA 3C6WA 1HYJA 4I7BA 4UI9B 5H1UA 3I2DA 3O35A 2CKLB 3EB5A 5B76A 2LQ6A 3PURA 2D8SA 2KIZA 3VK6A 2VPGA 2CT2A 5G05B 5C13A 1ZBDB 1WEEA 2KWNA 4CA1A 2YURA 4YC9A 2E6SA 1VFYA 4YADA 2E6RA 1U6GB 4PTBA 5LKZA 4UP0A 5LCWB 2VPDA 5J3XA 4C9ZA 4WZ0A 4UP5A 3M62A 2YQMA 2MD8C 2C2LA 4GNDA 1N87A 4GB0A 1VD4A 1JOCA 5LKXA 3KV6A 3HTKC 2KR4A 2C2VS 4MVTA 1LDKC 3ZVZB 3QZVA 3ASLA 3RPGB 4L58A 1WEVA 3L1ZB 4ZQLA 1IYMA 2VP7A 1T1HA 4GNEA 3ZVYA 3KNVA 1WEPA 2PNXA 4AVXA 2M3HA 1WEQA 4GNGA 2JMDA 4N3WA 2DX8A 4V3LC 3DQVR 2K1JA 1Z6UA 3ZTGA 2KU3A 5EYAF 2G45A 2JMIA 4S3OB 2F42A 2HYED 4AYCA 2LXPC 4LLBA 2EA6A 4O64A 4QF2A 3N9PA 5G0FA 4ZDTA 3MHHA 4N4FA 1WESA 2LGGA 5TRBA 3U5NA 2K16A 4X3GA 2KGGA 1LDJB 1MM2A 3DPLR 5H1VA 1G25A 5FERA 3C5KA 3GV4A 3SHBA 5B79A 4LJNA 2CKLA 4A4BA 5B8DA 4S3OC 2YW8A 4FJCA 2QJ0A 4AUQB 1WENA 2RSDA 2MNYA 2L5UA 4IC3A 4NN2A 3N9LA 3U5MA 4WZ2A 4FIPA 4A49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP A;  2FUI A;  2KGI A;  2YUC A;  2ZET C;  4V3K C;  5DIN A;  2M6M A;  2ECJ A;  3O37 A;  2ECW A;  1X4U A;  2QIZ A;  4GNF A;  2KWO A;  4FK5 A;  2KWJ A;  3T6R A;  5H9M A;  4L7X A;  4YAB A;  2UZG A;  2K17 A;  4Q6F A;  2JMJ A;  2VPB A;  5DKA A;  4CCG X;  1VYX A;  3GL6 A;  5B77 A;  2VNF A;  5TDR A;  3N9Q A;  2F6N A;  2FUU A;  2Y43 A;  1WGM A;  2LGV A;  1CHC A;  2YRE A;  1FP0 A;  2M1R A;  2K4D A;  2LRI C;  5KH9 A;  4R7E A;  2KE1 A;  2ECV A;  3PUQ A;  5B75 A;  1WEU A;  5H1T A;  3RPG C;  5AIU A;  2AN6 A;  4YBS A;  5B78 A;  2KWK A;  4YAT A;  1WFK A;  2MUM A;  1JM7 A;  1V87 A;  4P5O B;  5AIT A;  5FB1 A;  3FL2 A;  5G04 B;  1JM7 B;  2H0D B;  4WZ3 B;  1K2F A;  3U5P A;  2OXQ C;  4YBT A;  2Y1N A;  3M63 A;  2HDP A;  2BAY A;  1WEO A;  2VJF B;  2FSA A;  5FB0 A;  2ECG A;  4R8P K;  4R2Y A;  1WIL A;  2KRE A;  4F52 B;  1RMD A;  5D1L B;  3ZNI A;  5KH3 A;  1XWH A;  2XEU A;  2MA5 A;  3O34 A;  4LAD B;  4LK9 A;  2LN0 A;  1Z60 A;  4AP4 A;  5I3L A;  3O7A A;  4A0C D;  2L0B A;  5D1M B;  2VJE B;  2YHO A;  3M99 A;  2ECI A;  3RTR B;  2KYU A;  1F62 A;  2NAA A;  1E4U A;  1Z2Q A;  3KV5 A;  3ZPV 1;  2LXH C;  3L11 A;  3LRQ A;  2LGK A;  5JG6 A;  3SOW A;  5C11 A;  5TBN A;  2LGL A;  2CSZ A;  2MIQ A;  4ZUX U;  4QF3 A;  4B86 C;  1WEM A;  2G6Q A;  2I50 A;  4I7D A;  4TKP B;  1X4J A;  2L80 A;  3SOU A;  2XB1 A;  2Y1M A;  3L1X A;  2MA6 A;  3HCU A;  1X4I A;  4PPE A;  2CSY A;  3LQI A;  2RI7 A;  2ECT A;  5KH7 A;  3SOX A;  2YYR A;  3N9N A;  3T7L A;  4FO9 A;  3EB6 A;  2M85 A;  3NG2 A;  2MNZ A;  2VPE A;  2ECN A;  2KFT A;  3ZPV E;  1MM3 A;  4LKA A;  5FEY A;  5LKU A;  4BHW A;  1WE9 A;  5TDW A;  2EGP A;  4IC2 A;  3V43 A;  3HCS A;  5D1K B;  1WEW A;  1DVP A;  2F6J A;  4YAX A;  2LV9 A;  2YU4 A;  4XI1 A;  3ZYQ A;  1HYI A;  2QIC A;  2YHN A;  2YQL A;  2L75 A;  2YSJ A;  4B7Y C;  2YSM A;  3O33 A;  3LQH A;  2MD7 B;  4W4U A;  2YT5 A;  2LDR A;  3MHS A;  1WIM A;  2H0D A;  2L43 A;  4I7C A;  3O36 A;  2JRJ A;  4YBM A;  3LQJ A;  5LKT A;  4A4C A;  4MSX A;  2VJF A;  3N9O A;  4WA6 A;  4AYC B;  5TAB A;  3KQI A;  2MT5 A;  2EOD A;  2PUY A;  2G43 A;  3U5O A;  3N9M A;  1FBV A;  3O70 A;  2IDA A;  1BOR A;  3PHD A;  3HCT A;  4BBQ A;  2VJE A;  3C6W A;  1HYJ A;  4I7B A;  4UI9 B;  5H1U A;  3I2D A;  3O35 A;  2CKL B;  3EB5 A;  5B76 A;  2LQ6 A;  3PUR A;  2D8S A;  2KIZ A;  3VK6 A;  2VPG A;  2CT2 A;  5G05 B;  5C13 A;  1ZBD B;  1WEE A;  2KWN A;  4CA1 A;  2YUR A;  4YC9 A;  2E6S A;  1VFY A;  4YAD A;  2E6R A;  1U6G B;  4PTB A;  5LKZ A;  4UP0 A;  5LCW B;  2VPD A;  5J3X A;  4C9Z A;  4WZ0 A;  4UP5 A;  3M62 A;  2YQM A;  2MD8 C;  2C2L A;  4GND A;  1N87 A;  4GB0 A;  1VD4 A;  1JOC A;  5LKX A;  3KV6 A;  3HTK C;  2KR4 A;  2C2V S;  4MVT A;  1LDK C;  3ZVZ B;  3QZV A;  3ASL A;  3RPG B;  4L58 A;  1WEV A;  3L1Z B;  4ZQL A;  1IYM A;  2VP7 A;  1T1H A;  4GNE A;  3ZVY A;  3KNV A;  1WEP A;  2PNX A;  4AVX A;  2M3H A;  1WEQ A;  4GNG A;  2JMD A;  4N3W A;  2DX8 A;  4V3L C;  3DQV R;  2K1J A;  1Z6U A;  3ZTG A;  2KU3 A;  5EYA F;  2G45 A;  2JMI A;  4S3O B;  2F42 A;  2HYE D;  4AYC A;  2LXP C;  4LLB A;  2EA6 A;  4O64 A;  4QF2 A;  3N9P A;  5G0F A;  4ZDT A;  3MHH A;  4N4F A;  1WES A;  2LGG A;  5TRB A;  3U5N A;  2K16 A;  4X3G A;  2KGG A;  1LDJ B;  1MM2 A;  3DPL R;  5H1V A;  1G25 A;  5FER A;  3C5K A;  3GV4 A;  3SHB A;  5B79 A;  4LJN A;  2CKL A;  4A4B A;  5B8D A;  4S3O C;  2YW8 A;  4FJC A;  2QJ0 A;  4AUQ B;  1WEN A;  2RSD A;  2MNY A;  2L5U A;  4IC3 A;  4NN2 A;  3N9L A;  3U5M A;  4WZ2 A;  4FIP A;  4A49 A; 
#chains in the Genus database with same CATH topology
 3IHP A;  2FUI A;  2KGI A;  2YUC A;  2ZET C;  4V3K C;  5DIN A;  2M6M A;  2ECJ A;  3O37 A;  2ECW A;  1X4U A;  2JM3 A;  2QIZ A;  4GNF A;  2KWO A;  4FK5 A;  2KWJ A;  3T6R A;  5H9M A;  4L7X A;  4YAB A;  2UZG A;  2K17 A;  2D8U A;  3FAN A;  1MBM A;  4Q6F A;  2JMJ A;  2VPB A;  5DKA A;  4CCG X;  1VYX A;  3GL6 A;  2XOY A;  5B77 A;  2RR4 A;  5SVI B;  3LVQ E;  3LDY A;  2VNF A;  5TDR A;  3N9Q A;  2F6N A;  2FUU A;  2Y43 A;  1WGM A;  2LGV A;  1CHC A;  2YRE A;  1FP0 A;  2M1R A;  2XOZ A;  2K4D A;  2LRI C;  5KH9 A;  4R7E A;  2KE1 A;  2ECV A;  2KKX A;  3PUQ A;  5B75 A;  1WEU A;  5H1T A;  3RPG C;  5AIU A;  4Z0R A;  2AN6 A;  4YBS A;  5B78 A;  2KWK A;  4YAT A;  2CRW A;  1WFK A;  2MUM A;  1JM7 A;  1V87 A;  3DDT A;  4P5O B;  5AIT A;  5FB1 A;  3FL2 A;  5G04 B;  1JM7 B;  2H0D B;  4WZ3 B;  1K2F A;  5SVX A;  3U5P A;  2OXQ C;  4YBT A;  2Y1N A;  3M63 A;  3SUB A;  2HDP A;  3JUE A;  2BAY A;  1WEO A;  2VJF B;  2FSA A;  5FB0 A;  2ECG A;  4R8P K;  4R2Y A;  1WIL A;  2KRE A;  4F52 B;  1RMD A;  5D1L B;  2EXU A;  3ZNI A;  5KH3 A;  2CRR A;  1XWH A;  2XEU A;  2MA5 A;  3PLW A;  3O34 A;  4LAD B;  4LK9 A;  2LN0 A;  1Z60 A;  4AP4 A;  5I3L A;  3O7A A;  4A0C D;  2L0B A;  5D1M B;  2VJE B;  2YHO A;  3M99 A;  2ECI A;  2XOC A;  3RTR B;  2KYU A;  1F62 A;  2NAA A;  1E4U A;  1Z2Q A;  3KV5 A;  3ZPV 1;  2LXH C;  3L11 A;  3LRQ A;  2LGK A;  5JG6 A;  3SOW A;  5C11 A;  5TBN A;  2LGL A;  2CSZ A;  2MIQ A;  4ZUX U;  4QF3 A;  2L7P A;  4B86 C;  1WEM A;  2G6Q A;  2I50 A;  4I7D A;  3FJU B;  4TKP B;  1X4J A;  2L80 A;  3SOU A;  3E2D A;  2CSV A;  2XB1 A;  2Y1M A;  3L1X A;  2MA6 A;  3HCU A;  1X4I A;  4PPE A;  2CSY A;  2CON A;  3LQI A;  2RI7 A;  2E61 A;  2ECT A;  5KH7 A;  3SOX A;  2YYR A;  3N9N A;  3T7L A;  4FO9 A;  3EB6 A;  2M85 A;  3NG2 A;  2MNZ A;  2VPE A;  5SVI A;  2ECN A;  2KFT A;  3ZPV E;  4O62 A;  1MM3 A;  4LKA A;  5FEY A;  5LKU A;  4BHW A;  1WE9 A;  5TDW A;  2EGP A;  4QQ4 A;  4IC2 A;  3V43 A;  3HCS A;  5D1K B;  1WEW A;  1DVP A;  2F6J A;  4YAX A;  2LV9 A;  2YU4 A;  2MKE A;  4XI1 A;  3ZYQ A;  3M7K A;  1HYI A;  2QIC A;  2YHN A;  2YQL A;  2L75 A;  2YSJ A;  2IQJ A;  4B7Y C;  2YSM A;  3O33 A;  3LQH A;  2MD7 B;  4W4U A;  2YT5 A;  2LDR A;  3MHS A;  1WIM A;  2H0D A;  2L43 A;  4I7C A;  3O36 A;  2JRJ A;  4YBM A;  3LQJ A;  5LKT A;  4A4C A;  4MSX A;  2VJF A;  3N9O A;  4WA6 A;  5SVY A;  4AYC B;  1DCQ A;  3KDE C;  5TAB A;  3KQI A;  2MT5 A;  2FFW A;  2EOD A;  2PUY A;  2G43 A;  3U5O A;  3N9M A;  1FBV A;  2OWA A;  3O70 A;  2IDA A;  1BOR A;  3PHD A;  3HCT A;  4BBQ A;  2VJE A;  3C6W A;  3LVR E;  3O47 A;  1HYJ A;  4I7B A;  4UI9 B;  5H1U A;  3I2D A;  3O35 A;  2CKL B;  3EB5 A;  5B76 A;  4F1P A;  2LQ6 A;  3PUR A;  2D8S A;  2KIZ A;  3FAO A;  3VK6 A;  2VPG A;  2CT2 A;  5G05 B;  5C13 A;  1ZBD B;  1WEE A;  2KWN A;  4CA1 A;  2YUR A;  4YC9 A;  2E6S A;  3T9K A;  1VFY A;  4YAD A;  2E6R A;  1U6G B;  4PTB A;  5LKZ A;  4UP0 A;  5LCW B;  2VPD A;  5J3X A;  4C9Z A;  3DWD A;  2LAU A;  4WZ0 A;  4UP5 A;  3M62 A;  4Z0O A;  2YQM A;  2MD8 C;  2JUN A;  2C2L A;  4GND A;  1N87 A;  4GB0 A;  1VD4 A;  3LJU X;  1JOC A;  5LKX A;  3KV6 A;  3FM8 C;  3HTK C;  2KR4 A;  3FEH A;  2C2V S;  4MVT A;  1LDK C;  3ZVZ B;  3QZV A;  3ASL A;  4OGE A;  3RPG B;  4L58 A;  2XP0 A;  1WEV A;  2EGM A;  3L1Z B;  4ZQL A;  3H7H A;  1IYM A;  3MDB C;  2VP7 A;  4OGC A;  2FD4 A;  2M13 A;  1T1H A;  4GNE A;  3ZVY A;  3KNV A;  1WEP A;  2PNX A;  4AVX A;  2M3H A;  1WEQ A;  4GNG A;  2JMD A;  4N3W A;  2DX8 A;  4V3L C;  3DQV R;  2K1J A;  1Z6U A;  3ZTG A;  2KU3 A;  5EYA F;  2G45 A;  2JMI A;  4S3O B;  2F42 A;  2HYE D;  4AYC A;  2LXP C;  4LLB A;  2EA6 A;  2P57 A;  4O64 A;  4QF2 A;  3N9P A;  5G0F A;  4ZDT A;  3MHH A;  4N4F A;  1WES A;  2LGG A;  5TRB A;  3U5N A;  2K16 A;  4X3G A;  5K3Q A;  2KGG A;  1LDJ B;  2DJA A;  1MM2 A;  3DPL R;  2DSM A;  5H1V A;  1G25 A;  5FER A;  3C5K A;  3GV4 A;  3SHB A;  5B79 A;  4LJN A;  2CKL A;  4H9D A;  4A4B A;  5B8D A;  2YVR A;  4S3O C;  2KKY A;  2YW8 A;  4FJC A;  2QJ0 A;  4AUQ B;  1WEN A;  2RSD A;  2B0O E;  2MNY A;  2L5U A;  4IC3 A;  4NN2 A;  3N9L A;  3U5M A;  4WZ2 A;  3Q1D A;  4FIP A;  4A49 A; 
#chains in the Genus database with same CATH homology
 3IHP A;  2FUI A;  2KGI A;  2YUC A;  2ZET C;  4V3K C;  5DIN A;  2M6M A;  2ECJ A;  3O37 A;  2ECW A;  1X4U A;  2QIZ A;  4GNF A;  2KWO A;  4FK5 A;  2KWJ A;  3T6R A;  5H9M A;  4L7X A;  4YAB A;  2UZG A;  2K17 A;  4Q6F A;  2JMJ A;  2VPB A;  5DKA A;  4CCG X;  1VYX A;  3GL6 A;  5B77 A;  2VNF A;  5TDR A;  3N9Q A;  2F6N A;  2FUU A;  2Y43 A;  1WGM A;  2LGV A;  1CHC A;  2YRE A;  1FP0 A;  2M1R A;  2K4D A;  2LRI C;  5KH9 A;  4R7E A;  2KE1 A;  2ECV A;  3PUQ A;  5B75 A;  1WEU A;  5H1T A;  3RPG C;  5AIU A;  2AN6 A;  4YBS A;  5B78 A;  2KWK A;  4YAT A;  1WFK A;  2MUM A;  1JM7 A;  1V87 A;  4P5O B;  5AIT A;  5FB1 A;  3FL2 A;  5G04 B;  1JM7 B;  2H0D B;  4WZ3 B;  1K2F A;  3U5P A;  2OXQ C;  4YBT A;  2Y1N A;  3M63 A;  2HDP A;  2BAY A;  1WEO A;  2VJF B;  2FSA A;  5FB0 A;  2ECG A;  4R8P K;  4R2Y A;  1WIL A;  2KRE A;  4F52 B;  1RMD A;  5D1L B;  3ZNI A;  5KH3 A;  1XWH A;  2XEU A;  2MA5 A;  3O34 A;  4LAD B;  4LK9 A;  2LN0 A;  1Z60 A;  4AP4 A;  5I3L A;  3O7A A;  4A0C D;  2L0B A;  5D1M B;  2VJE B;  2YHO A;  3M99 A;  2ECI A;  3RTR B;  2KYU A;  1F62 A;  2NAA A;  1E4U A;  1Z2Q A;  3KV5 A;  3ZPV 1;  2LXH C;  3L11 A;  3LRQ A;  2LGK A;  5JG6 A;  3SOW A;  5C11 A;  5TBN A;  2LGL A;  2CSZ A;  2MIQ A;  4ZUX U;  4QF3 A;  4B86 C;  1WEM A;  2G6Q A;  2I50 A;  4I7D A;  4TKP B;  1X4J A;  2L80 A;  3SOU A;  2XB1 A;  2Y1M A;  3L1X A;  2MA6 A;  3HCU A;  1X4I A;  4PPE A;  2CSY A;  3LQI A;  2RI7 A;  2ECT A;  5KH7 A;  3SOX A;  2YYR A;  3N9N A;  3T7L A;  4FO9 A;  3EB6 A;  2M85 A;  3NG2 A;  2MNZ A;  2VPE A;  2ECN A;  2KFT A;  3ZPV E;  1MM3 A;  4LKA A;  5FEY A;  5LKU A;  4BHW A;  1WE9 A;  5TDW A;  2EGP A;  4IC2 A;  3V43 A;  3HCS A;  5D1K B;  1WEW A;  1DVP A;  2F6J A;  4YAX A;  2LV9 A;  2YU4 A;  4XI1 A;  3ZYQ A;  1HYI A;  2QIC A;  2YHN A;  2YQL A;  2L75 A;  2YSJ A;  4B7Y C;  2YSM A;  3O33 A;  3LQH A;  2MD7 B;  4W4U A;  2YT5 A;  2LDR A;  3MHS A;  1WIM A;  2H0D A;  2L43 A;  4I7C A;  3O36 A;  2JRJ A;  4YBM A;  3LQJ A;  5LKT A;  4A4C A;  4MSX A;  2VJF A;  3N9O A;  4WA6 A;  4AYC B;  5TAB A;  3KQI A;  2MT5 A;  2EOD A;  2PUY A;  2G43 A;  3U5O A;  3N9M A;  1FBV A;  3O70 A;  2IDA A;  1BOR A;  3PHD A;  3HCT A;  4BBQ A;  2VJE A;  3C6W A;  1HYJ A;  4I7B A;  4UI9 B;  5H1U A;  3I2D A;  3O35 A;  2CKL B;  3EB5 A;  5B76 A;  2LQ6 A;  3PUR A;  2D8S A;  2KIZ A;  3VK6 A;  2VPG A;  2CT2 A;  5G05 B;  5C13 A;  1ZBD B;  1WEE A;  2KWN A;  4CA1 A;  2YUR A;  4YC9 A;  2E6S A;  1VFY A;  4YAD A;  2E6R A;  1U6G B;  4PTB A;  5LKZ A;  4UP0 A;  5LCW B;  2VPD A;  5J3X A;  4C9Z A;  4WZ0 A;  4UP5 A;  3M62 A;  2YQM A;  2MD8 C;  2C2L A;  4GND A;  1N87 A;  4GB0 A;  1VD4 A;  1JOC A;  5LKX A;  3KV6 A;  3HTK C;  2KR4 A;  2C2V S;  4MVT A;  1LDK C;  3ZVZ B;  3QZV A;  3ASL A;  3RPG B;  4L58 A;  1WEV A;  3L1Z B;  4ZQL A;  1IYM A;  2VP7 A;  1T1H A;  4GNE A;  3ZVY A;  3KNV A;  1WEP A;  2PNX A;  4AVX A;  2M3H A;  1WEQ A;  4GNG A;  2JMD A;  4N3W A;  2DX8 A;  4V3L C;  3DQV R;  2K1J A;  1Z6U A;  3ZTG A;  2KU3 A;  5EYA F;  2G45 A;  2JMI A;  4S3O B;  2F42 A;  2HYE D;  4AYC A;  2LXP C;  4LLB A;  2EA6 A;  4O64 A;  4QF2 A;  3N9P A;  5G0F A;  4ZDT A;  3MHH A;  4N4F A;  1WES A;  2LGG A;  5TRB A;  3U5N A;  2K16 A;  4X3G A;  2KGG A;  1LDJ B;  1MM2 A;  3DPL R;  5H1V A;  1G25 A;  5FER A;  3C5K A;  3GV4 A;  3SHB A;  5B79 A;  4LJN A;  2CKL A;  4A4B A;  5B8D A;  4S3O C;  2YW8 A;  4FJC A;  2QJ0 A;  4AUQ B;  1WEN A;  2RSD A;  2MNY A;  2L5U A;  4IC3 A;  4NN2 A;  3N9L A;  3U5M A;  4WZ2 A;  4FIP A;  4A49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...