2L0BA

Solution nmr structure of zinc finger domain of e3 ubiquitin-protein ligase praja-1 from homo sapiens, northeast structural genomics consortium (nesg) target hr4710b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
b'MGHHHHHHSHMVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase Praja-1
publication title Solution structure of zinc finger domain of E3 ubiquitin-protein ligase protein praja-1 from Homo sapiens, northeast structural genomics consortium (NESG) target HR4710B
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 17
structure length 91
sequence length 91
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l0bA00
2JRJA 3U5OA 2LQ6A 2MT5A 5B78A 4MSXA 3N9QA 2MD7B 4W4UA 2K1JA 1RMDA 2EA6A 1F62A 2MNYA 4AVXA 5D1LB 3I2DA 4V3KC 2CKLB 4GB0A 2ECIA 2FSAA 5LCWB 4BBQA 3ASLA 3EB5A 3HTKC 5TDWA 4B7YC 2YQLA 2KWKA 2AN6A 1HYIA 2NAAA 3SOXA 2H0DB 2KGIA 3FL2A 3GV4A 2KR4A 4V3LC 2ECTA 5TABA 4S3OC 1VYXA 3RPGB 4I7CA 5LKUA 5AIUA 4S3OB 4O64A 2KU3A 4R2YA 4A4BA 4GNEA 2KWNA 3RTRB 3LRQA 2E6SA 4P5OB 4YAXA 2JMDA 3O35A 1VD4A 3KQIA 2RSDA 4YBMA 5KH7A 3PUQA 4AYCB 2HYED 1XWHA 3LQIA 5FEYA 2MUMA 5H9MA 2VJFB 2LXPC 3ZNIA 2VNFA 1CHCA 2BAYA 4NN2A 1X4IA 2LXHC 4FO9A 1IYMA 2RI7A 2KGGA 4LLBA 2DX8A 2LN0A 4UP0A 2L5UA 3N9NA 4WZ2A 5JG6A 3N9OA 2L75A 2D8SA 2M6MA 2VJEB 3ZPV1 2LRIC 3M99A 1WIMA 3HCTA 1FBVA 5I3LA 3C6WA 4N4FA 4YATA 2MA6A 3SOWA 5AITA 1Z6UA 1WEUA 2QIZA 3KNVA 2L43A 1MM3A 1Z60A 5TDRA 4CCGX 2K16A 2FUIA 4IC3A 2YHNA 4F52B 1WEQA 3ZTGA 2JMJA 4PPEA 4IC2A 4WZ0A 2MA5A 1T1HA 2LGLA 5KH9A 5LKTA 2E6RA 2YURA 3DPLR 1ZBDB 2MNZA 2QJ0A 1JOCA 1U6GB 1VFYA 2F6JA 4L7XA 3QZVA 2KWJA 3PHDA 2VP7A 2M85A 1N87A 2PNXA 4WZ3B 3U5NA 3LQHA 3T6RA 4GNGA 5G04B 3RPGC 2ECNA 1K2FA 2Y1NA 5J3XA 3O70A 1WFKA 3SOUA 5G05B 3NG2A 2QICA 3N9MA 1DVPA 2HDPA 3U5PA 3O7AA 1V87A 2C2LA 3T7LA 2PUYA 2ECGA 5FB0A 1WEVA 3ZVZB 3EB6A 2Y43A 4FK5A 2KE1A 2MD8C 5TRBA 2YQMA 5C11A 2YT5A 4YABA 2CSZA 3M62A 1G25A 2FUUA 2LDRA 2H0DA 4YBTA 2YHOA 1JM7B 3SHBA 3LQJA 4I7BA 2YYRA 4YBSA 1FP0A 2G45A 2LGKA 4A4CA 4AP4A 4MVTA 3N9PA 4A49A 5D1KB 3ZYQA 1X4JA 3MHHA 4QF2A 1WE9A 2VPGA 4TKPB 5LKXA 2XB1A 4YADA 2MIQA 3HCSA 3O37A 5DKAA 2CSYA 2G43A 1WEPA 2XEUA 2F6NA 4A0CD 3C5KA 2LGVA 5FERA 4AYCA 1WGMA 2VPBA 5EYAF 2YSMA 2I50A 4GNDA 4AUQB 4WA6A 5LKZA 2M3HA 2IDAA 2K4DA 4R8PK 2Y1MA 5H1UA 2L0BA 3KV6A 2VPEA 4XI1A 5B77A 1BORA 3O33A 4ZUXU 2EGPA 2YUCA 2VJEA 4GNFA 4ZQLA 3PURA 5DINA 1LDKC 2KYUA 3O34A 2KWOA 3ZPVE 1WEMA 5FB1A 2LV9A 4YC9A 5H1TA 3U5MA 4I7DA 3MHSA 2LGGA 2ECVA 2ECWA 2UZGA 1WEOA 4LJNA 3L1ZB 1LDJB 1MM2A 1WILA 3L1XA 4C9ZA 3ZVYA 1X4UA 5C13A 2C2VS 2OXQC 2ECJA 2KIZA 2YREA 1HYJA 3O36A 4FJCA 2VPDA 3V43A 2CKLA 3GL6A 2YSJA 4LK9A 4QF3A 2K17A 5D1MB 2L80A 2JMIA 3M63A 1WEEA 4FIPA 1E4UA 5KH3A 3N9LA 1WESA 4PTBA 3HCUA 2F42A 4LADB 4CA1A 2EODA 2M1RA 5B76A 5TBNA 3IHPA 3DQVR 4L58A 2KREA 4X3GA 5H1VA 2KFTA 4BHWA 4R7EA 3VK6A 5G0FA 2YU4A 4Q6FA 2VJFA 4ZDTA 4N3WA 2CT2A 2ZETC 4LKAA 3KV5A 4UP5A 2G6QA 3L11A 5B79A 1Z2QA 1WENA 4B86C 1WEWA 5B8DA 4UI9B 2YW8A 5B75A 1JM7A
chains in the Genus database with same CATH superfamily
2JRJA 3U5OA 2LQ6A 2MT5A 5B78A 4MSXA 3N9QA 2OWAA 2MD7B 2JUNA 4W4UA 2K1JA 1RMDA 2EA6A 1F62A 2MNYA 4AVXA 5D1LB 2CSVA 3I2DA 4V3KC 2CKLB 4GB0A 2KKYA 4H9DA 2ECIA 2FSAA 5LCWB 4BBQA 3ASLA 3EB5A 3HTKC 5TDWA 4B7YC 2YQLA 2KWKA 2AN6A 1HYIA 2XOZA 2NAAA 4O62A 3SOXA 2H0DB 4OGEA 2KGIA 3FL2A 3GV4A 2KR4A 4V3LC 2ECTA 5TABA 4S3OC 1VYXA 2KKXA 3RPGB 2MKEA 4I7CA 5LKUA 5AIUA 4S3OB 4O64A 2KU3A 4R2YA 4A4BA 4GNEA 2KWNA 3RTRB 3LRQA 2E6SA 4P5OB 4YAXA 2JMDA 2YVRA 3O35A 1VD4A 3KQIA 2RSDA 4YBMA 4Z0OA 2IQJA 5KH7A 3PUQA 4AYCB 2HYED 1XWHA 3LQIA 5FEYA 2MUMA 5H9MA 2VJFB 2LXPC 3SUBA 3ZNIA 2E61A 2VNFA 1CHCA 2BAYA 4NN2A 1X4IA 2LXHC 4FO9A 1IYMA 2RI7A 2KGGA 4LLBA 2DX8A 2LN0A 4UP0A 2L5UA 2FD4A 3N9NA 4WZ2A 5JG6A 3N9OA 2L75A 2D8SA 2M6MA 3MDBC 2DJAA 2VJEB 3ZPV1 2LRIC 5K3QA 3M99A 1WIMA 3HCTA 1FBVA 5I3LA 2RR4A 2CRWA 3C6WA 4N4FA 4YATA 2MA6A 3SOWA 2EGMA 5AITA 1Z6UA 1WEUA 2QIZA 3KNVA 2L43A 1MM3A 1Z60A 5TDRA 4CCGX 2K16A 2FUIA 3LVRE 4IC3A 2YHNA 2P57A 4F52B 1WEQA 3ZTGA 2JMJA 1DCQA 4PPEA 4IC2A 4WZ0A 2MA5A 1T1HA 2LGLA 5KH9A 5LKTA 2E6RA 2YURA 3DPLR 1ZBDB 3LVQE 2MNZA 2QJ0A 1JOCA 1U6GB 1VFYA 2F6JA 4L7XA 3QZVA 2KWJA 3PHDA 2VP7A 2M85A 1N87A 2PNXA 2XOCA 4WZ3B 5SVYA 3U5NA 3LQHA 3T6RA 2B0OE 4GNGA 5G04B 3RPGC 3JUEA 2ECNA 2EXUA 1K2FA 2Y1NA 3M7KA 3O47A 5J3XA 3FANA 3T9KA 3O70A 1WFKA 3SOUA 5G05B 4OGCA 3NG2A 2QICA 2CONA 3N9MA 1DVPA 2HDPA 3DWDA 5SVIB 3U5PA 3O7AA 1V87A 2C2LA 3T7LA 3LDYA 2PUYA 2ECGA 5FB0A 1WEVA 3ZVZB 3EB6A 2XOYA 2Y43A 4FK5A 2KE1A 2MD8C 5TRBA 2YQMA 5C11A 2YT5A 4YABA 2CSZA 3M62A 1G25A 2FUUA 2LDRA 2H0DA 2DSMA 4YBTA 2YHOA 2CRRA 1JM7B 3SHBA 3LQJA 4I7BA 2YYRA 4YBSA 1FP0A 3E2DA 2G45A 2LGKA 3FJUB 4A4CA 4AP4A 4MVTA 3Q1DA 3N9PA 4A49A 5D1KB 3ZYQA 1X4JA 3MHHA 4QF2A 1WE9A 2VPGA 4TKPB 5LKXA 3H7HA 2XB1A 4YADA 2MIQA 3HCSA 3O37A 5DKAA 2CSYA 2G43A 1WEPA 2XEUA 2F6NA 4A0CD 3C5KA 5SVXA 2LGVA 5FERA 4AYCA 1WGMA 2VPBA 5EYAF 2LAUA 2YSMA 2I50A 4GNDA 4AUQB 4WA6A 5LKZA 2M3HA 2IDAA 2K4DA 4R8PK 2Y1MA 5H1UA 2L0BA 3KV6A 2VPEA 4XI1A 5B77A 1BORA 3O33A 3FEHA 4ZUXU 2EGPA 2YUCA 2VJEA 4GNFA 4ZQLA 3PURA 5DINA 1LDKC 2L7PA 2KYUA 3O34A 2KWOA 3ZPVE 1WEMA 5FB1A 2LV9A 4YC9A 5H1TA 3U5MA 4I7DA 3MHSA 2LGGA 2M13A 2ECVA 2ECWA 2UZGA 1WEOA 4LJNA 3L1ZB 1LDJB 1MM2A 1WILA 3PLWA 3L1XA 4C9ZA 3ZVYA 1X4UA 2FFWA 5C13A 3KDEC 2C2VS 2OXQC 2ECJA 4F1PA 2KIZA 2YREA 1HYJA 3O36A 4FJCA 2VPDA 3V43A 2CKLA 3GL6A 2YSJA 4QQ4A 3LJUX 4LK9A 4QF3A 2K17A 5D1MB 2L80A 2JMIA 3M63A 1WEEA 4FIPA 1E4UA 3FAOA 5KH3A 3N9LA 1WESA 4PTBA 3HCUA 2F42A 4LADB 4CA1A 2EODA 2M1RA 5B76A 5TBNA 3IHPA 3DQVR 4L58A 2KREA 2XP0A 4X3GA 3DDTA 5H1VA 2KFTA 2D8UA 4BHWA 5SVIA 1MBMA 4R7EA 3VK6A 5G0FA 3FM8C 2YU4A 4Q6FA 2VJFA 4ZDTA 4N3WA 2CT2A 2ZETC 4LKAA 3KV5A 4UP5A 2G6QA 3L11A 5B79A 2JM3A 4Z0RA 1Z2QA 1WENA 4B86C 1WEWA 5B8DA 4UI9B 2YW8A 5B75A 1JM7A
chains in the Genus database with same CATH topology
2JRJA 3U5OA 2LQ6A 2MT5A 5B78A 4MSXA 3N9QA 2MD7B 4W4UA 2K1JA 1RMDA 2EA6A 1F62A 2MNYA 4AVXA 5D1LB 3I2DA 4V3KC 2CKLB 4GB0A 2ECIA 2FSAA 5LCWB 4BBQA 3ASLA 3EB5A 3HTKC 5TDWA 4B7YC 2YQLA 2KWKA 2AN6A 1HYIA 2NAAA 3SOXA 2H0DB 2KGIA 3FL2A 3GV4A 2KR4A 4V3LC 2ECTA 5TABA 4S3OC 1VYXA 3RPGB 4I7CA 5LKUA 5AIUA 4S3OB 4O64A 2KU3A 4R2YA 4A4BA 4GNEA 2KWNA 3RTRB 3LRQA 2E6SA 4P5OB 4YAXA 2JMDA 3O35A 1VD4A 3KQIA 2RSDA 4YBMA 5KH7A 3PUQA 4AYCB 2HYED 1XWHA 3LQIA 5FEYA 2MUMA 5H9MA 2VJFB 2LXPC 3ZNIA 2VNFA 1CHCA 2BAYA 4NN2A 1X4IA 2LXHC 4FO9A 1IYMA 2RI7A 2KGGA 4LLBA 2DX8A 2LN0A 4UP0A 2L5UA 3N9NA 4WZ2A 5JG6A 3N9OA 2L75A 2D8SA 2M6MA 2VJEB 3ZPV1 2LRIC 3M99A 1WIMA 3HCTA 1FBVA 5I3LA 3C6WA 4N4FA 4YATA 2MA6A 3SOWA 5AITA 1Z6UA 1WEUA 2QIZA 3KNVA 2L43A 1MM3A 1Z60A 5TDRA 4CCGX 2K16A 2FUIA 4IC3A 2YHNA 4F52B 1WEQA 3ZTGA 2JMJA 4PPEA 4IC2A 4WZ0A 2MA5A 1T1HA 2LGLA 5KH9A 5LKTA 2E6RA 2YURA 3DPLR 1ZBDB 2MNZA 2QJ0A 1JOCA 1U6GB 1VFYA 2F6JA 4L7XA 3QZVA 2KWJA 3PHDA 2VP7A 2M85A 1N87A 2PNXA 4WZ3B 3U5NA 3LQHA 3T6RA 4GNGA 5G04B 3RPGC 2ECNA 1K2FA 2Y1NA 5J3XA 3O70A 1WFKA 3SOUA 5G05B 3NG2A 2QICA 3N9MA 1DVPA 2HDPA 3U5PA 3O7AA 1V87A 2C2LA 3T7LA 2PUYA 2ECGA 5FB0A 1WEVA 3ZVZB 3EB6A 2Y43A 4FK5A 2KE1A 2MD8C 5TRBA 2YQMA 5C11A 2YT5A 4YABA 2CSZA 3M62A 1G25A 2FUUA 2LDRA 2H0DA 4YBTA 2YHOA 1JM7B 3SHBA 3LQJA 4I7BA 2YYRA 4YBSA 1FP0A 2G45A 2LGKA 4A4CA 4AP4A 4MVTA 3N9PA 4A49A 5D1KB 3ZYQA 1X4JA 3MHHA 4QF2A 1WE9A 2VPGA 4TKPB 5LKXA 2XB1A 4YADA 2MIQA 3HCSA 3O37A 5DKAA 2CSYA 2G43A 1WEPA 2XEUA 2F6NA 4A0CD 3C5KA 2LGVA 5FERA 4AYCA 1WGMA 2VPBA 5EYAF 2YSMA 2I50A 4GNDA 4AUQB 4WA6A 5LKZA 2M3HA 2IDAA 2K4DA 4R8PK 2Y1MA 5H1UA 2L0BA 3KV6A 2VPEA 4XI1A 5B77A 1BORA 3O33A 4ZUXU 2EGPA 2YUCA 2VJEA 4GNFA 4ZQLA 3PURA 5DINA 1LDKC 2KYUA 3O34A 2KWOA 3ZPVE 1WEMA 5FB1A 2LV9A 4YC9A 5H1TA 3U5MA 4I7DA 3MHSA 2LGGA 2ECVA 2ECWA 2UZGA 1WEOA 4LJNA 3L1ZB 1LDJB 1MM2A 1WILA 3L1XA 4C9ZA 3ZVYA 1X4UA 5C13A 2C2VS 2OXQC 2ECJA 2KIZA 2YREA 1HYJA 3O36A 4FJCA 2VPDA 3V43A 2CKLA 3GL6A 2YSJA 4LK9A 4QF3A 2K17A 5D1MB 2L80A 2JMIA 3M63A 1WEEA 4FIPA 1E4UA 5KH3A 3N9LA 1WESA 4PTBA 3HCUA 2F42A 4LADB 4CA1A 2EODA 2M1RA 5B76A 5TBNA 3IHPA 3DQVR 4L58A 2KREA 4X3GA 5H1VA 2KFTA 4BHWA 4R7EA 3VK6A 5G0FA 2YU4A 4Q6FA 2VJFA 4ZDTA 4N3WA 2CT2A 2ZETC 4LKAA 3KV5A 4UP5A 2G6QA 3L11A 5B79A 1Z2QA 1WENA 4B86C 1WEWA 5B8DA 4UI9B 2YW8A 5B75A 1JM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRJ A;  3U5O A;  2LQ6 A;  2MT5 A;  5B78 A;  4MSX A;  3N9Q A;  2MD7 B;  4W4U A;  2K1J A;  1RMD A;  2EA6 A;  1F62 A;  2MNY A;  4AVX A;  5D1L B;  3I2D A;  4V3K C;  2CKL B;  4GB0 A;  2ECI A;  2FSA A;  5LCW B;  4BBQ A;  3ASL A;  3EB5 A;  3HTK C;  5TDW A;  4B7Y C;  2YQL A;  2KWK A;  2AN6 A;  1HYI A;  2NAA A;  3SOX A;  2H0D B;  2KGI A;  3FL2 A;  3GV4 A;  2KR4 A;  4V3L C;  2ECT A;  5TAB A;  4S3O C;  1VYX A;  3RPG B;  4I7C A;  5LKU A;  5AIU A;  4S3O B;  4O64 A;  2KU3 A;  4R2Y A;  4A4B A;  4GNE A;  2KWN A;  3RTR B;  3LRQ A;  2E6S A;  4P5O B;  4YAX A;  2JMD A;  3O35 A;  1VD4 A;  3KQI A;  2RSD A;  4YBM A;  5KH7 A;  3PUQ A;  4AYC B;  2HYE D;  1XWH A;  3LQI A;  5FEY A;  2MUM A;  5H9M A;  2VJF B;  2LXP C;  3ZNI A;  2VNF A;  1CHC A;  2BAY A;  4NN2 A;  1X4I A;  2LXH C;  4FO9 A;  1IYM A;  2RI7 A;  2KGG A;  4LLB A;  2DX8 A;  2LN0 A;  4UP0 A;  2L5U A;  3N9N A;  4WZ2 A;  5JG6 A;  3N9O A;  2L75 A;  2D8S A;  2M6M A;  2VJE B;  3ZPV 1;  2LRI C;  3M99 A;  1WIM A;  3HCT A;  1FBV A;  5I3L A;  3C6W A;  4N4F A;  4YAT A;  2MA6 A;  3SOW A;  5AIT A;  1Z6U A;  1WEU A;  2QIZ A;  3KNV A;  2L43 A;  1MM3 A;  1Z60 A;  5TDR A;  4CCG X;  2K16 A;  2FUI A;  4IC3 A;  2YHN A;  4F52 B;  1WEQ A;  3ZTG A;  2JMJ A;  4PPE A;  4IC2 A;  4WZ0 A;  2MA5 A;  1T1H A;  2LGL A;  5KH9 A;  5LKT A;  2E6R A;  2YUR A;  3DPL R;  1ZBD B;  2MNZ A;  2QJ0 A;  1JOC A;  1U6G B;  1VFY A;  2F6J A;  4L7X A;  3QZV A;  2KWJ A;  3PHD A;  2VP7 A;  2M85 A;  1N87 A;  2PNX A;  4WZ3 B;  3U5N A;  3LQH A;  3T6R A;  4GNG A;  5G04 B;  3RPG C;  2ECN A;  1K2F A;  2Y1N A;  5J3X A;  3O70 A;  1WFK A;  3SOU A;  5G05 B;  3NG2 A;  2QIC A;  3N9M A;  1DVP A;  2HDP A;  3U5P A;  3O7A A;  1V87 A;  2C2L A;  3T7L A;  2PUY A;  2ECG A;  5FB0 A;  1WEV A;  3ZVZ B;  3EB6 A;  2Y43 A;  4FK5 A;  2KE1 A;  2MD8 C;  5TRB A;  2YQM A;  5C11 A;  2YT5 A;  4YAB A;  2CSZ A;  3M62 A;  1G25 A;  2FUU A;  2LDR A;  2H0D A;  4YBT A;  2YHO A;  1JM7 B;  3SHB A;  3LQJ A;  4I7B A;  2YYR A;  4YBS A;  1FP0 A;  2G45 A;  2LGK A;  4A4C A;  4AP4 A;  4MVT A;  3N9P A;  4A49 A;  5D1K B;  3ZYQ A;  1X4J A;  3MHH A;  4QF2 A;  1WE9 A;  2VPG A;  4TKP B;  5LKX A;  2XB1 A;  4YAD A;  2MIQ A;  3HCS A;  3O37 A;  5DKA A;  2CSY A;  2G43 A;  1WEP A;  2XEU A;  2F6N A;  4A0C D;  3C5K A;  2LGV A;  5FER A;  4AYC A;  1WGM A;  2VPB A;  5EYA F;  2YSM A;  2I50 A;  4GND A;  4AUQ B;  4WA6 A;  5LKZ A;  2M3H A;  2IDA A;  2K4D A;  4R8P K;  2Y1M A;  5H1U A;  2L0B A;  3KV6 A;  2VPE A;  4XI1 A;  5B77 A;  1BOR A;  3O33 A;  4ZUX U;  2EGP A;  2YUC A;  2VJE A;  4GNF A;  4ZQL A;  3PUR A;  5DIN A;  1LDK C;  2KYU A;  3O34 A;  2KWO A;  3ZPV E;  1WEM A;  5FB1 A;  2LV9 A;  4YC9 A;  5H1T A;  3U5M A;  4I7D A;  3MHS A;  2LGG A;  2ECV A;  2ECW A;  2UZG A;  1WEO A;  4LJN A;  3L1Z B;  1LDJ B;  1MM2 A;  1WIL A;  3L1X A;  4C9Z A;  3ZVY A;  1X4U A;  5C13 A;  2C2V S;  2OXQ C;  2ECJ A;  2KIZ A;  2YRE A;  1HYJ A;  3O36 A;  4FJC A;  2VPD A;  3V43 A;  2CKL A;  3GL6 A;  2YSJ A;  4LK9 A;  4QF3 A;  2K17 A;  5D1M B;  2L80 A;  2JMI A;  3M63 A;  1WEE A;  4FIP A;  1E4U A;  5KH3 A;  3N9L A;  1WES A;  4PTB A;  3HCU A;  2F42 A;  4LAD B;  4CA1 A;  2EOD A;  2M1R A;  5B76 A;  5TBN A;  3IHP A;  3DQV R;  4L58 A;  2KRE A;  4X3G A;  5H1V A;  2KFT A;  4BHW A;  4R7E A;  3VK6 A;  5G0F A;  2YU4 A;  4Q6F A;  2VJF A;  4ZDT A;  4N3W A;  2CT2 A;  2ZET C;  4LKA A;  3KV5 A;  4UP5 A;  2G6Q A;  3L11 A;  5B79 A;  1Z2Q A;  1WEN A;  4B86 C;  1WEW A;  5B8D A;  4UI9 B;  2YW8 A;  5B75 A;  1JM7 A; 
#chains in the Genus database with same CATH topology
 2JRJ A;  3U5O A;  2LQ6 A;  2MT5 A;  5B78 A;  4MSX A;  3N9Q A;  2OWA A;  2MD7 B;  2JUN A;  4W4U A;  2K1J A;  1RMD A;  2EA6 A;  1F62 A;  2MNY A;  4AVX A;  5D1L B;  2CSV A;  3I2D A;  4V3K C;  2CKL B;  4GB0 A;  2KKY A;  4H9D A;  2ECI A;  2FSA A;  5LCW B;  4BBQ A;  3ASL A;  3EB5 A;  3HTK C;  5TDW A;  4B7Y C;  2YQL A;  2KWK A;  2AN6 A;  1HYI A;  2XOZ A;  2NAA A;  4O62 A;  3SOX A;  2H0D B;  4OGE A;  2KGI A;  3FL2 A;  3GV4 A;  2KR4 A;  4V3L C;  2ECT A;  5TAB A;  4S3O C;  1VYX A;  2KKX A;  3RPG B;  2MKE A;  4I7C A;  5LKU A;  5AIU A;  4S3O B;  4O64 A;  2KU3 A;  4R2Y A;  4A4B A;  4GNE A;  2KWN A;  3RTR B;  3LRQ A;  2E6S A;  4P5O B;  4YAX A;  2JMD A;  2YVR A;  3O35 A;  1VD4 A;  3KQI A;  2RSD A;  4YBM A;  4Z0O A;  2IQJ A;  5KH7 A;  3PUQ A;  4AYC B;  2HYE D;  1XWH A;  3LQI A;  5FEY A;  2MUM A;  5H9M A;  2VJF B;  2LXP C;  3SUB A;  3ZNI A;  2E61 A;  2VNF A;  1CHC A;  2BAY A;  4NN2 A;  1X4I A;  2LXH C;  4FO9 A;  1IYM A;  2RI7 A;  2KGG A;  4LLB A;  2DX8 A;  2LN0 A;  4UP0 A;  2L5U A;  2FD4 A;  3N9N A;  4WZ2 A;  5JG6 A;  3N9O A;  2L75 A;  2D8S A;  2M6M A;  3MDB C;  2DJA A;  2VJE B;  3ZPV 1;  2LRI C;  5K3Q A;  3M99 A;  1WIM A;  3HCT A;  1FBV A;  5I3L A;  2RR4 A;  2CRW A;  3C6W A;  4N4F A;  4YAT A;  2MA6 A;  3SOW A;  2EGM A;  5AIT A;  1Z6U A;  1WEU A;  2QIZ A;  3KNV A;  2L43 A;  1MM3 A;  1Z60 A;  5TDR A;  4CCG X;  2K16 A;  2FUI A;  3LVR E;  4IC3 A;  2YHN A;  2P57 A;  4F52 B;  1WEQ A;  3ZTG A;  2JMJ A;  1DCQ A;  4PPE A;  4IC2 A;  4WZ0 A;  2MA5 A;  1T1H A;  2LGL A;  5KH9 A;  5LKT A;  2E6R A;  2YUR A;  3DPL R;  1ZBD B;  3LVQ E;  2MNZ A;  2QJ0 A;  1JOC A;  1U6G B;  1VFY A;  2F6J A;  4L7X A;  3QZV A;  2KWJ A;  3PHD A;  2VP7 A;  2M85 A;  1N87 A;  2PNX A;  2XOC A;  4WZ3 B;  5SVY A;  3U5N A;  3LQH A;  3T6R A;  2B0O E;  4GNG A;  5G04 B;  3RPG C;  3JUE A;  2ECN A;  2EXU A;  1K2F A;  2Y1N A;  3M7K A;  3O47 A;  5J3X A;  3FAN A;  3T9K A;  3O70 A;  1WFK A;  3SOU A;  5G05 B;  4OGC A;  3NG2 A;  2QIC A;  2CON A;  3N9M A;  1DVP A;  2HDP A;  3DWD A;  5SVI B;  3U5P A;  3O7A A;  1V87 A;  2C2L A;  3T7L A;  3LDY A;  2PUY A;  2ECG A;  5FB0 A;  1WEV A;  3ZVZ B;  3EB6 A;  2XOY A;  2Y43 A;  4FK5 A;  2KE1 A;  2MD8 C;  5TRB A;  2YQM A;  5C11 A;  2YT5 A;  4YAB A;  2CSZ A;  3M62 A;  1G25 A;  2FUU A;  2LDR A;  2H0D A;  2DSM A;  4YBT A;  2YHO A;  2CRR A;  1JM7 B;  3SHB A;  3LQJ A;  4I7B A;  2YYR A;  4YBS A;  1FP0 A;  3E2D A;  2G45 A;  2LGK A;  3FJU B;  4A4C A;  4AP4 A;  4MVT A;  3Q1D A;  3N9P A;  4A49 A;  5D1K B;  3ZYQ A;  1X4J A;  3MHH A;  4QF2 A;  1WE9 A;  2VPG A;  4TKP B;  5LKX A;  3H7H A;  2XB1 A;  4YAD A;  2MIQ A;  3HCS A;  3O37 A;  5DKA A;  2CSY A;  2G43 A;  1WEP A;  2XEU A;  2F6N A;  4A0C D;  3C5K A;  5SVX A;  2LGV A;  5FER A;  4AYC A;  1WGM A;  2VPB A;  5EYA F;  2LAU A;  2YSM A;  2I50 A;  4GND A;  4AUQ B;  4WA6 A;  5LKZ A;  2M3H A;  2IDA A;  2K4D A;  4R8P K;  2Y1M A;  5H1U A;  2L0B A;  3KV6 A;  2VPE A;  4XI1 A;  5B77 A;  1BOR A;  3O33 A;  3FEH A;  4ZUX U;  2EGP A;  2YUC A;  2VJE A;  4GNF A;  4ZQL A;  3PUR A;  5DIN A;  1LDK C;  2L7P A;  2KYU A;  3O34 A;  2KWO A;  3ZPV E;  1WEM A;  5FB1 A;  2LV9 A;  4YC9 A;  5H1T A;  3U5M A;  4I7D A;  3MHS A;  2LGG A;  2M13 A;  2ECV A;  2ECW A;  2UZG A;  1WEO A;  4LJN A;  3L1Z B;  1LDJ B;  1MM2 A;  1WIL A;  3PLW A;  3L1X A;  4C9Z A;  3ZVY A;  1X4U A;  2FFW A;  5C13 A;  3KDE C;  2C2V S;  2OXQ C;  2ECJ A;  4F1P A;  2KIZ A;  2YRE A;  1HYJ A;  3O36 A;  4FJC A;  2VPD A;  3V43 A;  2CKL A;  3GL6 A;  2YSJ A;  4QQ4 A;  3LJU X;  4LK9 A;  4QF3 A;  2K17 A;  5D1M B;  2L80 A;  2JMI A;  3M63 A;  1WEE A;  4FIP A;  1E4U A;  3FAO A;  5KH3 A;  3N9L A;  1WES A;  4PTB A;  3HCU A;  2F42 A;  4LAD B;  4CA1 A;  2EOD A;  2M1R A;  5B76 A;  5TBN A;  3IHP A;  3DQV R;  4L58 A;  2KRE A;  2XP0 A;  4X3G A;  3DDT A;  5H1V A;  2KFT A;  2D8U A;  4BHW A;  5SVI A;  1MBM A;  4R7E A;  3VK6 A;  5G0F A;  3FM8 C;  2YU4 A;  4Q6F A;  2VJF A;  4ZDT A;  4N3W A;  2CT2 A;  2ZET C;  4LKA A;  3KV5 A;  4UP5 A;  2G6Q A;  3L11 A;  5B79 A;  2JM3 A;  4Z0R A;  1Z2Q A;  1WEN A;  4B86 C;  1WEW A;  5B8D A;  4UI9 B;  2YW8 A;  5B75 A;  1JM7 A; 
#chains in the Genus database with same CATH homology
 2JRJ A;  3U5O A;  2LQ6 A;  2MT5 A;  5B78 A;  4MSX A;  3N9Q A;  2MD7 B;  4W4U A;  2K1J A;  1RMD A;  2EA6 A;  1F62 A;  2MNY A;  4AVX A;  5D1L B;  3I2D A;  4V3K C;  2CKL B;  4GB0 A;  2ECI A;  2FSA A;  5LCW B;  4BBQ A;  3ASL A;  3EB5 A;  3HTK C;  5TDW A;  4B7Y C;  2YQL A;  2KWK A;  2AN6 A;  1HYI A;  2NAA A;  3SOX A;  2H0D B;  2KGI A;  3FL2 A;  3GV4 A;  2KR4 A;  4V3L C;  2ECT A;  5TAB A;  4S3O C;  1VYX A;  3RPG B;  4I7C A;  5LKU A;  5AIU A;  4S3O B;  4O64 A;  2KU3 A;  4R2Y A;  4A4B A;  4GNE A;  2KWN A;  3RTR B;  3LRQ A;  2E6S A;  4P5O B;  4YAX A;  2JMD A;  3O35 A;  1VD4 A;  3KQI A;  2RSD A;  4YBM A;  5KH7 A;  3PUQ A;  4AYC B;  2HYE D;  1XWH A;  3LQI A;  5FEY A;  2MUM A;  5H9M A;  2VJF B;  2LXP C;  3ZNI A;  2VNF A;  1CHC A;  2BAY A;  4NN2 A;  1X4I A;  2LXH C;  4FO9 A;  1IYM A;  2RI7 A;  2KGG A;  4LLB A;  2DX8 A;  2LN0 A;  4UP0 A;  2L5U A;  3N9N A;  4WZ2 A;  5JG6 A;  3N9O A;  2L75 A;  2D8S A;  2M6M A;  2VJE B;  3ZPV 1;  2LRI C;  3M99 A;  1WIM A;  3HCT A;  1FBV A;  5I3L A;  3C6W A;  4N4F A;  4YAT A;  2MA6 A;  3SOW A;  5AIT A;  1Z6U A;  1WEU A;  2QIZ A;  3KNV A;  2L43 A;  1MM3 A;  1Z60 A;  5TDR A;  4CCG X;  2K16 A;  2FUI A;  4IC3 A;  2YHN A;  4F52 B;  1WEQ A;  3ZTG A;  2JMJ A;  4PPE A;  4IC2 A;  4WZ0 A;  2MA5 A;  1T1H A;  2LGL A;  5KH9 A;  5LKT A;  2E6R A;  2YUR A;  3DPL R;  1ZBD B;  2MNZ A;  2QJ0 A;  1JOC A;  1U6G B;  1VFY A;  2F6J A;  4L7X A;  3QZV A;  2KWJ A;  3PHD A;  2VP7 A;  2M85 A;  1N87 A;  2PNX A;  4WZ3 B;  3U5N A;  3LQH A;  3T6R A;  4GNG A;  5G04 B;  3RPG C;  2ECN A;  1K2F A;  2Y1N A;  5J3X A;  3O70 A;  1WFK A;  3SOU A;  5G05 B;  3NG2 A;  2QIC A;  3N9M A;  1DVP A;  2HDP A;  3U5P A;  3O7A A;  1V87 A;  2C2L A;  3T7L A;  2PUY A;  2ECG A;  5FB0 A;  1WEV A;  3ZVZ B;  3EB6 A;  2Y43 A;  4FK5 A;  2KE1 A;  2MD8 C;  5TRB A;  2YQM A;  5C11 A;  2YT5 A;  4YAB A;  2CSZ A;  3M62 A;  1G25 A;  2FUU A;  2LDR A;  2H0D A;  4YBT A;  2YHO A;  1JM7 B;  3SHB A;  3LQJ A;  4I7B A;  2YYR A;  4YBS A;  1FP0 A;  2G45 A;  2LGK A;  4A4C A;  4AP4 A;  4MVT A;  3N9P A;  4A49 A;  5D1K B;  3ZYQ A;  1X4J A;  3MHH A;  4QF2 A;  1WE9 A;  2VPG A;  4TKP B;  5LKX A;  2XB1 A;  4YAD A;  2MIQ A;  3HCS A;  3O37 A;  5DKA A;  2CSY A;  2G43 A;  1WEP A;  2XEU A;  2F6N A;  4A0C D;  3C5K A;  2LGV A;  5FER A;  4AYC A;  1WGM A;  2VPB A;  5EYA F;  2YSM A;  2I50 A;  4GND A;  4AUQ B;  4WA6 A;  5LKZ A;  2M3H A;  2IDA A;  2K4D A;  4R8P K;  2Y1M A;  5H1U A;  2L0B A;  3KV6 A;  2VPE A;  4XI1 A;  5B77 A;  1BOR A;  3O33 A;  4ZUX U;  2EGP A;  2YUC A;  2VJE A;  4GNF A;  4ZQL A;  3PUR A;  5DIN A;  1LDK C;  2KYU A;  3O34 A;  2KWO A;  3ZPV E;  1WEM A;  5FB1 A;  2LV9 A;  4YC9 A;  5H1T A;  3U5M A;  4I7D A;  3MHS A;  2LGG A;  2ECV A;  2ECW A;  2UZG A;  1WEO A;  4LJN A;  3L1Z B;  1LDJ B;  1MM2 A;  1WIL A;  3L1X A;  4C9Z A;  3ZVY A;  1X4U A;  5C13 A;  2C2V S;  2OXQ C;  2ECJ A;  2KIZ A;  2YRE A;  1HYJ A;  3O36 A;  4FJC A;  2VPD A;  3V43 A;  2CKL A;  3GL6 A;  2YSJ A;  4LK9 A;  4QF3 A;  2K17 A;  5D1M B;  2L80 A;  2JMI A;  3M63 A;  1WEE A;  4FIP A;  1E4U A;  5KH3 A;  3N9L A;  1WES A;  4PTB A;  3HCU A;  2F42 A;  4LAD B;  4CA1 A;  2EOD A;  2M1R A;  5B76 A;  5TBN A;  3IHP A;  3DQV R;  4L58 A;  2KRE A;  4X3G A;  5H1V A;  2KFT A;  4BHW A;  4R7E A;  3VK6 A;  5G0F A;  2YU4 A;  4Q6F A;  2VJF A;  4ZDT A;  4N3W A;  2CT2 A;  2ZET C;  4LKA A;  3KV5 A;  4UP5 A;  2G6Q A;  3L11 A;  5B79 A;  1Z2Q A;  1WEN A;  4B86 C;  1WEW A;  5B8D A;  4UI9 B;  2YW8 A;  5B75 A;  1JM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...