2L0BA

Solution nmr structure of zinc finger domain of e3 ubiquitin-protein ligase praja-1 from homo sapiens, northeast structural genomics consortium (nesg) target hr4710b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase Praja-1
publication title Solution structure of zinc finger domain of E3 ubiquitin-protein ligase protein praja-1 from Homo sapiens, northeast structural genomics consortium (NESG) target HR4710B
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 17
structure length 91
sequence length 91
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l0bA00
3MHHA 2ECVA 4X3GA 2AN6A 2K1JA 3LQJA 4UP0A 1JM7B 4ZUXU 5EYAF 1HYIA 2E6SA 1WEVA 2VJEB 2EA6A 4PPEA 3ZPVE 5J3XA 2LRIC 2LXPC 3I2DA 2LGVA 4O64A 4R7EA 2G43A 1DVPA 5FEYA 2YURA 2QICA 1Z6UA 2K17A 2RI7A 5G05B 4AVXA 2H0DA 2YSJA 4A4CA 4AUQB 1WEUA 3NG2A 4TKPB 1Z2QA 2UZGA 2KIZA 4YABA 4L7XA 2KU3A 2MUMA 3DQVR 3ZYQA 3GL6A 2LXHC 5TABA 2KREA 2F6NA 4LKAA 2YHOA 1X4IA 4GNDA 3V43A 3KQIA 5D1LB 3C5KA 4YBMA 5TBNA 4ZQLA 3L1XA 5G04B 4QF2A 2CSZA 2RSDA 4IC3A 4V3LC 5B8DA 5DKAA 2F6JA 2VPDA 1X4UA 3FL2A 2M6MA 2K4DA 4YBTA 4MSXA 5KH9A 2F42A 4BBQA 3SOWA 2Y1NA 3T7LA 2CT2A 2YU4A 3O7AA 3ZTGA 5FERA 3N9QA 2FSAA 3U5MA 1T1HA 4R2YA 5B78A 2LGGA 2FUIA 2LQ6A 2PUYA 3O37A 2KWOA 5B76A 2VPBA 3HCUA 4FO9A 2G6QA 3ZVZB 4LJNA 4UI9B 2CSYA 4I7BA 1MM2A 2KWKA 1F62A 4AYCA 5FB0A 4LADB 5LKZA 2G45A 5D1KB 2ECGA 2D8SA 5B75A 3HCSA 3T6RA 5KH3A 2LGKA 1VD4A 3HTKC 3M62A 1WEQA 2VJFA 2C2LA 1U6GB 2L75A 5C11A 5TDRA 2ECNA 5JG6A 1XWHA 2YT5A 5FB1A 1BORA 4P5OB 3HCTA 3PURA 4LK9A 5LKXA 1FBVA 2YQMA 2QJ0A 3SHBA 3ASLA 3ZNIA 2ECTA 2ZETC 2VP7A 2YUCA 2ECWA 1VYXA 3GV4A 4GB0A 1WEMA 2LV9A 4QF3A 3N9OA 2VNFA 4F52B 3QZVA 3EB6A 3RPGC 4CCGX 1WENA 4N3WA 2CKLB 3N9LA 2MNZA 2YREA 2I50A 4YADA 3LQHA 5DINA 3KNVA 4FJCA 2NAAA 1WILA 4AP4A 3U5NA 3KV6A 5LKTA 3C6WA 1WGMA 1WIMA 1JM7A 1LDJB 2Y1MA 2JMDA 3IHPA 2EGPA 2C2VS 5H1VA 2L80A 3O34A 2VJEA 4WA6A 3PUQA 2KE1A 5TDWA 2PNXA 4BHWA 4I7DA 1Z60A 2L5UA 5B79A 2KWNA 2H0DB 2MT5A 3M63A 3N9MA 3RPGB 1X4JA 4Q6FA 2FUUA 2KR4A 2YHNA 4XI1A 5AITA 3MHSA 1LDKC 2JRJA 4FIPA 4W4UA 1CHCA 2JMIA 3VK6A 2KFTA 2MNYA 1WEOA 2KGIA 5C13A 2CKLA 4B7YC 2ECIA 2E6RA 1HYJA 1K2FA 2M3HA 4A0CD 4NN2A 4C9ZA 4YBSA 2LN0A 5D1MB 5AIUA 1E4UA 1MM3A 2BAYA 1WFKA 2HYED 3U5PA 4A49A 4GNFA 5G0FA 5H9MA 3L1ZB 3ZPV1 4CA1A 2YW8A 1FP0A 1RMDA 3LQIA 2MIQA 4L58A 4S3OC 2MD7B 3M99A 2DX8A 4YAXA 2QIZA 4LLBA 3SOUA 4B86C 2L43A 2MA6A 3U5OA 1JOCA 3O35A 3N9NA 2M85A 4I7CA 2LDRA 2MA5A 3DPLR 1V87A 4MVTA 5H1UA 2K16A 4YC9A 4WZ2A 2MD8C 5I3LA 4AYCB 3N9PA 3O33A 3KV5A 3ZVYA 5LKUA 5B77A 5LCWB 2EODA 1ZBDB 2KWJA 2VPGA 1N87A 3LRQA 2OXQC 4WZ3B 2VJFB 2IDAA 2LGLA 2VPEA 4IC2A 2HDPA 2XB1A 2KGGA 3O36A 2YQLA 4V3KC 3O70A 2L0BA 4GNGA 3RTRB 3L11A 4GNEA 2ECJA 2YYRA 4WZ0A 1WEEA 4ZDTA 4N4FA 1IYMA 4S3OB 2XEUA 2Y43A 1WESA 1WEPA 4R8PK 2JMJA 4A4BA 2YSMA 5TRBA 3EB5A 1G25A 3PHDA 1WE9A 1WEWA 2M1RA 4UP5A 2KYUA 4FK5A 4PTBA 4YATA 5H1TA 3SOXA 1VFYA 5KH7A
chains in the Genus database with same CATH superfamily
3MHHA 2ECVA 4X3GA 2AN6A 5SVIB 2K1JA 3LQJA 3H7HA 4UP0A 1JM7B 4ZUXU 5EYAF 1HYIA 2E6SA 3FANA 1WEVA 2VJEB 2EA6A 4PPEA 3ZPVE 5J3XA 2LRIC 2LXPC 3I2DA 2LGVA 3LVQE 4O64A 4R7EA 2G43A 1DVPA 5FEYA 2YURA 2QICA 1Z6UA 2K17A 2RI7A 5G05B 4AVXA 2H0DA 2YSJA 2EGMA 4A4CA 4AUQB 1WEUA 3NG2A 4TKPB 1Z2QA 2UZGA 2KIZA 4YABA 4L7XA 2KU3A 2MUMA 3DQVR 3ZYQA 3GL6A 2LXHC 5TABA 2KREA 2F6NA 3MDBC 4LKAA 2FFWA 2YHOA 1X4IA 4GNDA 3V43A 3KQIA 2XOYA 2D8UA 5D1LB 3C5KA 4YBMA 5TBNA 4ZQLA 3L1XA 5G04B 4QF2A 2CSZA 2RSDA 4IC3A 4V3LC 5B8DA 5DKAA 2F6JA 2VPDA 1X4UA 3FL2A 2M6MA 3T9KA 2K4DA 4YBTA 4MSXA 2DSMA 5KH9A 2F42A 4BBQA 3SOWA 2Y1NA 2JM3A 2L7PA 3T7LA 2CT2A 2YU4A 3O7AA 5SVXA 3ZTGA 5FERA 3N9QA 2FSAA 3U5MA 1T1HA 4R2YA 3FJUB 5B78A 2LGGA 2FUIA 2LQ6A 2PUYA 3O37A 3DDTA 2KWOA 5B76A 2IQJA 2VPBA 3HCUA 4FO9A 2G6QA 3ZVZB 4LJNA 4UI9B 3DWDA 2CSYA 4I7BA 1MM2A 2KWKA 1F62A 3FEHA 4AYCA 2M13A 5FB0A 3Q1DA 4LADB 5LKZA 2G45A 5D1KB 2ECGA 2D8SA 5B75A 3HCSA 3T6RA 5KH3A 2LGKA 1VD4A 2B0OE 3HTKC 3M62A 2CSVA 1WEQA 2VJFA 2C2LA 1U6GB 2L75A 3FM8C 5C11A 5TDRA 2MKEA 2ECNA 2CRWA 5JG6A 1XWHA 2YT5A 5FB1A 1BORA 4P5OB 4H9DA 3HCTA 3PURA 2XOCA 4LK9A 1FBVA 5LKXA 2YQMA 2QJ0A 3SHBA 3ASLA 3ZNIA 2ECTA 2ZETC 2VP7A 2YUCA 2ECWA 1VYXA 3GV4A 4GB0A 1WEMA 2LV9A 4QF3A 3N9OA 2VNFA 4F52B 3QZVA 2E61A 3EB6A 3RPGC 2FD4A 4CCGX 1WENA 4O62A 4N3WA 3KDEC 2CKLB 3N9LA 2MNZA 1MBMA 2YREA 2I50A 4YADA 2KKXA 3LQHA 5DINA 3KNVA 4FJCA 2NAAA 1WILA 4AP4A 3U5NA 3KV6A 5LKTA 5SVIA 2EXUA 4F1PA 3C6WA 1WGMA 1WIMA 2YVRA 1JM7A 1LDJB 2Y1MA 2JMDA 3IHPA 2EGPA 2C2VS 3PLWA 5H1VA 4OGEA 2L80A 3O34A 2VJEA 3FAOA 2P57A 4WA6A 3PUQA 2KE1A 5TDWA 2PNXA 3M7KA 4BHWA 4I7DA 1Z60A 2L5UA 5B79A 2KWNA 4Z0RA 2H0DB 2MT5A 2XOZA 3M63A 3N9MA 3RPGB 1X4JA 4Q6FA 2FUUA 2KR4A 2YHNA 4XI1A 1DCQA 5AITA 3MHSA 3SUBA 2LAUA 1LDKC 2JRJA 4FIPA 4W4UA 1CHCA 2JMIA 3VK6A 2KFTA 2MNYA 2CRRA 1WEOA 2KGIA 5C13A 2CKLA 4B7YC 2OWAA 2ECIA 2E6RA 1HYJA 1K2FA 2M3HA 4A0CD 4NN2A 4C9ZA 4YBSA 2LN0A 5D1MB 5AIUA 1E4UA 1MM3A 2BAYA 1WFKA 2HYED 3U5PA 2DJAA 4A49A 4GNFA 3LJUX 5G0FA 5H9MA 3LDYA 3L1ZB 3ZPV1 4CA1A 2YW8A 1FP0A 1RMDA 3LQIA 2MIQA 4L58A 4S3OC 2MD7B 3M99A 2DX8A 4YAXA 2QIZA 4LLBA 3SOUA 4B86C 2L43A 2MA6A 3U5OA 1JOCA 3O35A 3N9NA 2M85A 3JUEA 4I7CA 2KKYA 2LDRA 2MA5A 3DPLR 1V87A 3LVRE 4MVTA 5H1UA 2K16A 4YC9A 5SVYA 4WZ2A 2MD8C 5I3LA 4AYCB 3N9PA 3O33A 3KV5A 3ZVYA 5LKUA 5B77A 5LCWB 2EODA 1ZBDB 2KWJA 2VPGA 1N87A 3LRQA 2OXQC 4WZ3B 2CONA 2VJFB 2IDAA 2LGLA 2RR4A 2VPEA 4IC2A 2HDPA 2XB1A 2KGGA 3O36A 2YQLA 4V3KC 2XP0A 3O70A 2L0BA 4GNGA 3RTRB 3L11A 4GNEA 2ECJA 2YYRA 4WZ0A 1WEEA 4ZDTA 4N4FA 1IYMA 4S3OB 2XEUA 2Y43A 1WESA 2JUNA 1WEPA 4R8PK 2JMJA 4A4BA 2YSMA 5TRBA 4OGCA 3E2DA 3EB5A 1G25A 3PHDA 1WE9A 1WEWA 3O47A 2M1RA 4UP5A 2KYUA 5K3QA 4FK5A 4QQ4A 4Z0OA 4PTBA 4YATA 5H1TA 3SOXA 1VFYA 5KH7A
chains in the Genus database with same CATH topology
3MHHA 2ECVA 4X3GA 2AN6A 2K1JA 3LQJA 4UP0A 1JM7B 4ZUXU 5EYAF 1HYIA 2E6SA 1WEVA 2VJEB 2EA6A 4PPEA 3ZPVE 5J3XA 2LRIC 2LXPC 3I2DA 2LGVA 4O64A 4R7EA 2G43A 1DVPA 5FEYA 2YURA 2QICA 1Z6UA 2K17A 2RI7A 5G05B 4AVXA 2H0DA 2YSJA 4A4CA 4AUQB 1WEUA 3NG2A 4TKPB 1Z2QA 2UZGA 2KIZA 4YABA 4L7XA 2KU3A 2MUMA 3DQVR 3ZYQA 3GL6A 2LXHC 5TABA 2KREA 2F6NA 4LKAA 2YHOA 1X4IA 4GNDA 3V43A 3KQIA 5D1LB 3C5KA 4YBMA 5TBNA 4ZQLA 3L1XA 5G04B 4QF2A 2CSZA 2RSDA 4IC3A 4V3LC 5B8DA 5DKAA 2F6JA 2VPDA 1X4UA 3FL2A 2M6MA 2K4DA 4YBTA 4MSXA 5KH9A 2F42A 4BBQA 3SOWA 2Y1NA 3T7LA 2CT2A 2YU4A 3O7AA 3ZTGA 5FERA 3N9QA 2FSAA 3U5MA 1T1HA 4R2YA 5B78A 2LGGA 2FUIA 2LQ6A 2PUYA 3O37A 2KWOA 5B76A 2VPBA 3HCUA 4FO9A 2G6QA 3ZVZB 4LJNA 4UI9B 2CSYA 4I7BA 1MM2A 2KWKA 1F62A 4AYCA 5FB0A 4LADB 5LKZA 2G45A 5D1KB 2ECGA 2D8SA 5B75A 3HCSA 3T6RA 5KH3A 2LGKA 1VD4A 3HTKC 3M62A 1WEQA 2VJFA 2C2LA 1U6GB 2L75A 5C11A 5TDRA 2ECNA 5JG6A 1XWHA 2YT5A 5FB1A 1BORA 4P5OB 3HCTA 3PURA 4LK9A 5LKXA 1FBVA 2YQMA 2QJ0A 3SHBA 3ASLA 3ZNIA 2ECTA 2ZETC 2VP7A 2YUCA 2ECWA 1VYXA 3GV4A 4GB0A 1WEMA 2LV9A 4QF3A 3N9OA 2VNFA 4F52B 3QZVA 3EB6A 3RPGC 4CCGX 1WENA 4N3WA 2CKLB 3N9LA 2MNZA 2YREA 2I50A 4YADA 3LQHA 5DINA 3KNVA 4FJCA 2NAAA 1WILA 4AP4A 3U5NA 3KV6A 5LKTA 3C6WA 1WGMA 1WIMA 1JM7A 1LDJB 2Y1MA 2JMDA 3IHPA 2EGPA 2C2VS 5H1VA 2L80A 3O34A 2VJEA 4WA6A 3PUQA 2KE1A 5TDWA 2PNXA 4BHWA 4I7DA 1Z60A 2L5UA 5B79A 2KWNA 2H0DB 2MT5A 3M63A 3N9MA 3RPGB 1X4JA 4Q6FA 2FUUA 2KR4A 2YHNA 4XI1A 5AITA 3MHSA 1LDKC 2JRJA 4FIPA 4W4UA 1CHCA 2JMIA 3VK6A 2KFTA 2MNYA 1WEOA 2KGIA 5C13A 2CKLA 4B7YC 2ECIA 2E6RA 1HYJA 1K2FA 2M3HA 4A0CD 4NN2A 4C9ZA 4YBSA 2LN0A 5D1MB 5AIUA 1E4UA 1MM3A 2BAYA 1WFKA 2HYED 3U5PA 4A49A 4GNFA 5G0FA 5H9MA 3L1ZB 3ZPV1 4CA1A 2YW8A 1FP0A 1RMDA 3LQIA 2MIQA 4L58A 4S3OC 2MD7B 3M99A 2DX8A 4YAXA 2QIZA 4LLBA 3SOUA 4B86C 2L43A 2MA6A 3U5OA 1JOCA 3O35A 3N9NA 2M85A 4I7CA 2LDRA 2MA5A 3DPLR 1V87A 4MVTA 5H1UA 2K16A 4YC9A 4WZ2A 2MD8C 5I3LA 4AYCB 3N9PA 3O33A 3KV5A 3ZVYA 5LKUA 5B77A 5LCWB 2EODA 1ZBDB 2KWJA 2VPGA 1N87A 3LRQA 2OXQC 4WZ3B 2VJFB 2IDAA 2LGLA 2VPEA 4IC2A 2HDPA 2XB1A 2KGGA 3O36A 2YQLA 4V3KC 3O70A 2L0BA 4GNGA 3RTRB 3L11A 4GNEA 2ECJA 2YYRA 4WZ0A 1WEEA 4ZDTA 4N4FA 1IYMA 4S3OB 2XEUA 2Y43A 1WESA 1WEPA 4R8PK 2JMJA 4A4BA 2YSMA 5TRBA 3EB5A 1G25A 3PHDA 1WE9A 1WEWA 2M1RA 4UP5A 2KYUA 4FK5A 4PTBA 4YATA 5H1TA 3SOXA 1VFYA 5KH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  2ECV A;  4X3G A;  2AN6 A;  2K1J A;  3LQJ A;  4UP0 A;  1JM7 B;  4ZUX U;  5EYA F;  1HYI A;  2E6S A;  1WEV A;  2VJE B;  2EA6 A;  4PPE A;  3ZPV E;  5J3X A;  2LRI C;  2LXP C;  3I2D A;  2LGV A;  4O64 A;  4R7E A;  2G43 A;  1DVP A;  5FEY A;  2YUR A;  2QIC A;  1Z6U A;  2K17 A;  2RI7 A;  5G05 B;  4AVX A;  2H0D A;  2YSJ A;  4A4C A;  4AUQ B;  1WEU A;  3NG2 A;  4TKP B;  1Z2Q A;  2UZG A;  2KIZ A;  4YAB A;  4L7X A;  2KU3 A;  2MUM A;  3DQV R;  3ZYQ A;  3GL6 A;  2LXH C;  5TAB A;  2KRE A;  2F6N A;  4LKA A;  2YHO A;  1X4I A;  4GND A;  3V43 A;  3KQI A;  5D1L B;  3C5K A;  4YBM A;  5TBN A;  4ZQL A;  3L1X A;  5G04 B;  4QF2 A;  2CSZ A;  2RSD A;  4IC3 A;  4V3L C;  5B8D A;  5DKA A;  2F6J A;  2VPD A;  1X4U A;  3FL2 A;  2M6M A;  2K4D A;  4YBT A;  4MSX A;  5KH9 A;  2F42 A;  4BBQ A;  3SOW A;  2Y1N A;  3T7L A;  2CT2 A;  2YU4 A;  3O7A A;  3ZTG A;  5FER A;  3N9Q A;  2FSA A;  3U5M A;  1T1H A;  4R2Y A;  5B78 A;  2LGG A;  2FUI A;  2LQ6 A;  2PUY A;  3O37 A;  2KWO A;  5B76 A;  2VPB A;  3HCU A;  4FO9 A;  2G6Q A;  3ZVZ B;  4LJN A;  4UI9 B;  2CSY A;  4I7B A;  1MM2 A;  2KWK A;  1F62 A;  4AYC A;  5FB0 A;  4LAD B;  5LKZ A;  2G45 A;  5D1K B;  2ECG A;  2D8S A;  5B75 A;  3HCS A;  3T6R A;  5KH3 A;  2LGK A;  1VD4 A;  3HTK C;  3M62 A;  1WEQ A;  2VJF A;  2C2L A;  1U6G B;  2L75 A;  5C11 A;  5TDR A;  2ECN A;  5JG6 A;  1XWH A;  2YT5 A;  5FB1 A;  1BOR A;  4P5O B;  3HCT A;  3PUR A;  4LK9 A;  5LKX A;  1FBV A;  2YQM A;  2QJ0 A;  3SHB A;  3ASL A;  3ZNI A;  2ECT A;  2ZET C;  2VP7 A;  2YUC A;  2ECW A;  1VYX A;  3GV4 A;  4GB0 A;  1WEM A;  2LV9 A;  4QF3 A;  3N9O A;  2VNF A;  4F52 B;  3QZV A;  3EB6 A;  3RPG C;  4CCG X;  1WEN A;  4N3W A;  2CKL B;  3N9L A;  2MNZ A;  2YRE A;  2I50 A;  4YAD A;  3LQH A;  5DIN A;  3KNV A;  4FJC A;  2NAA A;  1WIL A;  4AP4 A;  3U5N A;  3KV6 A;  5LKT A;  3C6W A;  1WGM A;  1WIM A;  1JM7 A;  1LDJ B;  2Y1M A;  2JMD A;  3IHP A;  2EGP A;  2C2V S;  5H1V A;  2L80 A;  3O34 A;  2VJE A;  4WA6 A;  3PUQ A;  2KE1 A;  5TDW A;  2PNX A;  4BHW A;  4I7D A;  1Z60 A;  2L5U A;  5B79 A;  2KWN A;  2H0D B;  2MT5 A;  3M63 A;  3N9M A;  3RPG B;  1X4J A;  4Q6F A;  2FUU A;  2KR4 A;  2YHN A;  4XI1 A;  5AIT A;  3MHS A;  1LDK C;  2JRJ A;  4FIP A;  4W4U A;  1CHC A;  2JMI A;  3VK6 A;  2KFT A;  2MNY A;  1WEO A;  2KGI A;  5C13 A;  2CKL A;  4B7Y C;  2ECI A;  2E6R A;  1HYJ A;  1K2F A;  2M3H A;  4A0C D;  4NN2 A;  4C9Z A;  4YBS A;  2LN0 A;  5D1M B;  5AIU A;  1E4U A;  1MM3 A;  2BAY A;  1WFK A;  2HYE D;  3U5P A;  4A49 A;  4GNF A;  5G0F A;  5H9M A;  3L1Z B;  3ZPV 1;  4CA1 A;  2YW8 A;  1FP0 A;  1RMD A;  3LQI A;  2MIQ A;  4L58 A;  4S3O C;  2MD7 B;  3M99 A;  2DX8 A;  4YAX A;  2QIZ A;  4LLB A;  3SOU A;  4B86 C;  2L43 A;  2MA6 A;  3U5O A;  1JOC A;  3O35 A;  3N9N A;  2M85 A;  4I7C A;  2LDR A;  2MA5 A;  3DPL R;  1V87 A;  4MVT A;  5H1U A;  2K16 A;  4YC9 A;  4WZ2 A;  2MD8 C;  5I3L A;  4AYC B;  3N9P A;  3O33 A;  3KV5 A;  3ZVY A;  5LKU A;  5B77 A;  5LCW B;  2EOD A;  1ZBD B;  2KWJ A;  2VPG A;  1N87 A;  3LRQ A;  2OXQ C;  4WZ3 B;  2VJF B;  2IDA A;  2LGL A;  2VPE A;  4IC2 A;  2HDP A;  2XB1 A;  2KGG A;  3O36 A;  2YQL A;  4V3K C;  3O70 A;  2L0B A;  4GNG A;  3RTR B;  3L11 A;  4GNE A;  2ECJ A;  2YYR A;  4WZ0 A;  1WEE A;  4ZDT A;  4N4F A;  1IYM A;  4S3O B;  2XEU A;  2Y43 A;  1WES A;  1WEP A;  4R8P K;  2JMJ A;  4A4B A;  2YSM A;  5TRB A;  3EB5 A;  1G25 A;  3PHD A;  1WE9 A;  1WEW A;  2M1R A;  4UP5 A;  2KYU A;  4FK5 A;  4PTB A;  4YAT A;  5H1T A;  3SOX A;  1VFY A;  5KH7 A; 
#chains in the Genus database with same CATH topology
 3MHH A;  2ECV A;  4X3G A;  2AN6 A;  5SVI B;  2K1J A;  3LQJ A;  3H7H A;  4UP0 A;  1JM7 B;  4ZUX U;  5EYA F;  1HYI A;  2E6S A;  3FAN A;  1WEV A;  2VJE B;  2EA6 A;  4PPE A;  3ZPV E;  5J3X A;  2LRI C;  2LXP C;  3I2D A;  2LGV A;  3LVQ E;  4O64 A;  4R7E A;  2G43 A;  1DVP A;  5FEY A;  2YUR A;  2QIC A;  1Z6U A;  2K17 A;  2RI7 A;  5G05 B;  4AVX A;  2H0D A;  2YSJ A;  2EGM A;  4A4C A;  4AUQ B;  1WEU A;  3NG2 A;  4TKP B;  1Z2Q A;  2UZG A;  2KIZ A;  4YAB A;  4L7X A;  2KU3 A;  2MUM A;  3DQV R;  3ZYQ A;  3GL6 A;  2LXH C;  5TAB A;  2KRE A;  2F6N A;  3MDB C;  4LKA A;  2FFW A;  2YHO A;  1X4I A;  4GND A;  3V43 A;  3KQI A;  2XOY A;  2D8U A;  5D1L B;  3C5K A;  4YBM A;  5TBN A;  4ZQL A;  3L1X A;  5G04 B;  4QF2 A;  2CSZ A;  2RSD A;  4IC3 A;  4V3L C;  5B8D A;  5DKA A;  2F6J A;  2VPD A;  1X4U A;  3FL2 A;  2M6M A;  3T9K A;  2K4D A;  4YBT A;  4MSX A;  2DSM A;  5KH9 A;  2F42 A;  4BBQ A;  3SOW A;  2Y1N A;  2JM3 A;  2L7P A;  3T7L A;  2CT2 A;  2YU4 A;  3O7A A;  5SVX A;  3ZTG A;  5FER A;  3N9Q A;  2FSA A;  3U5M A;  1T1H A;  4R2Y A;  3FJU B;  5B78 A;  2LGG A;  2FUI A;  2LQ6 A;  2PUY A;  3O37 A;  3DDT A;  2KWO A;  5B76 A;  2IQJ A;  2VPB A;  3HCU A;  4FO9 A;  2G6Q A;  3ZVZ B;  4LJN A;  4UI9 B;  3DWD A;  2CSY A;  4I7B A;  1MM2 A;  2KWK A;  1F62 A;  3FEH A;  4AYC A;  2M13 A;  5FB0 A;  3Q1D A;  4LAD B;  5LKZ A;  2G45 A;  5D1K B;  2ECG A;  2D8S A;  5B75 A;  3HCS A;  3T6R A;  5KH3 A;  2LGK A;  1VD4 A;  2B0O E;  3HTK C;  3M62 A;  2CSV A;  1WEQ A;  2VJF A;  2C2L A;  1U6G B;  2L75 A;  3FM8 C;  5C11 A;  5TDR A;  2MKE A;  2ECN A;  2CRW A;  5JG6 A;  1XWH A;  2YT5 A;  5FB1 A;  1BOR A;  4P5O B;  4H9D A;  3HCT A;  3PUR A;  2XOC A;  4LK9 A;  1FBV A;  5LKX A;  2YQM A;  2QJ0 A;  3SHB A;  3ASL A;  3ZNI A;  2ECT A;  2ZET C;  2VP7 A;  2YUC A;  2ECW A;  1VYX A;  3GV4 A;  4GB0 A;  1WEM A;  2LV9 A;  4QF3 A;  3N9O A;  2VNF A;  4F52 B;  3QZV A;  2E61 A;  3EB6 A;  3RPG C;  2FD4 A;  4CCG X;  1WEN A;  4O62 A;  4N3W A;  3KDE C;  2CKL B;  3N9L A;  2MNZ A;  1MBM A;  2YRE A;  2I50 A;  4YAD A;  2KKX A;  3LQH A;  5DIN A;  3KNV A;  4FJC A;  2NAA A;  1WIL A;  4AP4 A;  3U5N A;  3KV6 A;  5LKT A;  5SVI A;  2EXU A;  4F1P A;  3C6W A;  1WGM A;  1WIM A;  2YVR A;  1JM7 A;  1LDJ B;  2Y1M A;  2JMD A;  3IHP A;  2EGP A;  2C2V S;  3PLW A;  5H1V A;  4OGE A;  2L80 A;  3O34 A;  2VJE A;  3FAO A;  2P57 A;  4WA6 A;  3PUQ A;  2KE1 A;  5TDW A;  2PNX A;  3M7K A;  4BHW A;  4I7D A;  1Z60 A;  2L5U A;  5B79 A;  2KWN A;  4Z0R A;  2H0D B;  2MT5 A;  2XOZ A;  3M63 A;  3N9M A;  3RPG B;  1X4J A;  4Q6F A;  2FUU A;  2KR4 A;  2YHN A;  4XI1 A;  1DCQ A;  5AIT A;  3MHS A;  3SUB A;  2LAU A;  1LDK C;  2JRJ A;  4FIP A;  4W4U A;  1CHC A;  2JMI A;  3VK6 A;  2KFT A;  2MNY A;  2CRR A;  1WEO A;  2KGI A;  5C13 A;  2CKL A;  4B7Y C;  2OWA A;  2ECI A;  2E6R A;  1HYJ A;  1K2F A;  2M3H A;  4A0C D;  4NN2 A;  4C9Z A;  4YBS A;  2LN0 A;  5D1M B;  5AIU A;  1E4U A;  1MM3 A;  2BAY A;  1WFK A;  2HYE D;  3U5P A;  2DJA A;  4A49 A;  4GNF A;  3LJU X;  5G0F A;  5H9M A;  3LDY A;  3L1Z B;  3ZPV 1;  4CA1 A;  2YW8 A;  1FP0 A;  1RMD A;  3LQI A;  2MIQ A;  4L58 A;  4S3O C;  2MD7 B;  3M99 A;  2DX8 A;  4YAX A;  2QIZ A;  4LLB A;  3SOU A;  4B86 C;  2L43 A;  2MA6 A;  3U5O A;  1JOC A;  3O35 A;  3N9N A;  2M85 A;  3JUE A;  4I7C A;  2KKY A;  2LDR A;  2MA5 A;  3DPL R;  1V87 A;  3LVR E;  4MVT A;  5H1U A;  2K16 A;  4YC9 A;  5SVY A;  4WZ2 A;  2MD8 C;  5I3L A;  4AYC B;  3N9P A;  3O33 A;  3KV5 A;  3ZVY A;  5LKU A;  5B77 A;  5LCW B;  2EOD A;  1ZBD B;  2KWJ A;  2VPG A;  1N87 A;  3LRQ A;  2OXQ C;  4WZ3 B;  2CON A;  2VJF B;  2IDA A;  2LGL A;  2RR4 A;  2VPE A;  4IC2 A;  2HDP A;  2XB1 A;  2KGG A;  3O36 A;  2YQL A;  4V3K C;  2XP0 A;  3O70 A;  2L0B A;  4GNG A;  3RTR B;  3L11 A;  4GNE A;  2ECJ A;  2YYR A;  4WZ0 A;  1WEE A;  4ZDT A;  4N4F A;  1IYM A;  4S3O B;  2XEU A;  2Y43 A;  1WES A;  2JUN A;  1WEP A;  4R8P K;  2JMJ A;  4A4B A;  2YSM A;  5TRB A;  4OGC A;  3E2D A;  3EB5 A;  1G25 A;  3PHD A;  1WE9 A;  1WEW A;  3O47 A;  2M1R A;  4UP5 A;  2KYU A;  5K3Q A;  4FK5 A;  4QQ4 A;  4Z0O A;  4PTB A;  4YAT A;  5H1T A;  3SOX A;  1VFY A;  5KH7 A; 
#chains in the Genus database with same CATH homology
 3MHH A;  2ECV A;  4X3G A;  2AN6 A;  2K1J A;  3LQJ A;  4UP0 A;  1JM7 B;  4ZUX U;  5EYA F;  1HYI A;  2E6S A;  1WEV A;  2VJE B;  2EA6 A;  4PPE A;  3ZPV E;  5J3X A;  2LRI C;  2LXP C;  3I2D A;  2LGV A;  4O64 A;  4R7E A;  2G43 A;  1DVP A;  5FEY A;  2YUR A;  2QIC A;  1Z6U A;  2K17 A;  2RI7 A;  5G05 B;  4AVX A;  2H0D A;  2YSJ A;  4A4C A;  4AUQ B;  1WEU A;  3NG2 A;  4TKP B;  1Z2Q A;  2UZG A;  2KIZ A;  4YAB A;  4L7X A;  2KU3 A;  2MUM A;  3DQV R;  3ZYQ A;  3GL6 A;  2LXH C;  5TAB A;  2KRE A;  2F6N A;  4LKA A;  2YHO A;  1X4I A;  4GND A;  3V43 A;  3KQI A;  5D1L B;  3C5K A;  4YBM A;  5TBN A;  4ZQL A;  3L1X A;  5G04 B;  4QF2 A;  2CSZ A;  2RSD A;  4IC3 A;  4V3L C;  5B8D A;  5DKA A;  2F6J A;  2VPD A;  1X4U A;  3FL2 A;  2M6M A;  2K4D A;  4YBT A;  4MSX A;  5KH9 A;  2F42 A;  4BBQ A;  3SOW A;  2Y1N A;  3T7L A;  2CT2 A;  2YU4 A;  3O7A A;  3ZTG A;  5FER A;  3N9Q A;  2FSA A;  3U5M A;  1T1H A;  4R2Y A;  5B78 A;  2LGG A;  2FUI A;  2LQ6 A;  2PUY A;  3O37 A;  2KWO A;  5B76 A;  2VPB A;  3HCU A;  4FO9 A;  2G6Q A;  3ZVZ B;  4LJN A;  4UI9 B;  2CSY A;  4I7B A;  1MM2 A;  2KWK A;  1F62 A;  4AYC A;  5FB0 A;  4LAD B;  5LKZ A;  2G45 A;  5D1K B;  2ECG A;  2D8S A;  5B75 A;  3HCS A;  3T6R A;  5KH3 A;  2LGK A;  1VD4 A;  3HTK C;  3M62 A;  1WEQ A;  2VJF A;  2C2L A;  1U6G B;  2L75 A;  5C11 A;  5TDR A;  2ECN A;  5JG6 A;  1XWH A;  2YT5 A;  5FB1 A;  1BOR A;  4P5O B;  3HCT A;  3PUR A;  4LK9 A;  5LKX A;  1FBV A;  2YQM A;  2QJ0 A;  3SHB A;  3ASL A;  3ZNI A;  2ECT A;  2ZET C;  2VP7 A;  2YUC A;  2ECW A;  1VYX A;  3GV4 A;  4GB0 A;  1WEM A;  2LV9 A;  4QF3 A;  3N9O A;  2VNF A;  4F52 B;  3QZV A;  3EB6 A;  3RPG C;  4CCG X;  1WEN A;  4N3W A;  2CKL B;  3N9L A;  2MNZ A;  2YRE A;  2I50 A;  4YAD A;  3LQH A;  5DIN A;  3KNV A;  4FJC A;  2NAA A;  1WIL A;  4AP4 A;  3U5N A;  3KV6 A;  5LKT A;  3C6W A;  1WGM A;  1WIM A;  1JM7 A;  1LDJ B;  2Y1M A;  2JMD A;  3IHP A;  2EGP A;  2C2V S;  5H1V A;  2L80 A;  3O34 A;  2VJE A;  4WA6 A;  3PUQ A;  2KE1 A;  5TDW A;  2PNX A;  4BHW A;  4I7D A;  1Z60 A;  2L5U A;  5B79 A;  2KWN A;  2H0D B;  2MT5 A;  3M63 A;  3N9M A;  3RPG B;  1X4J A;  4Q6F A;  2FUU A;  2KR4 A;  2YHN A;  4XI1 A;  5AIT A;  3MHS A;  1LDK C;  2JRJ A;  4FIP A;  4W4U A;  1CHC A;  2JMI A;  3VK6 A;  2KFT A;  2MNY A;  1WEO A;  2KGI A;  5C13 A;  2CKL A;  4B7Y C;  2ECI A;  2E6R A;  1HYJ A;  1K2F A;  2M3H A;  4A0C D;  4NN2 A;  4C9Z A;  4YBS A;  2LN0 A;  5D1M B;  5AIU A;  1E4U A;  1MM3 A;  2BAY A;  1WFK A;  2HYE D;  3U5P A;  4A49 A;  4GNF A;  5G0F A;  5H9M A;  3L1Z B;  3ZPV 1;  4CA1 A;  2YW8 A;  1FP0 A;  1RMD A;  3LQI A;  2MIQ A;  4L58 A;  4S3O C;  2MD7 B;  3M99 A;  2DX8 A;  4YAX A;  2QIZ A;  4LLB A;  3SOU A;  4B86 C;  2L43 A;  2MA6 A;  3U5O A;  1JOC A;  3O35 A;  3N9N A;  2M85 A;  4I7C A;  2LDR A;  2MA5 A;  3DPL R;  1V87 A;  4MVT A;  5H1U A;  2K16 A;  4YC9 A;  4WZ2 A;  2MD8 C;  5I3L A;  4AYC B;  3N9P A;  3O33 A;  3KV5 A;  3ZVY A;  5LKU A;  5B77 A;  5LCW B;  2EOD A;  1ZBD B;  2KWJ A;  2VPG A;  1N87 A;  3LRQ A;  2OXQ C;  4WZ3 B;  2VJF B;  2IDA A;  2LGL A;  2VPE A;  4IC2 A;  2HDP A;  2XB1 A;  2KGG A;  3O36 A;  2YQL A;  4V3K C;  3O70 A;  2L0B A;  4GNG A;  3RTR B;  3L11 A;  4GNE A;  2ECJ A;  2YYR A;  4WZ0 A;  1WEE A;  4ZDT A;  4N4F A;  1IYM A;  4S3O B;  2XEU A;  2Y43 A;  1WES A;  1WEP A;  4R8P K;  2JMJ A;  4A4B A;  2YSM A;  5TRB A;  3EB5 A;  1G25 A;  3PHD A;  1WE9 A;  1WEW A;  2M1R A;  4UP5 A;  2KYU A;  4FK5 A;  4PTB A;  4YAT A;  5H1T A;  3SOX A;  1VFY A;  5KH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...