2L0BA

Solution nmr structure of zinc finger domain of e3 ubiquitin-protein ligase praja-1 from homo sapiens, northeast structural genomics consortium (nesg) target hr4710b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of zinc finger domain of E3 ubiquitin-protein ligase protein praja-1 from Homo sapiens, northeast structural genomics consortium (NESG) target HR4710B
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase Praja-1
total genus 17
structure length 91
sequence length 91
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l0bA00
2ECTA 2ECIA 1VD4A 5H1UA 2RI7A 3ZNIA 2LGLA 4GNEA 2JMJA 2LGGA 2LXHC 3RPGC 2KWNA 4FJCA 2VNFA 4N3WA 2MD7B 4A0CD 1X4IA 3O37A 2KREA 4ZDTA 5D1MB 2M6MA 2FUIA 2MA5A 3SOXA 5C11A 3DPLR 1T1HA 2KYUA 4W4UA 1WESA 4YBTA 5D1LB 1BORA 1VFYA 4LLBA 4UP5A 4O64A 2YQMA 5FB1A 4GB0A 4Q6FA 4WZ0A 4PTBA 1WEEA 2LGKA 2DX8A 3KQIA 3M62A 2YT5A 2EODA 2KGIA 4P5OB 2ECJA 4V3LC 3ZPVE 4L58A 2QJ0A 2K16A 3NG2A 1IYMA 3VK6A 2D8SA 5TBNA 1WGMA 5KH9A 3SOWA 5H1TA 2M3HA 4MSXA 2PUYA 1HYIA 2RSDA 1WENA 3L1ZB 1RMDA 4YC9A 3O70A 5TRBA 1LDKC 2QICA 1WEWA 2Y43A 2K4DA 2CKLB 4B7YC 3ZPV1 2KWJA 3ZYQA 2LDRA 2L0BA 1F62A 4CA1A 2NAAA 4CCGX 4AYCA 2YHNA 1WEOA 4LKAA 4YBSA 1U6GB 4R7EA 3RTRB 5JG6A 1WEVA 4A4CA 1WEMA 1LDJB 2KGGA 1E4UA 1ZBDB 2VJFA 5DKAA 2L75A 1XWHA 3HCTA 5D1KB 4LJNA 5LKXA 1WEQA 3N9MA 2L80A 3PHDA 4YAXA 3O34A 2C2VS 2JMIA 4YABA 1FBVA 5FB0A 5FEYA 2H0DB 5H9MA 3U5MA 3DQVR 5B75A 1V87A 2ECNA 2YYRA 3O36A 3N9PA 2VPBA 2K1JA 1X4UA 2AN6A 5LKUA 4V3KC 2E6SA 4LK9A 1HYJA 4AYCB 2HDPA 2L5UA 3C6WA 5TDRA 2FSAA 3N9LA 4FK5A 2LGVA 2KFTA 1X4JA 2YURA 3O33A 4IC2A 3M63A 2KU3A 5G04B 5B8DA 3ZVYA 2QIZA 2CSZA 5B76A 2KE1A 3RPGB 2H0DA 3MHSA 2KR4A 2LN0A 4NN2A 2VPEA 4BHWA 2YSMA 2M85A 2YSJA 1Z6UA 3N9QA 3FL2A 4AP4A 5KH3A 2CSYA 3IHPA 3PURA 3EB5A 5LCWB 4ZQLA 2CKLA 3GL6A 4GNFA 2MUMA 4B86C 3C5KA 2MA6A 5H1VA 2VJEB 4IC3A 2UZGA 2YHOA 4AVXA 4QF3A 3L1XA 4GNGA 1DVPA 3U5NA 3I2DA 4XI1A 4I7BA 2YW8A 2VP7A 2ECGA 4FIPA 3T7LA 2YQLA 4TKPB 3KV5A 4UI9B 2Y1MA 4L7XA 4C9ZA 3GV4A 3L11A 5J3XA 1WE9A 1K2FA 1JM7B 1N87A 2G6QA 3ASLA 3SHBA 3U5PA 4AUQB 2LXPC 5B79A 2I50A 4BBQA 4YATA 2YUCA 5TABA 5G0FA 2VPGA 3ZTGA 4R2YA 3EB6A 2JRJA 5KH7A 5DINA 3M99A 4ZUXU 4N4FA 4WA6A 2ECWA 4GNDA 4S3OB 2MNYA 3SOUA 2XB1A 2VPDA 5B78A 2G43A 4F52B 1WEPA 5LKZA 2M1RA 3MHHA 5I3LA 2KWOA 3PUQA 1JM7A 2MIQA 2JMDA 3N9OA 4A49A 1JOCA 1MM2A 1CHCA 2G45A 2LRIC 5TDWA 4WZ2A 5AIUA 2F6NA 2CT2A 1MM3A 2VJEA 3LQIA 2KIZA 4X3GA 3LQHA 3N9NA 1FP0A 3O7AA 2LQ6A 2F6JA 4WZ3B 2ECVA 2MD8C 1WEUA 2LV9A 1Z60A 3HTKC 5G05B 4QF2A 2EA6A 4FO9A 2FUUA 4YBMA 4UP0A 1G25A 3ZVZB 2Y1NA 5AITA 2L43A 3HCUA 2YU4A 2OXQC 1VYXA 2EGPA 3U5OA 3LQJA 4YADA 2F42A 3QZVA 4I7CA 4A4BA 5C13A 2XEUA 1WIMA 1WILA 2K17A 3O35A 3LRQA 3T6RA 2MT5A 2BAYA 1Z2QA 2VJFB 4S3OC 2E6RA 2KWKA 1WFKA 2C2LA 5LKTA 3HCSA 4R8PK 3KNVA 2HYED 2ZETC 5EYAF 3V43A 4MVTA 2YREA 5B77A 5FERA 4PPEA 4I7DA 3KV6A 2IDAA 4LADB 2MNZA 2PNXA
chains in the Genus database with same CATH superfamily
2ECTA 2ECIA 1VD4A 5H1UA 2RI7A 5SVIA 3ZNIA 2LGLA 4GNEA 4O62A 2JMJA 2LGGA 2LXHC 3RPGC 2XOCA 2KWNA 4FJCA 2VNFA 4N3WA 2MD7B 4A0CD 2XP0A 1X4IA 3O37A 2KREA 4ZDTA 5D1MB 2M6MA 2FUIA 2MA5A 3SOXA 5C11A 3DPLR 1T1HA 2KYUA 4W4UA 2KKXA 3Q1DA 1WESA 4YBTA 5D1LB 1BORA 1VFYA 4LLBA 4UP5A 4O64A 2YQMA 5FB1A 4GB0A 4Q6FA 4WZ0A 4PTBA 1WEEA 3FJUB 2LGKA 2DX8A 3M62A 3KQIA 2YT5A 2EODA 2FD4A 2KGIA 4P5OB 2ECJA 2L7PA 4V3LC 3ZPVE 4L58A 2QJ0A 2K16A 3NG2A 1IYMA 3VK6A 2D8SA 5TBNA 1WGMA 5KH9A 3SOWA 5H1TA 2M3HA 4MSXA 2PUYA 1HYIA 2RSDA 1WENA 3L1ZB 1RMDA 4YC9A 3O70A 3PLWA 5TRBA 1LDKC 2QICA 1WEWA 2Y43A 2K4DA 3DWDA 2CKLB 4B7YC 3ZPV1 2KWJA 3ZYQA 2LDRA 2L0BA 1F62A 4CA1A 2NAAA 2EGMA 4CCGX 4AYCA 2YHNA 1WEOA 4LKAA 4YBSA 1U6GB 4R7EA 3RTRB 5JG6A 1WEVA 4A4CA 3H7HA 1WEMA 3LJUX 1LDJB 2KGGA 1E4UA 1ZBDB 2VJFA 5DKAA 2L75A 1XWHA 3M7KA 3HCTA 5D1KB 4LJNA 5LKXA 1WEQA 3N9MA 2L80A 3PHDA 4YAXA 3O34A 2C2VS 2JMIA 4YABA 2YVRA 1FBVA 5FB0A 5FEYA 2H0DB 5H9MA 2XOZA 3U5MA 3DQVR 5B75A 1V87A 1DCQA 2ECNA 2YYRA 3O36A 3N9PA 2VPBA 2K1JA 1X4UA 2AN6A 5LKUA 4V3KC 3LVQE 2E6SA 4LK9A 1HYJA 4AYCB 2CSVA 2HDPA 2L5UA 3C6WA 5TDRA 2FSAA 3FAOA 2DJAA 3N9LA 4FK5A 2LGVA 2KFTA 1X4JA 2YURA 3JUEA 2P57A 3O33A 2D8UA 4IC2A 3M63A 2KU3A 5G04B 4H9DA 5B8DA 3ZVYA 2QIZA 2CSZA 5B76A 2KE1A 3RPGB 4Z0RA 2H0DA 3KDEC 3MDBC 3MHSA 2KR4A 2LN0A 4NN2A 2VPEA 4BHWA 2YSMA 2M85A 2YSJA 1Z6UA 3N9QA 3FL2A 4AP4A 5KH3A 2CSYA 3IHPA 3PURA 3EB5A 5LCWB 4ZQLA 2CKLA 3GL6A 4GNFA 2MUMA 2MKEA 4B86C 3C5KA 2MA6A 5H1VA 2VJEB 4IC3A 2UZGA 2YHOA 2M13A 4AVXA 4QF3A 3L1XA 4GNGA 1DVPA 3U5NA 3I2DA 4XI1A 4I7BA 2YW8A 2VP7A 2ECGA 2CRRA 4FIPA 3T7LA 3DDTA 2YQLA 4F1PA 4TKPB 3KV5A 4UI9B 2Y1MA 4L7XA 4C9ZA 3GV4A 3L11A 5J3XA 1WE9A 1K2FA 1JM7B 1N87A 2G6QA 3ASLA 3SHBA 3U5PA 4AUQB 2LXPC 5B79A 2I50A 4BBQA 4YATA 2YUCA 5TABA 5G0FA 2VPGA 1MBMA 3ZTGA 4R2YA 5SVYA 3EB6A 2EXUA 2JRJA 5KH7A 5DINA 5K3QA 3M99A 4ZUXU 4N4FA 4WA6A 2ECWA 4GNDA 4S3OB 2MNYA 3SOUA 2XB1A 2VPDA 3T9KA 2OWAA 5B78A 2G43A 4F52B 5SVXA 1WEPA 5LKZA 4OGCA 2M1RA 3MHHA 5I3LA 2KWOA 3PUQA 1JM7A 2MIQA 2JMDA 3N9OA 3FANA 4OGEA 3E2DA 5SVIB 2KKYA 4A49A 1JOCA 1MM2A 2XOYA 1CHCA 2G45A 2LRIC 5TDWA 4WZ2A 3FM8C 5AIUA 2JUNA 2F6NA 2CT2A 1MM3A 2VJEA 2RR4A 2LAUA 2JM3A 3LQIA 2KIZA 4X3GA 2DSMA 3LQHA 3N9NA 3SUBA 1FP0A 2E61A 3O7AA 2LQ6A 2F6JA 4WZ3B 2ECVA 2MD8C 1WEUA 2LV9A 1Z60A 3HTKC 5G05B 4QF2A 2EA6A 4FO9A 2FUUA 4YBMA 4UP0A 1G25A 3ZVZB 2Y1NA 5AITA 2L43A 4QQ4A 4Z0OA 3HCUA 2YU4A 2OXQC 1VYXA 2EGPA 3U5OA 3LQJA 4YADA 2F42A 3QZVA 4I7CA 4A4BA 5C13A 2CRWA 2FFWA 2XEUA 1WIMA 1WILA 2K17A 3O35A 3FEHA 3LRQA 3T6RA 2MT5A 2BAYA 3LDYA 1Z2QA 2VJFB 4S3OC 2E6RA 2KWKA 1WFKA 2C2LA 5LKTA 3HCSA 2IQJA 4R8PK 2CONA 3KNVA 2HYED 2ZETC 5EYAF 3LVRE 3O47A 3V43A 2B0OE 4MVTA 2YREA 5B77A 5FERA 4PPEA 4I7DA 3KV6A 2IDAA 4LADB 2MNZA 2PNXA
chains in the Genus database with same CATH topology
2ECTA 2ECIA 1VD4A 5H1UA 2RI7A 3ZNIA 2LGLA 4GNEA 2JMJA 2LGGA 2LXHC 3RPGC 2KWNA 4FJCA 2VNFA 4N3WA 2MD7B 4A0CD 1X4IA 3O37A 2KREA 4ZDTA 5D1MB 2M6MA 2FUIA 2MA5A 3SOXA 5C11A 3DPLR 1T1HA 2KYUA 4W4UA 1WESA 4YBTA 5D1LB 1BORA 1VFYA 4LLBA 4UP5A 4O64A 2YQMA 5FB1A 4GB0A 4Q6FA 4WZ0A 4PTBA 1WEEA 2LGKA 2DX8A 3KQIA 3M62A 2YT5A 2EODA 2KGIA 4P5OB 2ECJA 4V3LC 3ZPVE 4L58A 2QJ0A 2K16A 3NG2A 1IYMA 3VK6A 2D8SA 5TBNA 1WGMA 5KH9A 3SOWA 5H1TA 2M3HA 4MSXA 2PUYA 1HYIA 2RSDA 1WENA 3L1ZB 1RMDA 4YC9A 3O70A 5TRBA 1LDKC 2QICA 1WEWA 2Y43A 2K4DA 2CKLB 4B7YC 3ZPV1 2KWJA 3ZYQA 2LDRA 2L0BA 1F62A 4CA1A 2NAAA 4CCGX 4AYCA 2YHNA 1WEOA 4LKAA 4YBSA 1U6GB 4R7EA 3RTRB 5JG6A 1WEVA 4A4CA 1WEMA 1LDJB 2KGGA 1E4UA 1ZBDB 2VJFA 5DKAA 2L75A 1XWHA 3HCTA 5D1KB 4LJNA 5LKXA 1WEQA 3N9MA 2L80A 3PHDA 4YAXA 3O34A 2C2VS 2JMIA 4YABA 1FBVA 5FB0A 5FEYA 2H0DB 5H9MA 3U5MA 3DQVR 5B75A 1V87A 2ECNA 2YYRA 3O36A 3N9PA 2VPBA 2K1JA 1X4UA 2AN6A 5LKUA 4V3KC 2E6SA 4LK9A 1HYJA 4AYCB 2HDPA 2L5UA 3C6WA 5TDRA 2FSAA 3N9LA 4FK5A 2LGVA 2KFTA 1X4JA 2YURA 3O33A 4IC2A 3M63A 2KU3A 5G04B 5B8DA 3ZVYA 2QIZA 2CSZA 5B76A 2KE1A 3RPGB 2H0DA 3MHSA 2KR4A 2LN0A 4NN2A 2VPEA 4BHWA 2YSMA 2M85A 2YSJA 1Z6UA 3N9QA 3FL2A 4AP4A 5KH3A 2CSYA 3IHPA 3PURA 3EB5A 5LCWB 4ZQLA 2CKLA 3GL6A 4GNFA 2MUMA 4B86C 3C5KA 2MA6A 5H1VA 2VJEB 4IC3A 2UZGA 2YHOA 4AVXA 4QF3A 3L1XA 4GNGA 1DVPA 3U5NA 3I2DA 4XI1A 4I7BA 2YW8A 2VP7A 2ECGA 4FIPA 3T7LA 2YQLA 4TKPB 3KV5A 4UI9B 2Y1MA 4L7XA 4C9ZA 3GV4A 3L11A 5J3XA 1WE9A 1K2FA 1JM7B 1N87A 2G6QA 3ASLA 3SHBA 3U5PA 4AUQB 2LXPC 5B79A 2I50A 4BBQA 4YATA 2YUCA 5TABA 5G0FA 2VPGA 3ZTGA 4R2YA 3EB6A 2JRJA 5KH7A 5DINA 3M99A 4ZUXU 4N4FA 4WA6A 2ECWA 4GNDA 4S3OB 2MNYA 3SOUA 2XB1A 2VPDA 5B78A 2G43A 4F52B 1WEPA 5LKZA 2M1RA 3MHHA 5I3LA 2KWOA 3PUQA 1JM7A 2MIQA 2JMDA 3N9OA 4A49A 1JOCA 1MM2A 1CHCA 2G45A 2LRIC 5TDWA 4WZ2A 5AIUA 2F6NA 2CT2A 1MM3A 2VJEA 3LQIA 2KIZA 4X3GA 3LQHA 3N9NA 1FP0A 3O7AA 2LQ6A 2F6JA 4WZ3B 2ECVA 2MD8C 1WEUA 2LV9A 1Z60A 3HTKC 5G05B 4QF2A 2EA6A 4FO9A 2FUUA 4YBMA 4UP0A 1G25A 3ZVZB 2Y1NA 5AITA 2L43A 3HCUA 2YU4A 2OXQC 1VYXA 2EGPA 3U5OA 3LQJA 4YADA 2F42A 3QZVA 4I7CA 4A4BA 5C13A 2XEUA 1WIMA 1WILA 2K17A 3O35A 3LRQA 3T6RA 2MT5A 2BAYA 1Z2QA 2VJFB 4S3OC 2E6RA 2KWKA 1WFKA 2C2LA 5LKTA 3HCSA 4R8PK 3KNVA 2HYED 2ZETC 5EYAF 3V43A 4MVTA 2YREA 5B77A 5FERA 4PPEA 4I7DA 3KV6A 2IDAA 4LADB 2MNZA 2PNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECT A;  2ECI A;  1VD4 A;  5H1U A;  2RI7 A;  3ZNI A;  2LGL A;  4GNE A;  2JMJ A;  2LGG A;  2LXH C;  3RPG C;  2KWN A;  4FJC A;  2VNF A;  4N3W A;  2MD7 B;  4A0C D;  1X4I A;  3O37 A;  2KRE A;  4ZDT A;  5D1M B;  2M6M A;  2FUI A;  2MA5 A;  3SOX A;  5C11 A;  3DPL R;  1T1H A;  2KYU A;  4W4U A;  1WES A;  4YBT A;  5D1L B;  1BOR A;  1VFY A;  4LLB A;  4UP5 A;  4O64 A;  2YQM A;  5FB1 A;  4GB0 A;  4Q6F A;  4WZ0 A;  4PTB A;  1WEE A;  2LGK A;  2DX8 A;  3KQI A;  3M62 A;  2YT5 A;  2EOD A;  2KGI A;  4P5O B;  2ECJ A;  4V3L C;  3ZPV E;  4L58 A;  2QJ0 A;  2K16 A;  3NG2 A;  1IYM A;  3VK6 A;  2D8S A;  5TBN A;  1WGM A;  5KH9 A;  3SOW A;  5H1T A;  2M3H A;  4MSX A;  2PUY A;  1HYI A;  2RSD A;  1WEN A;  3L1Z B;  1RMD A;  4YC9 A;  3O70 A;  5TRB A;  1LDK C;  2QIC A;  1WEW A;  2Y43 A;  2K4D A;  2CKL B;  4B7Y C;  3ZPV 1;  2KWJ A;  3ZYQ A;  2LDR A;  2L0B A;  1F62 A;  4CA1 A;  2NAA A;  4CCG X;  4AYC A;  2YHN A;  1WEO A;  4LKA A;  4YBS A;  1U6G B;  4R7E A;  3RTR B;  5JG6 A;  1WEV A;  4A4C A;  1WEM A;  1LDJ B;  2KGG A;  1E4U A;  1ZBD B;  2VJF A;  5DKA A;  2L75 A;  1XWH A;  3HCT A;  5D1K B;  4LJN A;  5LKX A;  1WEQ A;  3N9M A;  2L80 A;  3PHD A;  4YAX A;  3O34 A;  2C2V S;  2JMI A;  4YAB A;  1FBV A;  5FB0 A;  5FEY A;  2H0D B;  5H9M A;  3U5M A;  3DQV R;  5B75 A;  1V87 A;  2ECN A;  2YYR A;  3O36 A;  3N9P A;  2VPB A;  2K1J A;  1X4U A;  2AN6 A;  5LKU A;  4V3K C;  2E6S A;  4LK9 A;  1HYJ A;  4AYC B;  2HDP A;  2L5U A;  3C6W A;  5TDR A;  2FSA A;  3N9L A;  4FK5 A;  2LGV A;  2KFT A;  1X4J A;  2YUR A;  3O33 A;  4IC2 A;  3M63 A;  2KU3 A;  5G04 B;  5B8D A;  3ZVY A;  2QIZ A;  2CSZ A;  5B76 A;  2KE1 A;  3RPG B;  2H0D A;  3MHS A;  2KR4 A;  2LN0 A;  4NN2 A;  2VPE A;  4BHW A;  2YSM A;  2M85 A;  2YSJ A;  1Z6U A;  3N9Q A;  3FL2 A;  4AP4 A;  5KH3 A;  2CSY A;  3IHP A;  3PUR A;  3EB5 A;  5LCW B;  4ZQL A;  2CKL A;  3GL6 A;  4GNF A;  2MUM A;  4B86 C;  3C5K A;  2MA6 A;  5H1V A;  2VJE B;  4IC3 A;  2UZG A;  2YHO A;  4AVX A;  4QF3 A;  3L1X A;  4GNG A;  1DVP A;  3U5N A;  3I2D A;  4XI1 A;  4I7B A;  2YW8 A;  2VP7 A;  2ECG A;  4FIP A;  3T7L A;  2YQL A;  4TKP B;  3KV5 A;  4UI9 B;  2Y1M A;  4L7X A;  4C9Z A;  3GV4 A;  3L11 A;  5J3X A;  1WE9 A;  1K2F A;  1JM7 B;  1N87 A;  2G6Q A;  3ASL A;  3SHB A;  3U5P A;  4AUQ B;  2LXP C;  5B79 A;  2I50 A;  4BBQ A;  4YAT A;  2YUC A;  5TAB A;  5G0F A;  2VPG A;  3ZTG A;  4R2Y A;  3EB6 A;  2JRJ A;  5KH7 A;  5DIN A;  3M99 A;  4ZUX U;  4N4F A;  4WA6 A;  2ECW A;  4GND A;  4S3O B;  2MNY A;  3SOU A;  2XB1 A;  2VPD A;  5B78 A;  2G43 A;  4F52 B;  1WEP A;  5LKZ A;  2M1R A;  3MHH A;  5I3L A;  2KWO A;  3PUQ A;  1JM7 A;  2MIQ A;  2JMD A;  3N9O A;  4A49 A;  1JOC A;  1MM2 A;  1CHC A;  2G45 A;  2LRI C;  5TDW A;  4WZ2 A;  5AIU A;  2F6N A;  2CT2 A;  1MM3 A;  2VJE A;  3LQI A;  2KIZ A;  4X3G A;  3LQH A;  3N9N A;  1FP0 A;  3O7A A;  2LQ6 A;  2F6J A;  4WZ3 B;  2ECV A;  2MD8 C;  1WEU A;  2LV9 A;  1Z60 A;  3HTK C;  5G05 B;  4QF2 A;  2EA6 A;  4FO9 A;  2FUU A;  4YBM A;  4UP0 A;  1G25 A;  3ZVZ B;  2Y1N A;  5AIT A;  2L43 A;  3HCU A;  2YU4 A;  2OXQ C;  1VYX A;  2EGP A;  3U5O A;  3LQJ A;  4YAD A;  2F42 A;  3QZV A;  4I7C A;  4A4B A;  5C13 A;  2XEU A;  1WIM A;  1WIL A;  2K17 A;  3O35 A;  3LRQ A;  3T6R A;  2MT5 A;  2BAY A;  1Z2Q A;  2VJF B;  4S3O C;  2E6R A;  2KWK A;  1WFK A;  2C2L A;  5LKT A;  3HCS A;  4R8P K;  3KNV A;  2HYE D;  2ZET C;  5EYA F;  3V43 A;  4MVT A;  2YRE A;  5B77 A;  5FER A;  4PPE A;  4I7D A;  3KV6 A;  2IDA A;  4LAD B;  2MNZ A;  2PNX A; 
#chains in the Genus database with same CATH topology
 2ECT A;  2ECI A;  1VD4 A;  5H1U A;  2RI7 A;  5SVI A;  3ZNI A;  2LGL A;  4GNE A;  4O62 A;  2JMJ A;  2LGG A;  2LXH C;  3RPG C;  2XOC A;  2KWN A;  4FJC A;  2VNF A;  4N3W A;  2MD7 B;  4A0C D;  2XP0 A;  1X4I A;  3O37 A;  2KRE A;  4ZDT A;  5D1M B;  2M6M A;  2FUI A;  2MA5 A;  3SOX A;  5C11 A;  3DPL R;  1T1H A;  2KYU A;  4W4U A;  2KKX A;  3Q1D A;  1WES A;  4YBT A;  5D1L B;  1BOR A;  1VFY A;  4LLB A;  4UP5 A;  4O64 A;  2YQM A;  5FB1 A;  4GB0 A;  4Q6F A;  4WZ0 A;  4PTB A;  1WEE A;  3FJU B;  2LGK A;  2DX8 A;  3M62 A;  3KQI A;  2YT5 A;  2EOD A;  2FD4 A;  2KGI A;  4P5O B;  2ECJ A;  2L7P A;  4V3L C;  3ZPV E;  4L58 A;  2QJ0 A;  2K16 A;  3NG2 A;  1IYM A;  3VK6 A;  2D8S A;  5TBN A;  1WGM A;  5KH9 A;  3SOW A;  5H1T A;  2M3H A;  4MSX A;  2PUY A;  1HYI A;  2RSD A;  1WEN A;  3L1Z B;  1RMD A;  4YC9 A;  3O70 A;  3PLW A;  5TRB A;  1LDK C;  2QIC A;  1WEW A;  2Y43 A;  2K4D A;  3DWD A;  2CKL B;  4B7Y C;  3ZPV 1;  2KWJ A;  3ZYQ A;  2LDR A;  2L0B A;  1F62 A;  4CA1 A;  2NAA A;  2EGM A;  4CCG X;  4AYC A;  2YHN A;  1WEO A;  4LKA A;  4YBS A;  1U6G B;  4R7E A;  3RTR B;  5JG6 A;  1WEV A;  4A4C A;  3H7H A;  1WEM A;  3LJU X;  1LDJ B;  2KGG A;  1E4U A;  1ZBD B;  2VJF A;  5DKA A;  2L75 A;  1XWH A;  3M7K A;  3HCT A;  5D1K B;  4LJN A;  5LKX A;  1WEQ A;  3N9M A;  2L80 A;  3PHD A;  4YAX A;  3O34 A;  2C2V S;  2JMI A;  4YAB A;  2YVR A;  1FBV A;  5FB0 A;  5FEY A;  2H0D B;  5H9M A;  2XOZ A;  3U5M A;  3DQV R;  5B75 A;  1V87 A;  1DCQ A;  2ECN A;  2YYR A;  3O36 A;  3N9P A;  2VPB A;  2K1J A;  1X4U A;  2AN6 A;  5LKU A;  4V3K C;  3LVQ E;  2E6S A;  4LK9 A;  1HYJ A;  4AYC B;  2CSV A;  2HDP A;  2L5U A;  3C6W A;  5TDR A;  2FSA A;  3FAO A;  2DJA A;  3N9L A;  4FK5 A;  2LGV A;  2KFT A;  1X4J A;  2YUR A;  3JUE A;  2P57 A;  3O33 A;  2D8U A;  4IC2 A;  3M63 A;  2KU3 A;  5G04 B;  4H9D A;  5B8D A;  3ZVY A;  2QIZ A;  2CSZ A;  5B76 A;  2KE1 A;  3RPG B;  4Z0R A;  2H0D A;  3KDE C;  3MDB C;  3MHS A;  2KR4 A;  2LN0 A;  4NN2 A;  2VPE A;  4BHW A;  2YSM A;  2M85 A;  2YSJ A;  1Z6U A;  3N9Q A;  3FL2 A;  4AP4 A;  5KH3 A;  2CSY A;  3IHP A;  3PUR A;  3EB5 A;  5LCW B;  4ZQL A;  2CKL A;  3GL6 A;  4GNF A;  2MUM A;  2MKE A;  4B86 C;  3C5K A;  2MA6 A;  5H1V A;  2VJE B;  4IC3 A;  2UZG A;  2YHO A;  2M13 A;  4AVX A;  4QF3 A;  3L1X A;  4GNG A;  1DVP A;  3U5N A;  3I2D A;  4XI1 A;  4I7B A;  2YW8 A;  2VP7 A;  2ECG A;  2CRR A;  4FIP A;  3T7L A;  3DDT A;  2YQL A;  4F1P A;  4TKP B;  3KV5 A;  4UI9 B;  2Y1M A;  4L7X A;  4C9Z A;  3GV4 A;  3L11 A;  5J3X A;  1WE9 A;  1K2F A;  1JM7 B;  1N87 A;  2G6Q A;  3ASL A;  3SHB A;  3U5P A;  4AUQ B;  2LXP C;  5B79 A;  2I50 A;  4BBQ A;  4YAT A;  2YUC A;  5TAB A;  5G0F A;  2VPG A;  1MBM A;  3ZTG A;  4R2Y A;  5SVY A;  3EB6 A;  2EXU A;  2JRJ A;  5KH7 A;  5DIN A;  5K3Q A;  3M99 A;  4ZUX U;  4N4F A;  4WA6 A;  2ECW A;  4GND A;  4S3O B;  2MNY A;  3SOU A;  2XB1 A;  2VPD A;  3T9K A;  2OWA A;  5B78 A;  2G43 A;  4F52 B;  5SVX A;  1WEP A;  5LKZ A;  4OGC A;  2M1R A;  3MHH A;  5I3L A;  2KWO A;  3PUQ A;  1JM7 A;  2MIQ A;  2JMD A;  3N9O A;  3FAN A;  4OGE A;  3E2D A;  5SVI B;  2KKY A;  4A49 A;  1JOC A;  1MM2 A;  2XOY A;  1CHC A;  2G45 A;  2LRI C;  5TDW A;  4WZ2 A;  3FM8 C;  5AIU A;  2JUN A;  2F6N A;  2CT2 A;  1MM3 A;  2VJE A;  2RR4 A;  2LAU A;  2JM3 A;  3LQI A;  2KIZ A;  4X3G A;  2DSM A;  3LQH A;  3N9N A;  3SUB A;  1FP0 A;  2E61 A;  3O7A A;  2LQ6 A;  2F6J A;  4WZ3 B;  2ECV A;  2MD8 C;  1WEU A;  2LV9 A;  1Z60 A;  3HTK C;  5G05 B;  4QF2 A;  2EA6 A;  4FO9 A;  2FUU A;  4YBM A;  4UP0 A;  1G25 A;  3ZVZ B;  2Y1N A;  5AIT A;  2L43 A;  4QQ4 A;  4Z0O A;  3HCU A;  2YU4 A;  2OXQ C;  1VYX A;  2EGP A;  3U5O A;  3LQJ A;  4YAD A;  2F42 A;  3QZV A;  4I7C A;  4A4B A;  5C13 A;  2CRW A;  2FFW A;  2XEU A;  1WIM A;  1WIL A;  2K17 A;  3O35 A;  3FEH A;  3LRQ A;  3T6R A;  2MT5 A;  2BAY A;  3LDY A;  1Z2Q A;  2VJF B;  4S3O C;  2E6R A;  2KWK A;  1WFK A;  2C2L A;  5LKT A;  3HCS A;  2IQJ A;  4R8P K;  2CON A;  3KNV A;  2HYE D;  2ZET C;  5EYA F;  3LVR E;  3O47 A;  3V43 A;  2B0O E;  4MVT A;  2YRE A;  5B77 A;  5FER A;  4PPE A;  4I7D A;  3KV6 A;  2IDA A;  4LAD B;  2MNZ A;  2PNX A; 
#chains in the Genus database with same CATH homology
 2ECT A;  2ECI A;  1VD4 A;  5H1U A;  2RI7 A;  3ZNI A;  2LGL A;  4GNE A;  2JMJ A;  2LGG A;  2LXH C;  3RPG C;  2KWN A;  4FJC A;  2VNF A;  4N3W A;  2MD7 B;  4A0C D;  1X4I A;  3O37 A;  2KRE A;  4ZDT A;  5D1M B;  2M6M A;  2FUI A;  2MA5 A;  3SOX A;  5C11 A;  3DPL R;  1T1H A;  2KYU A;  4W4U A;  1WES A;  4YBT A;  5D1L B;  1BOR A;  1VFY A;  4LLB A;  4UP5 A;  4O64 A;  2YQM A;  5FB1 A;  4GB0 A;  4Q6F A;  4WZ0 A;  4PTB A;  1WEE A;  2LGK A;  2DX8 A;  3KQI A;  3M62 A;  2YT5 A;  2EOD A;  2KGI A;  4P5O B;  2ECJ A;  4V3L C;  3ZPV E;  4L58 A;  2QJ0 A;  2K16 A;  3NG2 A;  1IYM A;  3VK6 A;  2D8S A;  5TBN A;  1WGM A;  5KH9 A;  3SOW A;  5H1T A;  2M3H A;  4MSX A;  2PUY A;  1HYI A;  2RSD A;  1WEN A;  3L1Z B;  1RMD A;  4YC9 A;  3O70 A;  5TRB A;  1LDK C;  2QIC A;  1WEW A;  2Y43 A;  2K4D A;  2CKL B;  4B7Y C;  3ZPV 1;  2KWJ A;  3ZYQ A;  2LDR A;  2L0B A;  1F62 A;  4CA1 A;  2NAA A;  4CCG X;  4AYC A;  2YHN A;  1WEO A;  4LKA A;  4YBS A;  1U6G B;  4R7E A;  3RTR B;  5JG6 A;  1WEV A;  4A4C A;  1WEM A;  1LDJ B;  2KGG A;  1E4U A;  1ZBD B;  2VJF A;  5DKA A;  2L75 A;  1XWH A;  3HCT A;  5D1K B;  4LJN A;  5LKX A;  1WEQ A;  3N9M A;  2L80 A;  3PHD A;  4YAX A;  3O34 A;  2C2V S;  2JMI A;  4YAB A;  1FBV A;  5FB0 A;  5FEY A;  2H0D B;  5H9M A;  3U5M A;  3DQV R;  5B75 A;  1V87 A;  2ECN A;  2YYR A;  3O36 A;  3N9P A;  2VPB A;  2K1J A;  1X4U A;  2AN6 A;  5LKU A;  4V3K C;  2E6S A;  4LK9 A;  1HYJ A;  4AYC B;  2HDP A;  2L5U A;  3C6W A;  5TDR A;  2FSA A;  3N9L A;  4FK5 A;  2LGV A;  2KFT A;  1X4J A;  2YUR A;  3O33 A;  4IC2 A;  3M63 A;  2KU3 A;  5G04 B;  5B8D A;  3ZVY A;  2QIZ A;  2CSZ A;  5B76 A;  2KE1 A;  3RPG B;  2H0D A;  3MHS A;  2KR4 A;  2LN0 A;  4NN2 A;  2VPE A;  4BHW A;  2YSM A;  2M85 A;  2YSJ A;  1Z6U A;  3N9Q A;  3FL2 A;  4AP4 A;  5KH3 A;  2CSY A;  3IHP A;  3PUR A;  3EB5 A;  5LCW B;  4ZQL A;  2CKL A;  3GL6 A;  4GNF A;  2MUM A;  4B86 C;  3C5K A;  2MA6 A;  5H1V A;  2VJE B;  4IC3 A;  2UZG A;  2YHO A;  4AVX A;  4QF3 A;  3L1X A;  4GNG A;  1DVP A;  3U5N A;  3I2D A;  4XI1 A;  4I7B A;  2YW8 A;  2VP7 A;  2ECG A;  4FIP A;  3T7L A;  2YQL A;  4TKP B;  3KV5 A;  4UI9 B;  2Y1M A;  4L7X A;  4C9Z A;  3GV4 A;  3L11 A;  5J3X A;  1WE9 A;  1K2F A;  1JM7 B;  1N87 A;  2G6Q A;  3ASL A;  3SHB A;  3U5P A;  4AUQ B;  2LXP C;  5B79 A;  2I50 A;  4BBQ A;  4YAT A;  2YUC A;  5TAB A;  5G0F A;  2VPG A;  3ZTG A;  4R2Y A;  3EB6 A;  2JRJ A;  5KH7 A;  5DIN A;  3M99 A;  4ZUX U;  4N4F A;  4WA6 A;  2ECW A;  4GND A;  4S3O B;  2MNY A;  3SOU A;  2XB1 A;  2VPD A;  5B78 A;  2G43 A;  4F52 B;  1WEP A;  5LKZ A;  2M1R A;  3MHH A;  5I3L A;  2KWO A;  3PUQ A;  1JM7 A;  2MIQ A;  2JMD A;  3N9O A;  4A49 A;  1JOC A;  1MM2 A;  1CHC A;  2G45 A;  2LRI C;  5TDW A;  4WZ2 A;  5AIU A;  2F6N A;  2CT2 A;  1MM3 A;  2VJE A;  3LQI A;  2KIZ A;  4X3G A;  3LQH A;  3N9N A;  1FP0 A;  3O7A A;  2LQ6 A;  2F6J A;  4WZ3 B;  2ECV A;  2MD8 C;  1WEU A;  2LV9 A;  1Z60 A;  3HTK C;  5G05 B;  4QF2 A;  2EA6 A;  4FO9 A;  2FUU A;  4YBM A;  4UP0 A;  1G25 A;  3ZVZ B;  2Y1N A;  5AIT A;  2L43 A;  3HCU A;  2YU4 A;  2OXQ C;  1VYX A;  2EGP A;  3U5O A;  3LQJ A;  4YAD A;  2F42 A;  3QZV A;  4I7C A;  4A4B A;  5C13 A;  2XEU A;  1WIM A;  1WIL A;  2K17 A;  3O35 A;  3LRQ A;  3T6R A;  2MT5 A;  2BAY A;  1Z2Q A;  2VJF B;  4S3O C;  2E6R A;  2KWK A;  1WFK A;  2C2L A;  5LKT A;  3HCS A;  4R8P K;  3KNV A;  2HYE D;  2ZET C;  5EYA F;  3V43 A;  4MVT A;  2YRE A;  5B77 A;  5FER A;  4PPE A;  4I7D A;  3KV6 A;  2IDA A;  4LAD B;  2MNZ A;  2PNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...