5FB1A

Crystal structure of a phd finger bound to histone h3 k9me3 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
174
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYGPQKPMWLNKVKTSLNEQTYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear autoantigen Sp-100
publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
total genus 57
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb1A01
4HBXA 4YADA 4ALGA 4UIYA 2ZETC 5FH6A 5A5PA 2Y43A 4LR6A 4NQNA 5DKCA 4OGJA 4YYNA 5EQ1A 4YY6A 4CUQA 3MXFA 5C87A 2CSZA 4YYIA 3LQHA 5F3AA 3T7LA 5F2PA 5G4RA 4LLBA 4LZ2A 3IU5A 5HCLA 2RI7A 3O37A 4IC2A 5B75A 5ENBA 4I7DA 1WEQA 2L5EA 3L1ZB 2K17A 5ENIA 1LDJB 2YEMA 5F63A 1Z60A 1JM7A 2UZGA 5D3LA 3TLPA 5ENCA 1WEVA 4UP0A 5FE6A 4YBTA 2ECWA 4HXNA 5FFYA 2Y1NA 5DFCA 4KV4A 5FB1A 3HTKC 4QSWA 2WP2A 4MR3A 4CFKA 4NR6A 3O7AA 5H9MA 2ECTA 1IYMA 3L1XA 3N9OA 3JVMA 4S3OC 5D1KB 3SHBA 4IOQA 4YAXA 5TDWA 4LYSA 4ZW1A 4QBMA 2RNXA 5II1A 4YY4A 4UIXA 5L98A 4Q0NA 1WGMA 2ECVA 3RPGC 5ETBA 2PNXA 5DYAA 4UP5A 2IDAA 3PUQA 3AQAA 4QSVA 5BT4A 2DVQA 5CU8A 4XI1A 5IG6A 5E9MA 5I89A 3DQVR 2G4AA 5CRMA 2FUUA 1WEOA 5L8TA 2FUIA 3SOUA 4QYDA 5D3NA 4ALHA 3UVYA 4GNEA 5B76A 5EK9A 5CZGA 4UYDA 4F3IA 3P1DA 1WIMA 5KH3A 2RFJA 4HXMA 4NXJA 5COIA 1WEWA 2JMIA 4FJCA 4YC9A 4I7BA 4O7BA 2YREA 4P5OB 2DVSA 2BAYA 4V3LC 4QY4A 5C4QA 4FIPA 5LVQA 1BORA 5DY7A 4A4CA 4N4IA 2D9EA 5FERA 2NXBA 4CA1A 1VYXA 5F1LA 5A81A 4NN2A 2GRCA 4QSXA 5EWCA 2VPBA 2OO1A 5CTLA 5FE9A 3T6RA 5KTUA 5A7CA 5AIUA 3MHSA 2LXHC 4YYHA 2KIZA 5D3TA 2KGIA 2LGGA 4A9LA 1WEPA 2M6MA 2YUCA 5E0RA 4QF2A 4OUFA 2YDWA 5CQ3A 3ZPVE 2R10A 3ZVYA 5EI4A 4PCIA 1X4UA 1X0JA 1WFKA 4CUPA 4UIZA 5CUCA 4XUAA 3UVWA 2ECJA 3S91A 2LRIC 4BW3A 5IGKA 2YEKA 4QUTA 5DINA 4MR5A 5DLXA 1JM4B 5G0FA 4CUUA 3FKMX 4ZC9A 5ENHA 2YURA 4PKLA 5EICA 3N9LA 3RTRB 2G43A 2LN0A 4WZ0A 5CQ8A 2PUYA 4MR6A 4NUDA 4AP4A 5I7YA 5L99A 4Q0OA 4HBVA 2KWNA 3V43A 4WZ3B 4HXLA 5DKAA 2MA6A 3Q2FA 5DYUA 4IORA 2ECNA 4S3OB 2D8SA 4QYLA 3Q2EA 5FEYA 5EVAA 5HQ7A 2K16A 5DW1A 4QC3A 4QEVA 5DYXA 5D3RA 3LRQA 4FK5A 5DBMA 4AVXA 4N4FA 1VD4A 5CY9A 1V87A 5CQ6A 1ZBDB 4IOOA 5C8GA 5LJ1A 4A49A 3ZPV1 4UYEA 5E9IA 5I7XA 2H0DA 4TZ2A 4WHWA 1U6GB 2DVRA 5FG5A 4OGIA 4WA6A 2I7KA 1F68A 2LGVA 3U5NA 5KU3A 2M3HA 5A5RA 3ZNIA 1E6IA 5FFVA 4O78A 4NRCA 5I83A 4Z1QA 1X4IA 3IHPA 4W4UA 4N4GA 5II2A 5IGMA 4MVTA 5D3SA 5AD2A 5FH8A 5CQ7A 4I7CA 5JWMA 4HXKA 3JVJA 2KWOA 2LGKA 4O64A 5I3LA 4O7FA 4CL9A 3P1EA 4NR5A 2KE1A 2MT5A 2YSMA 5F1HA 3KQIA 4FO9A 5L97A 4Z1SA 4LJNA 5D3HA 4J3IA 2E6SA 4WZ2A 3JVKA 5ACYA 1WEEA 1Z2QA 2CKLB 4IC3A 3IU6A 5F25A 4QZSA 5E3DA 3ZVZB 3U5OA 3MQMA 2YHOA 2ECIA 3HCUA 4Z6IA 3UW9A 5B8DA 4GPJA 2MA5A 3L11A 4A4BA 4XY9A 4L58A 3QZSA 4R2YA 4F52B 4HBWA 4A9OA 5D0CA 4AYCA 3MUKA 5CRZA 3MULA 4XYAA 4TU6A 4J1PA 4CURA 3KNVA 2N9GA 2JMDA 5JG6A 4N4HA 4YBMA 5HLSA 5J0DA 1WILA 2L0BA 5A82A 2WP1A 4PY6A 5E3GA 3KV5A 4DONA 3HCTA 3O70A 4LYIA 4L7XA 5HEMA 4A9FA 4O71A 4MENA 1G25A 3U5JA 4O7EA 2OXQC 5DYCA 4PCEA 2YQMA 4J0RA 5E7DA 4A9MA 4KV1A 3P5OA 4PS5A 2JMJA 5F5ZA 4LK9A 5I40A 4ZDTA 4WIVA 3HMFA 4C66A 5I80A 4GNGA 5E9LA 5A85A 5E73A 2I8NA 2F6JA 1XWHA 5HQ5A 3I2DA 4YH4A 5LJ0A 4CFLA 5CQTA 2YSJA 3M99A 3UV5A 5FFWA 2DATA 4LRGA 5CQ4A 4BW4A 4UIVA 4CUTA 5A5QA 5AD3A 4AUQB 5F36A 1WENA 2EGPA 2KR4A 3PURA 3MB4A 5C89A 2VJFB 4O77A 3VK6A 4MR4A 5BT3A 1VFYA 4NR9A 2KYUA 2LXPC 2KGGA 5CUAA 1JOCA 4O75A 4MEOA 4GB0A 4LKAA 5FE4A 5KTWA 1JM7B 2QJ0A 5L8UA 4A9JA 4A9NA 3N9NA 5D25A 4O7CA 4NUCA 3M62A 3O35A 4NYVA 3GG3A 5KH7A 4UYHA 4Z6HA 5DFBA 5TABA 4NR7A 5FB0A 1WEMA 2KFTA 5EISA 4NUEA 5IGLA 2JRJA 5CGPA 3U5PA 4TT6A 5E9YA 5LJ2A 3NXBA 4R8PK 4QSTA 5FE8A 3N9MA 2VPGA 2VJEB 4B7YC 4KCXA 2R0SA 5G05B 2MIQA 5EWDA 2LGLA 3SVHA 3AADA 5CS8A 2QIZA 5J3XA 4QSPA 5HQ6A 2G6QA 5AITA 4CCGX 1HYJA 3NG2A 4GNDA 4WHUA 4HXSA 5TCMA 2YQDA 4UI9B 3ASLA 5LKXA 2M1RA 4QSUA 5EWVA 5CUEA 5CQAA 3RCWA 1WE9A 2K1JA 4HXRA 4Q6FA 5C7NA 3SOXA 4BW1A 5H1UA 4FLPA 5H85A 4PTBA 4B86C 2CKLA 2NAAA 4R7EA 5TB6A 1JSPB 5EA1A 3RPGB 5FE2A 4TYLA 4QR5A 5DKDA 4MEQA 4QC1A 4QR4A 4ZQLA 5FE0A 5HRXA 5I29A 2LDRA 3KV6A 4AKNA 3QZVA 4YATA 5JI8A 2C2LA 5C13A 4QSSA 5EGUA 5I88A 3LXJA 4BW2A 4LYWA 5A5NA 5K29A 2MNZA 5KHMA 4A9KA 2KWJA 2LQ6A 3C5KA 5LVRA 3D7CA 4XUBA 4C67A 3P1CA 3UV4A 3U5MA 5CUDA 4IR6A 5EPSA 5IGNA 2MD7B 5FDZA 2QICA 2F6NA 2E7NA 2VNFA 3HCSA 4TKPB 4X2IA 1K2FA 5KH9A 2ECGA 4YABA 5AMEA 5D1LB 5EWHA 2R0YA 2LV9A 3MHHA 5EWWA 2F42A 4TT4A 4UYFB 4NS5A 2L84A 3LQIA 4LDFA 2RS9B 5C11A 3N9QA 5I1QA 3G0LA 3I3JA 4NRBA 4UYGA 4UITA 5LKUA 4N3WA 2RNWA 2Y1MA 2VPEA 3PHDA 5E9KA 4A9HA 4NYWA 2L80A 2YT5A 5AMFA 2CSYA 3LJWA 5DX4A 4CUSA 5FE7A 2XB1A 5HRVA 2YW8A 5D1MB 5TBNA 5HELA 2VJFA 4BHWA 5I86A 4Z93A 5HFQA 4YYKA 4MSXA 2D82A 1ZS5A 1T1HA 3C6WA 3FL2A 5F60A 5EPBA 2R0VA 3U5KA 4BJXA 2AN6A 2VPDA 4V3KC 5LCWB 4UIWA 2L85A 2MD8C 4YBSA 2L75A 2MNYA 2YYRA 5DW2A 2E3KA 2YELA 5EYAF 4LZSA 1X4JA 2OUOA 4TS8A 3N9PA 4LZRA 5C85A 5KTXA 5A5SA 5D3JA 5EM3A 1WEUA 4X3GA 4BBQA 2DVVA 2H0DB 4YH3A 5KO4A 5EP7A 4IR5A 4TT2A 5CQ5A 1MM2A 2VJEA 3M63A 1N72A 5CUBA 3MB3A 4YYDA 1FP0A 4YK0A 4O70A 2KU3A 5HRWA 1CHCA 3U5LA 5E74A 4YYJA 3UVDA 2RSDA 4YYMA 2EODA 2YW5A 5ENFA 1MM3A 5LUUA 3DPLR 4Y03A 5D7XA 5EU1A 5FG4A 5FE5A 5D3PA 5FE3A 4PPEA 2DKWA 4O72A 5ENEA 5A5OA 5H1VA 3ZTGA 5ETDA 5EPRA 4NR8A 4YYGA 1F62A 4A9IA 2L43A 4LADB 4GNFA 5HENA 1LDKC 5HJCA 4A0CD 4QUUA 5B79A 5DFDA 2MUMA 5H1TA 5FE1A 4TZ8A 2KREA 4TTEA 3O34A 4J0SA 5HFRA 3ZYUA 2KWKA 2YQLA 4XY8A 5L96A 5B77A 2OSSA 4AYCB 1N87A 2FSAA 3O33A 3G0JA 2RNYA 3SOWA 3SVGA 4C9ZA 3HMEA 5EV9A 4QNSA 2HDPA 5CFWA 4O74A 2RO1A 4QSRA 2E6RA 1FBVA 2H60A 4IR4A 2M85A 2L5UA 4NRAA 3UV2A 3UVXA 4LC2A 2DX8A 1E4UA 1WUMA 5BT5A 2YU4A 5FH7A 3ZYQA 5CUGA 4QEWA 4QEUA 3K2JA 2G45A 4UYFA 1RMDA 1WUGA 4A9EA 4O76A 1EQFA 5HM0A 1DVPA 2CT2A 5A83A 3S92A 2C2VS 2E7OA 5DKHA 4HXPA 5D24A 5ENJA 4NR4A 5FBXA 5LKTA 2YHNA 2VP7A 4QF3A 4QR3A 5CPEA 5TDRA 4NQMA 2DWWA 2LSPB 2YYNA 3JVLA 4RVRA 4TQNA 1HYIA 3SVFA 1WESA 3ONIA 5G4SA 3EB5A 5ENGA 5LKZA 3EB6A 3O36A 5CP5A 4HBYA 4IR3A 2K4DA 4TU4A 4UIUA 4MEPA 5IBNA 5E9VA 3LQJA 5D26A 5FG6A 2I50A 2XEUA 3P1FA 2KTBB 4O7AA 4ZUXU 3DWYA 5G04B 4HXOA 3QZTA 5DLZA 5F61A 3DAIA 3HMHA 1Z6UA 4CLBA 5B78A 5F62A 4NYXA 2EA6A 4QB3A 2MJVB 5IIDA 4E96A 4QSQA 3GV4A 3GL6A 2HYED 5TRBA
chains in the Genus database with same CATH superfamily
4HBXA 4YADA 4ALGA 2YVRA 4UIYA 2ZETC 5FH6A 5A5PA 2Y43A 4O62A 4LR6A 4NQNA 5DKCA 4OGJA 4YYNA 5EQ1A 4YY6A 4CUQA 3MXFA 5C87A 2CSZA 4YYIA 3LQHA 5F3AA 3T7LA 5F2PA 5G4RA 4LLBA 4LZ2A 3IU5A 5HCLA 2RI7A 3O37A 4AKHA 4IC2A 5ENBA 5B75A 4I7DA 1WEQA 2L5EA 3L1ZB 2K17A 5ENIA 1LDJB 2YEMA 5F63A 1Z60A 1JM7A 2UZGA 4OGCA 5D3LA 3TLPA 5ENCA 1WEVA 4UP0A 3T9KA 5FE6A 4YBTA 2ECWA 4HXNA 5FFYA 2Y1NA 5DFCA 4KV4A 5FB1A 3HTKC 4QSWA 2WP2A 4MR3A 4CFKA 4NR6A 3O7AA 5H9MA 2ECTA 1IYMA 3L1XA 3N9OA 3JVMA 4S3OC 5D1KB 3SHBA 4IOQA 4YAXA 5TDWA 4LYSA 4ZW1A 4QBMA 2RNXA 5II1A 4YY4A 1DCQA 4UIXA 5L98A 4Q0NA 1WGMA 2ECVA 3RPGC 5ETBA 2PNXA 2XOCA 5DYAA 4UP5A 2IDAA 3PUQA 3AQAA 4QSVA 5BT4A 2DVQA 5CU8A 4XI1A 5IG6A 5E9MA 5I89A 3DQVR 2G4AA 5CRMA 2FUUA 1WEOA 5L8TA 2FUIA 3SOUA 4QYDA 5D3NA 4ALHA 3UVYA 4GNEA 5B76A 5EK9A 5CZGA 4UYDA 2DJAA 4F3IA 3P1DA 1WIMA 3FAOA 5KH3A 2RFJA 4HXMA 4NXJA 5COIA 4AKGA 1WEWA 2EXUA 2JMIA 4YC9A 4FJCA 4O7BA 2YREA 4I7BA 4P5OB 2DVSA 2BAYA 4V3LC 4QY4A 5C4QA 4FIPA 5LVQA 1BORA 5DY7A 4A4CA 4N4IA 2D9EA 5FERA 2NXBA 4CA1A 1VYXA 5F1LA 5A81A 4NN2A 2GRCA 4QSXA 5EWCA 2VPBA 2OO1A 5CTLA 5FE9A 3T6RA 5KTUA 5A7CA 5AIUA 2XOZA 3MHSA 2LXHC 4YYHA 2KIZA 5D3TA 2KGIA 2LGGA 4A9LA 1WEPA 2M6MA 2YUCA 5E0RA 4QF2A 4OUFA 2YDWA 5CQ3A 3ZPVE 2R10A 3ZVYA 5EI4A 4PCIA 1X4UA 1X0JA 1WFKA 4CUPA 4UIZA 5CUCA 4XUAA 3UVWA 2ECJA 3S91A 2LRIC 4BW3A 5IGKA 2YEKA 4QUTA 5DINA 4MR5A 5DLXA 1JM4B 5G0FA 4CUUA 3FKMX 4ZC9A 5ENHA 2YURA 4PKLA 5EICA 3N9LA 3RTRB 2G43A 2LN0A 4WZ0A 5CQ8A 2PUYA 4MR6A 4NUDA 4AI6A 4AP4A 5I7YA 5L99A 4Q0OA 1PUOA 4HBVA 2KWNA 3V43A 4WZ3B 4HXLA 5DKAA 2MA6A 3Q2FA 5DYUA 4IORA 2ECNA 4S3OB 2D8SA 4QYLA 3Q2EA 5FEYA 5EVAA 5HQ7A 2K16A 5DW1A 4QC3A 4QEVA 5DYXA 5D3RA 3LRQA 4FK5A 5DBMA 4AVXA 4N4FA 1VD4A 5CY9A 1V87A 5CQ6A 1ZBDB 4IOOA 5C8GA 2CRWA 5LJ1A 4A49A 3ZPV1 4UYEA 5E9IA 5I7XA 2H0DA 4TZ2A 4WHWA 1U6GB 2DVRA 5FG5A 4OGIA 4WA6A 2I7KA 1F68A 2LGVA 3U5NA 1ZKRA 5KU3A 5A5RA 2JUNA 2M3HA 1E6IA 3ZNIA 3ERRA 5FFVA 4O78A 4NRCA 5I83A 4Z1QA 1X4IA 3IHPA 4W4UA 4N4GA 2FFWA 5II2A 5IGMA 4MVTA 5D3SA 5AD2A 5FH8A 5CQ7A 4I7CA 5JWMA 4HXKA 3JVJA 2KWOA 2LGKA 4O64A 5I3LA 4O7FA 4CL9A 3P1EA 4NR5A 2KE1A 2MT5A 2YSMA 5F1HA 3KQIA 4FO9A 5L97A 4Z1SA 2DSMA 2XP0A 4LJNA 5D3HA 4J3IA 2E6SA 4WZ2A 3JVKA 5ACYA 1WEEA 1Z2QA 2CKLB 4IC3A 3IU6A 5F25A 4OGEA 4QZSA 5E3DA 3ZVZB 3U5OA 3D1BA 3MQMA 2YHOA 2ECIA 3LVQE 3HCUA 4Z6IA 3UW9A 5B8DA 4GPJA 2MA5A 3L11A 4A4BA 5SVIB 4XY9A 4L58A 3FJUB 3QZSA 4R2YA 4F52B 4HBWA 4A9OA 4Z0RA 5D0CA 3H7HA 3MUKA 4AYCA 5CRZA 3MULA 4XYAA 4TU6A 4J1PA 4CURA 3KNVA 2N9GA 2JMDA 5JG6A 3PLWA 4N4HA 4YBMA 5HLSA 5J0DA 1WILA 2L0BA 5A82A 2WP1A 4PY6A 5E3GA 3KV5A 4DONA 3HCTA 3O70A 4LYIA 4L7XA 5HEMA 4A9FA 4O71A 4MENA 1G25A 3U5JA 4O7EA 2OXQC 2LAUA 5DYCA 4PCEA 2YQMA 3D1DA 4J0RA 5E7DA 4A9MA 4KV1A 3P5OA 4PS5A 2JMJA 5F5ZA 4LK9A 5I40A 4ZDTA 4WIVA 3HMFA 4C66A 5I80A 4GNGA 5E9LA 5A85A 5E73A 2I8NA 2F6JA 1XWHA 5HQ5A 3I2DA 4Z0OA 4YH4A 2FD4A 5LJ0A 4CFLA 3FEHA 5CQTA 2YSJA 3M99A 3UV5A 5FFWA 2DATA 4LRGA 5CQ4A 4BW4A 4UIVA 4CUTA 5A5QA 5AD3A 3SUBA 4AUQB 5F36A 1WENA 2EGPA 2KR4A 3PURA 3MB4A 5C89A 2VJFB 4O77A 3VK6A 2IQJA 4MR4A 2P57A 5BT3A 1VFYA 4NR9A 2KYUA 2LXPC 2KGGA 5CUAA 1JOCA 4O75A 4MEOA 4GB0A 4LKAA 5FE4A 5KTWA 1JM7B 2QJ0A 5L8UA 4A9JA 4A9NA 3N9NA 5D25A 4O7CA 4NUCA 2RR4A 3M62A 3O35A 4NYVA 3E2DA 3GG3A 5KH7A 4UYHA 4Z6HA 5DFBA 5TABA 4NR7A 5FB0A 1WEMA 2KFTA 5EISA 4NUEA 3DDTA 5IGLA 2JRJA 5CGPA 3U5PA 4TT6A 5E9YA 5LJ2A 3NXBA 3O47A 4R8PK 4QSTA 5FE8A 3N9MA 2VPGA 2VJEB 4B7YC 4KCXA 2R0SA 5G05B 2MIQA 5EWDA 2LGLA 3SVHA 3AADA 5CS8A 2QIZA 5J3XA 4QSPA 5HQ6A 2G6QA 5AITA 4CCGX 1HYJA 3NG2A 4GNDA 4WHUA 4HXSA 5TCMA 2YQDA 4UI9B 3ASLA 5LKXA 2M1RA 4QSUA 5EWVA 5CUEA 5CQAA 3RCWA 1WE9A 2K1JA 4HXRA 3DWDA 5C7NA 4Q6FA 4BW1A 5H1UA 4FLPA 5H85A 3SOXA 4PTBA 4B86C 2CKLA 2NAAA 4R7EA 5TB6A 1JSPB 5EA1A 3VKHA 3RPGB 5FE2A 5SVIA 4TYLA 4QR5A 5DKDA 4MEQA 4QC1A 4QR4A 4ZQLA 5FE0A 5HRXA 5I29A 2LDRA 3FM8C 3KV6A 4AKNA 3QZVA 4YATA 5JI8A 2C2LA 5C13A 4QSSA 5EGUA 5I88A 2L7PA 3LXJA 4BW2A 4LYWA 5A5NA 5K29A 2MNZA 5KHMA 4A9KA 2KWJA 2LQ6A 3C5KA 5LVRA 3D7CA 4XUBA 4C67A 3MDBC 3P1CA 3UV4A 5K3QA 3U5MA 5CUDA 4IR6A 5EPSA 3LDYA 5IGNA 2MD7B 5FDZA 2QICA 2F6NA 2E7NA 2VNFA 3HCSA 4TKPB 4X2IA 1K2FA 5KH9A 2ECGA 4YABA 5AMEA 5D1LB 5EWHA 2R0YA 2LV9A 3MHHA 5EWWA 2F42A 4TT4A 4UYFB 4NS5A 2L84A 3LQIA 4LDFA 2RS9B 5C11A 3N9QA 5I1QA 3Q1DA 2CSVA 2CONA 3G0LA 3I3JA 4NRBA 4UYGA 4UITA 3VKGA 5LKUA 4N3WA 2RNWA 2Y1MA 2VPEA 3PHDA 5E9KA 4A9HA 3KDEC 4NYWA 2L80A 2YT5A 5AMFA 2CSYA 5SVXA 3LJWA 5DX4A 4CUSA 5FE7A 2XB1A 5HRVA 2YW8A 5D1MB 5TBNA 5HELA 2VJFA 4BHWA 5I86A 4Z93A 5HFQA 4YYKA 4MSXA 1ZS5A 2D82A 1T1HA 3C6WA 3FL2A 5F60A 5EPBA 2R0VA 3U5KA 4BJXA 2AN6A 2VPDA 4V3KC 5LCWB 4UIWA 2L85A 2MD8C 4YBSA 2L75A 2MNYA 2YYRA 5DW2A 2E3KA 2YELA 5EYAF 4LZSA 1X4JA 2OUOA 4TS8A 3N9PA 4LZRA 5C85A 5KTXA 5A5SA 5D3JA 5EM3A 1WEUA 3JUEA 4X3GA 4BBQA 2DVVA 2H0DB 4YH3A 5KO4A 5EP7A 4IR5A 4TT2A 5CQ5A 1MM2A 2VJEA 3M63A 1N72A 5CUBA 3MB3A 4YYDA 1FP0A 1MBMA 4YK0A 4O70A 2KU3A 5SVYA 5HRWA 2E61A 3FANA 1CHCA 3U5LA 5E74A 4YYJA 3UVDA 2RSDA 4YYMA 2EODA 2YW5A 5ENFA 1MM3A 5LUUA 3DPLR 4Y03A 5D7XA 5EU1A 5FG4A 5FE5A 5D3PA 5FE3A 4PPEA 2DKWA 4O72A 5ENEA 5A5OA 5H1VA 3ZTGA 5ETDA 5EPRA 3LJUX 4NR8A 4YYGA 1F62A 4H9DA 4A9IA 2L43A 4LADB 4GNFA 5HENA 1LDKC 5HJCA 4A0CD 4QUUA 5B79A 5DFDA 2MUMA 5H1TA 5FE1A 4TZ8A 2KREA 4TTEA 3O34A 4J0SA 5HFRA 3ZYUA 2KWKA 2YQLA 4XY8A 5L96A 5B77A 2OSSA 4F1PA 4AYCB 1N87A 2FSAA 3O33A 3G0JA 2RNYA 3SOWA 3SVGA 4C9ZA 3HMEA 5EV9A 4QNSA 2HDPA 5CFWA 4O74A 2KKXA 2RO1A 3M7KA 4QSRA 3LVRE 2E6RA 1FBVA 2H60A 2EGMA 4IR4A 2M85A 2L5UA 2OWAA 4NRAA 3UV2A 2MKEA 3UVXA 4LC2A 2DX8A 1E4UA 1WUMA 5BT5A 2YU4A 5FH7A 3ZYQA 5CUGA 4QEWA 4QEUA 3K2JA 2G45A 4UYFA 1RMDA 1WUGA 4A9EA 4O76A 1EQFA 5HM0A 2B0OE 1DVPA 2CT2A 5A83A 3S92A 2C2VS 2E7OA 5DKHA 4HXPA 5D24A 2M13A 5ENJA 4NR4A 5FBXA 5LKTA 2YHNA 2VP7A 2XOYA 4QF3A 4QR3A 5CPEA 5TDRA 4NQMA 2DWWA 2LSPB 2KKYA 2YYNA 3JVLA 4RVRA 4TQNA 1HYIA 3SVFA 1WESA 2JM3A 3ONIA 5G4SA 2D8UA 5ENGA 3EB5A 5LKZA 3EB6A 3O36A 5CP5A 4HBYA 4IR3A 2K4DA 4TU4A 4UIUA 4MEPA 5IBNA 5E9VA 3LQJA 5D26A 5FG6A 2I50A 2XEUA 3P1FA 2KTBB 2EJNA 4O7AA 4ZUXU 3DWYA 5G04B 4HXOA 3QZTA 5DLZA 4QQ4A 5F61A 3DAIA 3HMHA 1Z6UA 4CLBA 5B78A 5F62A 2CRRA 4NYXA 2EA6A 4QB3A 2MJVB 5IIDA 4E96A 4QSQA 4AKIA 3GV4A 3GL6A 2HYED 5TRBA
chains in the Genus database with same CATH topology
4HBXA 4YADA 4ALGA 4UIYA 2ZETC 5FH6A 5A5PA 2Y43A 4LR6A 4NQNA 5DKCA 4OGJA 4YYNA 5EQ1A 4YY6A 4CUQA 3MXFA 5C87A 2CSZA 4YYIA 3LQHA 5F3AA 3T7LA 5F2PA 5G4RA 4LLBA 4LZ2A 3IU5A 5HCLA 2RI7A 3O37A 4IC2A 5B75A 5ENBA 4I7DA 1WEQA 2L5EA 3L1ZB 2K17A 5ENIA 1LDJB 2YEMA 5F63A 1Z60A 1JM7A 2UZGA 5D3LA 3TLPA 5ENCA 1WEVA 4UP0A 5FE6A 4YBTA 2ECWA 4HXNA 5FFYA 2Y1NA 5DFCA 4KV4A 5FB1A 3HTKC 4QSWA 2WP2A 4MR3A 4CFKA 4NR6A 3O7AA 5H9MA 2ECTA 1IYMA 3L1XA 3N9OA 3JVMA 4S3OC 5D1KB 3SHBA 4IOQA 4YAXA 5TDWA 4LYSA 4ZW1A 4QBMA 2RNXA 5II1A 4YY4A 4UIXA 5L98A 4Q0NA 1WGMA 2ECVA 3RPGC 5ETBA 2PNXA 5DYAA 4UP5A 2IDAA 3PUQA 3AQAA 4QSVA 5BT4A 2DVQA 5CU8A 4XI1A 5IG6A 5E9MA 5I89A 3DQVR 2G4AA 5CRMA 2FUUA 1WEOA 5L8TA 2FUIA 3SOUA 4QYDA 5D3NA 4ALHA 3UVYA 4GNEA 5B76A 5EK9A 5CZGA 4UYDA 4F3IA 3P1DA 1WIMA 5KH3A 2RFJA 4HXMA 4NXJA 5COIA 1WEWA 2JMIA 4FJCA 4YC9A 4I7BA 4O7BA 2YREA 4P5OB 2DVSA 2BAYA 4V3LC 4QY4A 5C4QA 4FIPA 5LVQA 1BORA 5DY7A 4A4CA 4N4IA 2D9EA 5FERA 2NXBA 4CA1A 1VYXA 5F1LA 5A81A 4NN2A 2GRCA 4QSXA 5EWCA 2VPBA 2OO1A 5CTLA 5FE9A 3T6RA 5KTUA 5A7CA 5AIUA 3MHSA 2LXHC 4YYHA 2KIZA 5D3TA 2KGIA 2LGGA 4A9LA 1WEPA 2M6MA 2YUCA 5E0RA 4QF2A 4OUFA 2YDWA 5CQ3A 3ZPVE 2R10A 3ZVYA 5EI4A 4PCIA 1X4UA 1X0JA 1WFKA 4CUPA 4UIZA 5CUCA 4XUAA 3UVWA 2ECJA 3S91A 2LRIC 4BW3A 5IGKA 2YEKA 4QUTA 5DINA 4MR5A 5DLXA 1JM4B 5G0FA 4CUUA 3FKMX 4ZC9A 5ENHA 2YURA 4PKLA 5EICA 3N9LA 3RTRB 2G43A 2LN0A 4WZ0A 5CQ8A 2PUYA 4MR6A 4NUDA 4AP4A 5I7YA 5L99A 4Q0OA 4HBVA 2KWNA 3V43A 4WZ3B 4HXLA 5DKAA 2MA6A 3Q2FA 5DYUA 4IORA 2ECNA 4S3OB 2D8SA 4QYLA 3Q2EA 5FEYA 5EVAA 5HQ7A 2K16A 5DW1A 4QC3A 4QEVA 5DYXA 5D3RA 3LRQA 4FK5A 5DBMA 4AVXA 4N4FA 1VD4A 5CY9A 1V87A 5CQ6A 1ZBDB 4IOOA 5C8GA 5LJ1A 4A49A 3ZPV1 4UYEA 5E9IA 5I7XA 2H0DA 4TZ2A 4WHWA 1U6GB 2DVRA 5FG5A 4OGIA 4WA6A 2I7KA 1F68A 2LGVA 3U5NA 5KU3A 2M3HA 5A5RA 3ZNIA 1E6IA 5FFVA 4O78A 4NRCA 5I83A 4Z1QA 1X4IA 3IHPA 4W4UA 4N4GA 5II2A 5IGMA 4MVTA 5D3SA 5AD2A 5FH8A 5CQ7A 4I7CA 5JWMA 4HXKA 3JVJA 2KWOA 2LGKA 4O64A 5I3LA 4O7FA 4CL9A 3P1EA 4NR5A 2KE1A 2MT5A 2YSMA 5F1HA 3KQIA 4FO9A 5L97A 4Z1SA 4LJNA 5D3HA 4J3IA 2E6SA 4WZ2A 3JVKA 5ACYA 1WEEA 1Z2QA 2CKLB 4IC3A 3IU6A 5F25A 4QZSA 5E3DA 3ZVZB 3U5OA 3MQMA 2YHOA 2ECIA 3HCUA 4Z6IA 3UW9A 5B8DA 4GPJA 2MA5A 3L11A 4A4BA 4XY9A 4L58A 3QZSA 4R2YA 4F52B 4HBWA 4A9OA 5D0CA 4AYCA 3MUKA 5CRZA 3MULA 4XYAA 4TU6A 4J1PA 4CURA 3KNVA 2N9GA 2JMDA 5JG6A 4N4HA 4YBMA 5HLSA 5J0DA 1WILA 2L0BA 5A82A 2WP1A 4PY6A 5E3GA 3KV5A 4DONA 3HCTA 3O70A 4LYIA 4L7XA 5HEMA 4A9FA 4O71A 4MENA 1G25A 3U5JA 4O7EA 2OXQC 5DYCA 4PCEA 2YQMA 4J0RA 5E7DA 4A9MA 4KV1A 3P5OA 4PS5A 2JMJA 5F5ZA 4LK9A 5I40A 4ZDTA 4WIVA 3HMFA 4C66A 5I80A 4GNGA 5E9LA 5A85A 5E73A 2I8NA 2F6JA 1XWHA 5HQ5A 3I2DA 4YH4A 5LJ0A 4CFLA 5CQTA 2YSJA 3M99A 3UV5A 5FFWA 2DATA 4LRGA 5CQ4A 4BW4A 4UIVA 4CUTA 5A5QA 5AD3A 4AUQB 5F36A 1WENA 2EGPA 2KR4A 3PURA 3MB4A 5C89A 2VJFB 4O77A 3VK6A 4MR4A 5BT3A 1VFYA 4NR9A 2KYUA 2LXPC 2KGGA 5CUAA 1JOCA 4O75A 4MEOA 4GB0A 4LKAA 5FE4A 5KTWA 1JM7B 2QJ0A 5L8UA 4A9JA 4A9NA 3N9NA 5D25A 4O7CA 4NUCA 3M62A 3O35A 4NYVA 3GG3A 5KH7A 4UYHA 4Z6HA 5DFBA 5TABA 4NR7A 5FB0A 1WEMA 2KFTA 5EISA 4NUEA 5IGLA 2JRJA 5CGPA 3U5PA 4TT6A 5E9YA 5LJ2A 3NXBA 4R8PK 4QSTA 5FE8A 3N9MA 2VPGA 2VJEB 4B7YC 4KCXA 2R0SA 5G05B 2MIQA 5EWDA 2LGLA 3SVHA 3AADA 5CS8A 2QIZA 5J3XA 4QSPA 5HQ6A 2G6QA 5AITA 4CCGX 1HYJA 3NG2A 4GNDA 4WHUA 4HXSA 5TCMA 2YQDA 4UI9B 3ASLA 5LKXA 2M1RA 4QSUA 5EWVA 5CUEA 5CQAA 3RCWA 1WE9A 2K1JA 4HXRA 4Q6FA 5C7NA 3SOXA 4BW1A 5H1UA 4FLPA 5H85A 4PTBA 4B86C 2CKLA 2NAAA 4R7EA 5TB6A 1JSPB 5EA1A 3RPGB 5FE2A 4TYLA 4QR5A 5DKDA 4MEQA 4QC1A 4QR4A 4ZQLA 5FE0A 5HRXA 5I29A 2LDRA 3KV6A 4AKNA 3QZVA 4YATA 5JI8A 2C2LA 5C13A 4QSSA 5EGUA 5I88A 3LXJA 4BW2A 4LYWA 5A5NA 5K29A 2MNZA 5KHMA 4A9KA 2KWJA 2LQ6A 3C5KA 5LVRA 3D7CA 4XUBA 4C67A 3P1CA 3UV4A 3U5MA 5CUDA 4IR6A 5EPSA 5IGNA 2MD7B 5FDZA 2QICA 2F6NA 2E7NA 2VNFA 3HCSA 4TKPB 4X2IA 1K2FA 5KH9A 2ECGA 4YABA 5AMEA 5D1LB 5EWHA 2R0YA 2LV9A 3MHHA 5EWWA 2F42A 4TT4A 4UYFB 4NS5A 2L84A 3LQIA 4LDFA 2RS9B 5C11A 3N9QA 5I1QA 3G0LA 3I3JA 4NRBA 4UYGA 4UITA 5LKUA 4N3WA 2RNWA 2Y1MA 2VPEA 3PHDA 5E9KA 4A9HA 4NYWA 2L80A 2YT5A 5AMFA 2CSYA 3LJWA 5DX4A 4CUSA 5FE7A 2XB1A 5HRVA 2YW8A 5D1MB 5TBNA 5HELA 2VJFA 4BHWA 5I86A 4Z93A 5HFQA 4YYKA 4MSXA 2D82A 1ZS5A 1T1HA 3C6WA 3FL2A 5F60A 5EPBA 2R0VA 3U5KA 4BJXA 2AN6A 2VPDA 4V3KC 5LCWB 4UIWA 2L85A 2MD8C 4YBSA 2L75A 2MNYA 2YYRA 5DW2A 2E3KA 2YELA 5EYAF 4LZSA 1X4JA 2OUOA 4TS8A 3N9PA 4LZRA 5C85A 5KTXA 5A5SA 5D3JA 5EM3A 1WEUA 4X3GA 4BBQA 2DVVA 2H0DB 4YH3A 5KO4A 5EP7A 4IR5A 4TT2A 5CQ5A 1MM2A 2VJEA 3M63A 1N72A 5CUBA 3MB3A 4YYDA 1FP0A 4YK0A 4O70A 2KU3A 5HRWA 1CHCA 3U5LA 5E74A 4YYJA 3UVDA 2RSDA 4YYMA 2EODA 2YW5A 5ENFA 1MM3A 5LUUA 3DPLR 4Y03A 5D7XA 5EU1A 5FG4A 5FE5A 5D3PA 5FE3A 4PPEA 2DKWA 4O72A 5ENEA 5A5OA 5H1VA 3ZTGA 5ETDA 5EPRA 4NR8A 4YYGA 1F62A 4A9IA 2L43A 4LADB 4GNFA 5HENA 1LDKC 5HJCA 4A0CD 4QUUA 5B79A 5DFDA 2MUMA 5H1TA 5FE1A 4TZ8A 2KREA 4TTEA 3O34A 4J0SA 5HFRA 3ZYUA 2KWKA 2YQLA 4XY8A 5L96A 5B77A 2OSSA 4AYCB 1N87A 2FSAA 3O33A 3G0JA 2RNYA 3SOWA 3SVGA 4C9ZA 3HMEA 5EV9A 4QNSA 2HDPA 5CFWA 4O74A 2RO1A 4QSRA 2E6RA 1FBVA 2H60A 4IR4A 2M85A 2L5UA 4NRAA 3UV2A 3UVXA 4LC2A 2DX8A 1E4UA 1WUMA 5BT5A 2YU4A 5FH7A 3ZYQA 5CUGA 4QEWA 4QEUA 3K2JA 2G45A 4UYFA 1RMDA 1WUGA 4A9EA 4O76A 1EQFA 5HM0A 1DVPA 2CT2A 5A83A 3S92A 2C2VS 2E7OA 5DKHA 4HXPA 5D24A 5ENJA 4NR4A 5FBXA 5LKTA 2YHNA 2VP7A 4QF3A 4QR3A 5CPEA 5TDRA 4NQMA 2DWWA 2LSPB 2YYNA 3JVLA 4RVRA 4TQNA 1HYIA 3SVFA 1WESA 3ONIA 5G4SA 3EB5A 5ENGA 5LKZA 3EB6A 3O36A 5CP5A 4HBYA 4IR3A 2K4DA 4TU4A 4UIUA 4MEPA 5IBNA 5E9VA 3LQJA 5D26A 5FG6A 2I50A 2XEUA 3P1FA 2KTBB 4O7AA 4ZUXU 3DWYA 5G04B 4HXOA 3QZTA 5DLZA 5F61A 3DAIA 3HMHA 1Z6UA 4CLBA 5B78A 5F62A 4NYXA 2EA6A 4QB3A 2MJVB 5IIDA 4E96A 4QSQA 3GV4A 3GL6A 2HYED 5TRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBX A;  4YAD A;  4ALG A;  4UIY A;  2ZET C;  5FH6 A;  5A5P A;  2Y43 A;  4LR6 A;  4NQN A;  5DKC A;  4OGJ A;  4YYN A;  5EQ1 A;  4YY6 A;  4CUQ A;  3MXF A;  5C87 A;  2CSZ A;  4YYI A;  3LQH A;  5F3A A;  3T7L A;  5F2P A;  5G4R A;  4LLB A;  4LZ2 A;  3IU5 A;  5HCL A;  2RI7 A;  3O37 A;  4IC2 A;  5B75 A;  5ENB A;  4I7D A;  1WEQ A;  2L5E A;  3L1Z B;  2K17 A;  5ENI A;  1LDJ B;  2YEM A;  5F63 A;  1Z60 A;  1JM7 A;  2UZG A;  5D3L A;  3TLP A;  5ENC A;  1WEV A;  4UP0 A;  5FE6 A;  4YBT A;  2ECW A;  4HXN A;  5FFY A;  2Y1N A;  5DFC A;  4KV4 A;  5FB1 A;  3HTK C;  4QSW A;  2WP2 A;  4MR3 A;  4CFK A;  4NR6 A;  3O7A A;  5H9M A;  2ECT A;  1IYM A;  3L1X A;  3N9O A;  3JVM A;  4S3O C;  5D1K B;  3SHB A;  4IOQ A;  4YAX A;  5TDW A;  4LYS A;  4ZW1 A;  4QBM A;  2RNX A;  5II1 A;  4YY4 A;  4UIX A;  5L98 A;  4Q0N A;  1WGM A;  2ECV A;  3RPG C;  5ETB A;  2PNX A;  5DYA A;  4UP5 A;  2IDA A;  3PUQ A;  3AQA A;  4QSV A;  5BT4 A;  2DVQ A;  5CU8 A;  4XI1 A;  5IG6 A;  5E9M A;  5I89 A;  3DQV R;  2G4A A;  5CRM A;  2FUU A;  1WEO A;  5L8T A;  2FUI A;  3SOU A;  4QYD A;  5D3N A;  4ALH A;  3UVY A;  4GNE A;  5B76 A;  5EK9 A;  5CZG A;  4UYD A;  4F3I A;  3P1D A;  1WIM A;  5KH3 A;  2RFJ A;  4HXM A;  4NXJ A;  5COI A;  1WEW A;  2JMI A;  4FJC A;  4YC9 A;  4I7B A;  4O7B A;  2YRE A;  4P5O B;  2DVS A;  2BAY A;  4V3L C;  4QY4 A;  5C4Q A;  4FIP A;  5LVQ A;  1BOR A;  5DY7 A;  4A4C A;  4N4I A;  2D9E A;  5FER A;  2NXB A;  4CA1 A;  1VYX A;  5F1L A;  5A81 A;  4NN2 A;  2GRC A;  4QSX A;  5EWC A;  2VPB A;  2OO1 A;  5CTL A;  5FE9 A;  3T6R A;  5KTU A;  5A7C A;  5AIU A;  3MHS A;  2LXH C;  4YYH A;  2KIZ A;  5D3T A;  2KGI A;  2LGG A;  4A9L A;  1WEP A;  2M6M A;  2YUC A;  5E0R A;  4QF2 A;  4OUF A;  2YDW A;  5CQ3 A;  3ZPV E;  2R10 A;  3ZVY A;  5EI4 A;  4PCI A;  1X4U A;  1X0J A;  1WFK A;  4CUP A;  4UIZ A;  5CUC A;  4XUA A;  3UVW A;  2ECJ A;  3S91 A;  2LRI C;  4BW3 A;  5IGK A;  2YEK A;  4QUT A;  5DIN A;  4MR5 A;  5DLX A;  1JM4 B;  5G0F A;  4CUU A;  3FKM X;  4ZC9 A;  5ENH A;  2YUR A;  4PKL A;  5EIC A;  3N9L A;  3RTR B;  2G43 A;  2LN0 A;  4WZ0 A;  5CQ8 A;  2PUY A;  4MR6 A;  4NUD A;  4AP4 A;  5I7Y A;  5L99 A;  4Q0O A;  4HBV A;  2KWN A;  3V43 A;  4WZ3 B;  4HXL A;  5DKA A;  2MA6 A;  3Q2F A;  5DYU A;  4IOR A;  2ECN A;  4S3O B;  2D8S A;  4QYL A;  3Q2E A;  5FEY A;  5EVA A;  5HQ7 A;  2K16 A;  5DW1 A;  4QC3 A;  4QEV A;  5DYX A;  5D3R A;  3LRQ A;  4FK5 A;  5DBM A;  4AVX A;  4N4F A;  1VD4 A;  5CY9 A;  1V87 A;  5CQ6 A;  1ZBD B;  4IOO A;  5C8G A;  5LJ1 A;  4A49 A;  3ZPV 1;  4UYE A;  5E9I A;  5I7X A;  2H0D A;  4TZ2 A;  4WHW A;  1U6G B;  2DVR A;  5FG5 A;  4OGI A;  4WA6 A;  2I7K A;  1F68 A;  2LGV A;  3U5N A;  5KU3 A;  2M3H A;  5A5R A;  3ZNI A;  1E6I A;  5FFV A;  4O78 A;  4NRC A;  5I83 A;  4Z1Q A;  1X4I A;  3IHP A;  4W4U A;  4N4G A;  5II2 A;  5IGM A;  4MVT A;  5D3S A;  5AD2 A;  5FH8 A;  5CQ7 A;  4I7C A;  5JWM A;  4HXK A;  3JVJ A;  2KWO A;  2LGK A;  4O64 A;  5I3L A;  4O7F A;  4CL9 A;  3P1E A;  4NR5 A;  2KE1 A;  2MT5 A;  2YSM A;  5F1H A;  3KQI A;  4FO9 A;  5L97 A;  4Z1S A;  4LJN A;  5D3H A;  4J3I A;  2E6S A;  4WZ2 A;  3JVK A;  5ACY A;  1WEE A;  1Z2Q A;  2CKL B;  4IC3 A;  3IU6 A;  5F25 A;  4QZS A;  5E3D A;  3ZVZ B;  3U5O A;  3MQM A;  2YHO A;  2ECI A;  3HCU A;  4Z6I A;  3UW9 A;  5B8D A;  4GPJ A;  2MA5 A;  3L11 A;  4A4B A;  4XY9 A;  4L58 A;  3QZS A;  4R2Y A;  4F52 B;  4HBW A;  4A9O A;  5D0C A;  4AYC A;  3MUK A;  5CRZ A;  3MUL A;  4XYA A;  4TU6 A;  4J1P A;  4CUR A;  3KNV A;  2N9G A;  2JMD A;  5JG6 A;  4N4H A;  4YBM A;  5HLS A;  5J0D A;  1WIL A;  2L0B A;  5A82 A;  2WP1 A;  4PY6 A;  5E3G A;  3KV5 A;  4DON A;  3HCT A;  3O70 A;  4LYI A;  4L7X A;  5HEM A;  4A9F A;  4O71 A;  4MEN A;  1G25 A;  3U5J A;  4O7E A;  2OXQ C;  5DYC A;  4PCE A;  2YQM A;  4J0R A;  5E7D A;  4A9M A;  4KV1 A;  3P5O A;  4PS5 A;  2JMJ A;  5F5Z A;  4LK9 A;  5I40 A;  4ZDT A;  4WIV A;  3HMF A;  4C66 A;  5I80 A;  4GNG A;  5E9L A;  5A85 A;  5E73 A;  2I8N A;  2F6J A;  1XWH A;  5HQ5 A;  3I2D A;  4YH4 A;  5LJ0 A;  4CFL A;  5CQT A;  2YSJ A;  3M99 A;  3UV5 A;  5FFW A;  2DAT A;  4LRG A;  5CQ4 A;  4BW4 A;  4UIV A;  4CUT A;  5A5Q A;  5AD3 A;  4AUQ B;  5F36 A;  1WEN A;  2EGP A;  2KR4 A;  3PUR A;  3MB4 A;  5C89 A;  2VJF B;  4O77 A;  3VK6 A;  4MR4 A;  5BT3 A;  1VFY A;  4NR9 A;  2KYU A;  2LXP C;  2KGG A;  5CUA A;  1JOC A;  4O75 A;  4MEO A;  4GB0 A;  4LKA A;  5FE4 A;  5KTW A;  1JM7 B;  2QJ0 A;  5L8U A;  4A9J A;  4A9N A;  3N9N A;  5D25 A;  4O7C A;  4NUC A;  3M62 A;  3O35 A;  4NYV A;  3GG3 A;  5KH7 A;  4UYH A;  4Z6H A;  5DFB A;  5TAB A;  4NR7 A;  5FB0 A;  1WEM A;  2KFT A;  5EIS A;  4NUE A;  5IGL A;  2JRJ A;  5CGP A;  3U5P A;  4TT6 A;  5E9Y A;  5LJ2 A;  3NXB A;  4R8P K;  4QST A;  5FE8 A;  3N9M A;  2VPG A;  2VJE B;  4B7Y C;  4KCX A;  2R0S A;  5G05 B;  2MIQ A;  5EWD A;  2LGL A;  3SVH A;  3AAD A;  5CS8 A;  2QIZ A;  5J3X A;  4QSP A;  5HQ6 A;  2G6Q A;  5AIT A;  4CCG X;  1HYJ A;  3NG2 A;  4GND A;  4WHU A;  4HXS A;  5TCM A;  2YQD A;  4UI9 B;  3ASL A;  5LKX A;  2M1R A;  4QSU A;  5EWV A;  5CUE A;  5CQA A;  3RCW A;  1WE9 A;  2K1J A;  4HXR A;  4Q6F A;  5C7N A;  3SOX A;  4BW1 A;  5H1U A;  4FLP A;  5H85 A;  4PTB A;  4B86 C;  2CKL A;  2NAA A;  4R7E A;  5TB6 A;  1JSP B;  5EA1 A;  3RPG B;  5FE2 A;  4TYL A;  4QR5 A;  5DKD A;  4MEQ A;  4QC1 A;  4QR4 A;  4ZQL A;  5FE0 A;  5HRX A;  5I29 A;  2LDR A;  3KV6 A;  4AKN A;  3QZV A;  4YAT A;  5JI8 A;  2C2L A;  5C13 A;  4QSS A;  5EGU A;  5I88 A;  3LXJ A;  4BW2 A;  4LYW A;  5A5N A;  5K29 A;  2MNZ A;  5KHM A;  4A9K A;  2KWJ A;  2LQ6 A;  3C5K A;  5LVR A;  3D7C A;  4XUB A;  4C67 A;  3P1C A;  3UV4 A;  3U5M A;  5CUD A;  4IR6 A;  5EPS A;  5IGN A;  2MD7 B;  5FDZ A;  2QIC A;  2F6N A;  2E7N A;  2VNF A;  3HCS A;  4TKP B;  4X2I A;  1K2F A;  5KH9 A;  2ECG A;  4YAB A;  5AME A;  5D1L B;  5EWH A;  2R0Y A;  2LV9 A;  3MHH A;  5EWW A;  2F42 A;  4TT4 A;  4UYF B;  4NS5 A;  2L84 A;  3LQI A;  4LDF A;  2RS9 B;  5C11 A;  3N9Q A;  5I1Q A;  3G0L A;  3I3J A;  4NRB A;  4UYG A;  4UIT A;  5LKU A;  4N3W A;  2RNW A;  2Y1M A;  2VPE A;  3PHD A;  5E9K A;  4A9H A;  4NYW A;  2L80 A;  2YT5 A;  5AMF A;  2CSY A;  3LJW A;  5DX4 A;  4CUS A;  5FE7 A;  2XB1 A;  5HRV A;  2YW8 A;  5D1M B;  5TBN A;  5HEL A;  2VJF A;  4BHW A;  5I86 A;  4Z93 A;  5HFQ A;  4YYK A;  4MSX A;  2D82 A;  1ZS5 A;  1T1H A;  3C6W A;  3FL2 A;  5F60 A;  5EPB A;  2R0V A;  3U5K A;  4BJX A;  2AN6 A;  2VPD A;  4V3K C;  5LCW B;  4UIW A;  2L85 A;  2MD8 C;  4YBS A;  2L75 A;  2MNY A;  2YYR A;  5DW2 A;  2E3K A;  2YEL A;  5EYA F;  4LZS A;  1X4J A;  2OUO A;  4TS8 A;  3N9P A;  4LZR A;  5C85 A;  5KTX A;  5A5S A;  5D3J A;  5EM3 A;  1WEU A;  4X3G A;  4BBQ A;  2DVV A;  2H0D B;  4YH3 A;  5KO4 A;  5EP7 A;  4IR5 A;  4TT2 A;  5CQ5 A;  1MM2 A;  2VJE A;  3M63 A;  1N72 A;  5CUB A;  3MB3 A;  4YYD A;  1FP0 A;  4YK0 A;  4O70 A;  2KU3 A;  5HRW A;  1CHC A;  3U5L A;  5E74 A;  4YYJ A;  3UVD A;  2RSD A;  4YYM A;  2EOD A;  2YW5 A;  5ENF A;  1MM3 A;  5LUU A;  3DPL R;  4Y03 A;  5D7X A;  5EU1 A;  5FG4 A;  5FE5 A;  5D3P A;  5FE3 A;  4PPE A;  2DKW A;  4O72 A;  5ENE A;  5A5O A;  5H1V A;  3ZTG A;  5ETD A;  5EPR A;  4NR8 A;  4YYG A;  1F62 A;  4A9I A;  2L43 A;  4LAD B;  4GNF A;  5HEN A;  1LDK C;  5HJC A;  4A0C D;  4QUU A;  5B79 A;  5DFD A;  2MUM A;  5H1T A;  5FE1 A;  4TZ8 A;  2KRE A;  4TTE A;  3O34 A;  4J0S A;  5HFR A;  3ZYU A;  2KWK A;  2YQL A;  4XY8 A;  5L96 A;  5B77 A;  2OSS A;  4AYC B;  1N87 A;  2FSA A;  3O33 A;  3G0J A;  2RNY A;  3SOW A;  3SVG A;  4C9Z A;  3HME A;  5EV9 A;  4QNS A;  2HDP A;  5CFW A;  4O74 A;  2RO1 A;  4QSR A;  2E6R A;  1FBV A;  2H60 A;  4IR4 A;  2M85 A;  2L5U A;  4NRA A;  3UV2 A;  3UVX A;  4LC2 A;  2DX8 A;  1E4U A;  1WUM A;  5BT5 A;  2YU4 A;  5FH7 A;  3ZYQ A;  5CUG A;  4QEW A;  4QEU A;  3K2J A;  2G45 A;  4UYF A;  1RMD A;  1WUG A;  4A9E A;  4O76 A;  1EQF A;  5HM0 A;  1DVP A;  2CT2 A;  5A83 A;  3S92 A;  2C2V S;  2E7O A;  5DKH A;  4HXP A;  5D24 A;  5ENJ A;  4NR4 A;  5FBX A;  5LKT A;  2YHN A;  2VP7 A;  4QF3 A;  4QR3 A;  5CPE A;  5TDR A;  4NQM A;  2DWW A;  2LSP B;  2YYN A;  3JVL A;  4RVR A;  4TQN A;  1HYI A;  3SVF A;  1WES A;  3ONI A;  5G4S A;  3EB5 A;  5ENG A;  5LKZ A;  3EB6 A;  3O36 A;  5CP5 A;  4HBY A;  4IR3 A;  2K4D A;  4TU4 A;  4UIU A;  4MEP A;  5IBN A;  5E9V A;  3LQJ A;  5D26 A;  5FG6 A;  2I50 A;  2XEU A;  3P1F A;  2KTB B;  4O7A A;  4ZUX U;  3DWY A;  5G04 B;  4HXO A;  3QZT A;  5DLZ A;  5F61 A;  3DAI A;  3HMH A;  1Z6U A;  4CLB A;  5B78 A;  5F62 A;  4NYX A;  2EA6 A;  4QB3 A;  2MJV B;  5IID A;  4E96 A;  4QSQ A;  3GV4 A;  3GL6 A;  2HYE D;  5TRB A; 
#chains in the Genus database with same CATH topology
 4HBX A;  4YAD A;  4ALG A;  2YVR A;  4UIY A;  2ZET C;  5FH6 A;  5A5P A;  2Y43 A;  4O62 A;  4LR6 A;  4NQN A;  5DKC A;  4OGJ A;  4YYN A;  5EQ1 A;  4YY6 A;  4CUQ A;  3MXF A;  5C87 A;  2CSZ A;  4YYI A;  3LQH A;  5F3A A;  3T7L A;  5F2P A;  5G4R A;  4LLB A;  4LZ2 A;  3IU5 A;  5HCL A;  2RI7 A;  3O37 A;  4AKH A;  4IC2 A;  5ENB A;  5B75 A;  4I7D A;  1WEQ A;  2L5E A;  3L1Z B;  2K17 A;  5ENI A;  1LDJ B;  2YEM A;  5F63 A;  1Z60 A;  1JM7 A;  2UZG A;  4OGC A;  5D3L A;  3TLP A;  5ENC A;  1WEV A;  4UP0 A;  3T9K A;  5FE6 A;  4YBT A;  2ECW A;  4HXN A;  5FFY A;  2Y1N A;  5DFC A;  4KV4 A;  5FB1 A;  3HTK C;  4QSW A;  2WP2 A;  4MR3 A;  4CFK A;  4NR6 A;  3O7A A;  5H9M A;  2ECT A;  1IYM A;  3L1X A;  3N9O A;  3JVM A;  4S3O C;  5D1K B;  3SHB A;  4IOQ A;  4YAX A;  5TDW A;  4LYS A;  4ZW1 A;  4QBM A;  2RNX A;  5II1 A;  4YY4 A;  1DCQ A;  4UIX A;  5L98 A;  4Q0N A;  1WGM A;  2ECV A;  3RPG C;  5ETB A;  2PNX A;  2XOC A;  5DYA A;  4UP5 A;  2IDA A;  3PUQ A;  3AQA A;  4QSV A;  5BT4 A;  2DVQ A;  5CU8 A;  4XI1 A;  5IG6 A;  5E9M A;  5I89 A;  3DQV R;  2G4A A;  5CRM A;  2FUU A;  1WEO A;  5L8T A;  2FUI A;  3SOU A;  4QYD A;  5D3N A;  4ALH A;  3UVY A;  4GNE A;  5B76 A;  5EK9 A;  5CZG A;  4UYD A;  2DJA A;  4F3I A;  3P1D A;  1WIM A;  3FAO A;  5KH3 A;  2RFJ A;  4HXM A;  4NXJ A;  5COI A;  4AKG A;  1WEW A;  2EXU A;  2JMI A;  4YC9 A;  4FJC A;  4O7B A;  2YRE A;  4I7B A;  4P5O B;  2DVS A;  2BAY A;  4V3L C;  4QY4 A;  5C4Q A;  4FIP A;  5LVQ A;  1BOR A;  5DY7 A;  4A4C A;  4N4I A;  2D9E A;  5FER A;  2NXB A;  4CA1 A;  1VYX A;  5F1L A;  5A81 A;  4NN2 A;  2GRC A;  4QSX A;  5EWC A;  2VPB A;  2OO1 A;  5CTL A;  5FE9 A;  3T6R A;  5KTU A;  5A7C A;  5AIU A;  2XOZ A;  3MHS A;  2LXH C;  4YYH A;  2KIZ A;  5D3T A;  2KGI A;  2LGG A;  4A9L A;  1WEP A;  2M6M A;  2YUC A;  5E0R A;  4QF2 A;  4OUF A;  2YDW A;  5CQ3 A;  3ZPV E;  2R10 A;  3ZVY A;  5EI4 A;  4PCI A;  1X4U A;  1X0J A;  1WFK A;  4CUP A;  4UIZ A;  5CUC A;  4XUA A;  3UVW A;  2ECJ A;  3S91 A;  2LRI C;  4BW3 A;  5IGK A;  2YEK A;  4QUT A;  5DIN A;  4MR5 A;  5DLX A;  1JM4 B;  5G0F A;  4CUU A;  3FKM X;  4ZC9 A;  5ENH A;  2YUR A;  4PKL A;  5EIC A;  3N9L A;  3RTR B;  2G43 A;  2LN0 A;  4WZ0 A;  5CQ8 A;  2PUY A;  4MR6 A;  4NUD A;  4AI6 A;  4AP4 A;  5I7Y A;  5L99 A;  4Q0O A;  1PUO A;  4HBV A;  2KWN A;  3V43 A;  4WZ3 B;  4HXL A;  5DKA A;  2MA6 A;  3Q2F A;  5DYU A;  4IOR A;  2ECN A;  4S3O B;  2D8S A;  4QYL A;  3Q2E A;  5FEY A;  5EVA A;  5HQ7 A;  2K16 A;  5DW1 A;  4QC3 A;  4QEV A;  5DYX A;  5D3R A;  3LRQ A;  4FK5 A;  5DBM A;  4AVX A;  4N4F A;  1VD4 A;  5CY9 A;  1V87 A;  5CQ6 A;  1ZBD B;  4IOO A;  5C8G A;  2CRW A;  5LJ1 A;  4A49 A;  3ZPV 1;  4UYE A;  5E9I A;  5I7X A;  2H0D A;  4TZ2 A;  4WHW A;  1U6G B;  2DVR A;  5FG5 A;  4OGI A;  4WA6 A;  2I7K A;  1F68 A;  2LGV A;  3U5N A;  1ZKR A;  5KU3 A;  5A5R A;  2JUN A;  2M3H A;  1E6I A;  3ZNI A;  3ERR A;  5FFV A;  4O78 A;  4NRC A;  5I83 A;  4Z1Q A;  1X4I A;  3IHP A;  4W4U A;  4N4G A;  2FFW A;  5II2 A;  5IGM A;  4MVT A;  5D3S A;  5AD2 A;  5FH8 A;  5CQ7 A;  4I7C A;  5JWM A;  4HXK A;  3JVJ A;  2KWO A;  2LGK A;  4O64 A;  5I3L A;  4O7F A;  4CL9 A;  3P1E A;  4NR5 A;  2KE1 A;  2MT5 A;  2YSM A;  5F1H A;  3KQI A;  4FO9 A;  5L97 A;  4Z1S A;  2DSM A;  2XP0 A;  4LJN A;  5D3H A;  4J3I A;  2E6S A;  4WZ2 A;  3JVK A;  5ACY A;  1WEE A;  1Z2Q A;  2CKL B;  4IC3 A;  3IU6 A;  5F25 A;  4OGE A;  4QZS A;  5E3D A;  3ZVZ B;  3U5O A;  3D1B A;  3MQM A;  2YHO A;  2ECI A;  3LVQ E;  3HCU A;  4Z6I A;  3UW9 A;  5B8D A;  4GPJ A;  2MA5 A;  3L11 A;  4A4B A;  5SVI B;  4XY9 A;  4L58 A;  3FJU B;  3QZS A;  4R2Y A;  4F52 B;  4HBW A;  4A9O A;  4Z0R A;  5D0C A;  3H7H A;  3MUK A;  4AYC A;  5CRZ A;  3MUL A;  4XYA A;  4TU6 A;  4J1P A;  4CUR A;  3KNV A;  2N9G A;  2JMD A;  5JG6 A;  3PLW A;  4N4H A;  4YBM A;  5HLS A;  5J0D A;  1WIL A;  2L0B A;  5A82 A;  2WP1 A;  4PY6 A;  5E3G A;  3KV5 A;  4DON A;  3HCT A;  3O70 A;  4LYI A;  4L7X A;  5HEM A;  4A9F A;  4O71 A;  4MEN A;  1G25 A;  3U5J A;  4O7E A;  2OXQ C;  2LAU A;  5DYC A;  4PCE A;  2YQM A;  3D1D A;  4J0R A;  5E7D A;  4A9M A;  4KV1 A;  3P5O A;  4PS5 A;  2JMJ A;  5F5Z A;  4LK9 A;  5I40 A;  4ZDT A;  4WIV A;  3HMF A;  4C66 A;  5I80 A;  4GNG A;  5E9L A;  5A85 A;  5E73 A;  2I8N A;  2F6J A;  1XWH A;  5HQ5 A;  3I2D A;  4Z0O A;  4YH4 A;  2FD4 A;  5LJ0 A;  4CFL A;  3FEH A;  5CQT A;  2YSJ A;  3M99 A;  3UV5 A;  5FFW A;  2DAT A;  4LRG A;  5CQ4 A;  4BW4 A;  4UIV A;  4CUT A;  5A5Q A;  5AD3 A;  3SUB A;  4AUQ B;  5F36 A;  1WEN A;  2EGP A;  2KR4 A;  3PUR A;  3MB4 A;  5C89 A;  2VJF B;  4O77 A;  3VK6 A;  2IQJ A;  4MR4 A;  2P57 A;  5BT3 A;  1VFY A;  4NR9 A;  2KYU A;  2LXP C;  2KGG A;  5CUA A;  1JOC A;  4O75 A;  4MEO A;  4GB0 A;  4LKA A;  5FE4 A;  5KTW A;  1JM7 B;  2QJ0 A;  5L8U A;  4A9J A;  4A9N A;  3N9N A;  5D25 A;  4O7C A;  4NUC A;  2RR4 A;  3M62 A;  3O35 A;  4NYV A;  3E2D A;  3GG3 A;  5KH7 A;  4UYH A;  4Z6H A;  5DFB A;  5TAB A;  4NR7 A;  5FB0 A;  1WEM A;  2KFT A;  5EIS A;  4NUE A;  3DDT A;  5IGL A;  2JRJ A;  5CGP A;  3U5P A;  4TT6 A;  5E9Y A;  5LJ2 A;  3NXB A;  3O47 A;  4R8P K;  4QST A;  5FE8 A;  3N9M A;  2VPG A;  2VJE B;  4B7Y C;  4KCX A;  2R0S A;  5G05 B;  2MIQ A;  5EWD A;  2LGL A;  3SVH A;  3AAD A;  5CS8 A;  2QIZ A;  5J3X A;  4QSP A;  5HQ6 A;  2G6Q A;  5AIT A;  4CCG X;  1HYJ A;  3NG2 A;  4GND A;  4WHU A;  4HXS A;  5TCM A;  2YQD A;  4UI9 B;  3ASL A;  5LKX A;  2M1R A;  4QSU A;  5EWV A;  5CUE A;  5CQA A;  3RCW A;  1WE9 A;  2K1J A;  4HXR A;  3DWD A;  5C7N A;  4Q6F A;  4BW1 A;  5H1U A;  4FLP A;  5H85 A;  3SOX A;  4PTB A;  4B86 C;  2CKL A;  2NAA A;  4R7E A;  5TB6 A;  1JSP B;  5EA1 A;  3VKH A;  3RPG B;  5FE2 A;  5SVI A;  4TYL A;  4QR5 A;  5DKD A;  4MEQ A;  4QC1 A;  4QR4 A;  4ZQL A;  5FE0 A;  5HRX A;  5I29 A;  2LDR A;  3FM8 C;  3KV6 A;  4AKN A;  3QZV A;  4YAT A;  5JI8 A;  2C2L A;  5C13 A;  4QSS A;  5EGU A;  5I88 A;  2L7P A;  3LXJ A;  4BW2 A;  4LYW A;  5A5N A;  5K29 A;  2MNZ A;  5KHM A;  4A9K A;  2KWJ A;  2LQ6 A;  3C5K A;  5LVR A;  3D7C A;  4XUB A;  4C67 A;  3MDB C;  3P1C A;  3UV4 A;  5K3Q A;  3U5M A;  5CUD A;  4IR6 A;  5EPS A;  3LDY A;  5IGN A;  2MD7 B;  5FDZ A;  2QIC A;  2F6N A;  2E7N A;  2VNF A;  3HCS A;  4TKP B;  4X2I A;  1K2F A;  5KH9 A;  2ECG A;  4YAB A;  5AME A;  5D1L B;  5EWH A;  2R0Y A;  2LV9 A;  3MHH A;  5EWW A;  2F42 A;  4TT4 A;  4UYF B;  4NS5 A;  2L84 A;  3LQI A;  4LDF A;  2RS9 B;  5C11 A;  3N9Q A;  5I1Q A;  3Q1D A;  2CSV A;  2CON A;  3G0L A;  3I3J A;  4NRB A;  4UYG A;  4UIT A;  3VKG A;  5LKU A;  4N3W A;  2RNW A;  2Y1M A;  2VPE A;  3PHD A;  5E9K A;  4A9H A;  3KDE C;  4NYW A;  2L80 A;  2YT5 A;  5AMF A;  2CSY A;  5SVX A;  3LJW A;  5DX4 A;  4CUS A;  5FE7 A;  2XB1 A;  5HRV A;  2YW8 A;  5D1M B;  5TBN A;  5HEL A;  2VJF A;  4BHW A;  5I86 A;  4Z93 A;  5HFQ A;  4YYK A;  4MSX A;  1ZS5 A;  2D82 A;  1T1H A;  3C6W A;  3FL2 A;  5F60 A;  5EPB A;  2R0V A;  3U5K A;  4BJX A;  2AN6 A;  2VPD A;  4V3K C;  5LCW B;  4UIW A;  2L85 A;  2MD8 C;  4YBS A;  2L75 A;  2MNY A;  2YYR A;  5DW2 A;  2E3K A;  2YEL A;  5EYA F;  4LZS A;  1X4J A;  2OUO A;  4TS8 A;  3N9P A;  4LZR A;  5C85 A;  5KTX A;  5A5S A;  5D3J A;  5EM3 A;  1WEU A;  3JUE A;  4X3G A;  4BBQ A;  2DVV A;  2H0D B;  4YH3 A;  5KO4 A;  5EP7 A;  4IR5 A;  4TT2 A;  5CQ5 A;  1MM2 A;  2VJE A;  3M63 A;  1N72 A;  5CUB A;  3MB3 A;  4YYD A;  1FP0 A;  1MBM A;  4YK0 A;  4O70 A;  2KU3 A;  5SVY A;  5HRW A;  2E61 A;  3FAN A;  1CHC A;  3U5L A;  5E74 A;  4YYJ A;  3UVD A;  2RSD A;  4YYM A;  2EOD A;  2YW5 A;  5ENF A;  1MM3 A;  5LUU A;  3DPL R;  4Y03 A;  5D7X A;  5EU1 A;  5FG4 A;  5FE5 A;  5D3P A;  5FE3 A;  4PPE A;  2DKW A;  4O72 A;  5ENE A;  5A5O A;  5H1V A;  3ZTG A;  5ETD A;  5EPR A;  3LJU X;  4NR8 A;  4YYG A;  1F62 A;  4H9D A;  4A9I A;  2L43 A;  4LAD B;  4GNF A;  5HEN A;  1LDK C;  5HJC A;  4A0C D;  4QUU A;  5B79 A;  5DFD A;  2MUM A;  5H1T A;  5FE1 A;  4TZ8 A;  2KRE A;  4TTE A;  3O34 A;  4J0S A;  5HFR A;  3ZYU A;  2KWK A;  2YQL A;  4XY8 A;  5L96 A;  5B77 A;  2OSS A;  4F1P A;  4AYC B;  1N87 A;  2FSA A;  3O33 A;  3G0J A;  2RNY A;  3SOW A;  3SVG A;  4C9Z A;  3HME A;  5EV9 A;  4QNS A;  2HDP A;  5CFW A;  4O74 A;  2KKX A;  2RO1 A;  3M7K A;  4QSR A;  3LVR E;  2E6R A;  1FBV A;  2H60 A;  2EGM A;  4IR4 A;  2M85 A;  2L5U A;  2OWA A;  4NRA A;  3UV2 A;  2MKE A;  3UVX A;  4LC2 A;  2DX8 A;  1E4U A;  1WUM A;  5BT5 A;  2YU4 A;  5FH7 A;  3ZYQ A;  5CUG A;  4QEW A;  4QEU A;  3K2J A;  2G45 A;  4UYF A;  1RMD A;  1WUG A;  4A9E A;  4O76 A;  1EQF A;  5HM0 A;  2B0O E;  1DVP A;  2CT2 A;  5A83 A;  3S92 A;  2C2V S;  2E7O A;  5DKH A;  4HXP A;  5D24 A;  2M13 A;  5ENJ A;  4NR4 A;  5FBX A;  5LKT A;  2YHN A;  2VP7 A;  2XOY A;  4QF3 A;  4QR3 A;  5CPE A;  5TDR A;  4NQM A;  2DWW A;  2LSP B;  2KKY A;  2YYN A;  3JVL A;  4RVR A;  4TQN A;  1HYI A;  3SVF A;  1WES A;  2JM3 A;  3ONI A;  5G4S A;  2D8U A;  5ENG A;  3EB5 A;  5LKZ A;  3EB6 A;  3O36 A;  5CP5 A;  4HBY A;  4IR3 A;  2K4D A;  4TU4 A;  4UIU A;  4MEP A;  5IBN A;  5E9V A;  3LQJ A;  5D26 A;  5FG6 A;  2I50 A;  2XEU A;  3P1F A;  2KTB B;  2EJN A;  4O7A A;  4ZUX U;  3DWY A;  5G04 B;  4HXO A;  3QZT A;  5DLZ A;  4QQ4 A;  5F61 A;  3DAI A;  3HMH A;  1Z6U A;  4CLB A;  5B78 A;  5F62 A;  2CRR A;  4NYX A;  2EA6 A;  4QB3 A;  2MJV B;  5IID A;  4E96 A;  4QSQ A;  4AKI A;  3GV4 A;  3GL6 A;  2HYE D;  5TRB A; 
#chains in the Genus database with same CATH homology
 4HBX A;  4YAD A;  4ALG A;  4UIY A;  2ZET C;  5FH6 A;  5A5P A;  2Y43 A;  4LR6 A;  4NQN A;  5DKC A;  4OGJ A;  4YYN A;  5EQ1 A;  4YY6 A;  4CUQ A;  3MXF A;  5C87 A;  2CSZ A;  4YYI A;  3LQH A;  5F3A A;  3T7L A;  5F2P A;  5G4R A;  4LLB A;  4LZ2 A;  3IU5 A;  5HCL A;  2RI7 A;  3O37 A;  4IC2 A;  5B75 A;  5ENB A;  4I7D A;  1WEQ A;  2L5E A;  3L1Z B;  2K17 A;  5ENI A;  1LDJ B;  2YEM A;  5F63 A;  1Z60 A;  1JM7 A;  2UZG A;  5D3L A;  3TLP A;  5ENC A;  1WEV A;  4UP0 A;  5FE6 A;  4YBT A;  2ECW A;  4HXN A;  5FFY A;  2Y1N A;  5DFC A;  4KV4 A;  5FB1 A;  3HTK C;  4QSW A;  2WP2 A;  4MR3 A;  4CFK A;  4NR6 A;  3O7A A;  5H9M A;  2ECT A;  1IYM A;  3L1X A;  3N9O A;  3JVM A;  4S3O C;  5D1K B;  3SHB A;  4IOQ A;  4YAX A;  5TDW A;  4LYS A;  4ZW1 A;  4QBM A;  2RNX A;  5II1 A;  4YY4 A;  4UIX A;  5L98 A;  4Q0N A;  1WGM A;  2ECV A;  3RPG C;  5ETB A;  2PNX A;  5DYA A;  4UP5 A;  2IDA A;  3PUQ A;  3AQA A;  4QSV A;  5BT4 A;  2DVQ A;  5CU8 A;  4XI1 A;  5IG6 A;  5E9M A;  5I89 A;  3DQV R;  2G4A A;  5CRM A;  2FUU A;  1WEO A;  5L8T A;  2FUI A;  3SOU A;  4QYD A;  5D3N A;  4ALH A;  3UVY A;  4GNE A;  5B76 A;  5EK9 A;  5CZG A;  4UYD A;  4F3I A;  3P1D A;  1WIM A;  5KH3 A;  2RFJ A;  4HXM A;  4NXJ A;  5COI A;  1WEW A;  2JMI A;  4FJC A;  4YC9 A;  4I7B A;  4O7B A;  2YRE A;  4P5O B;  2DVS A;  2BAY A;  4V3L C;  4QY4 A;  5C4Q A;  4FIP A;  5LVQ A;  1BOR A;  5DY7 A;  4A4C A;  4N4I A;  2D9E A;  5FER A;  2NXB A;  4CA1 A;  1VYX A;  5F1L A;  5A81 A;  4NN2 A;  2GRC A;  4QSX A;  5EWC A;  2VPB A;  2OO1 A;  5CTL A;  5FE9 A;  3T6R A;  5KTU A;  5A7C A;  5AIU A;  3MHS A;  2LXH C;  4YYH A;  2KIZ A;  5D3T A;  2KGI A;  2LGG A;  4A9L A;  1WEP A;  2M6M A;  2YUC A;  5E0R A;  4QF2 A;  4OUF A;  2YDW A;  5CQ3 A;  3ZPV E;  2R10 A;  3ZVY A;  5EI4 A;  4PCI A;  1X4U A;  1X0J A;  1WFK A;  4CUP A;  4UIZ A;  5CUC A;  4XUA A;  3UVW A;  2ECJ A;  3S91 A;  2LRI C;  4BW3 A;  5IGK A;  2YEK A;  4QUT A;  5DIN A;  4MR5 A;  5DLX A;  1JM4 B;  5G0F A;  4CUU A;  3FKM X;  4ZC9 A;  5ENH A;  2YUR A;  4PKL A;  5EIC A;  3N9L A;  3RTR B;  2G43 A;  2LN0 A;  4WZ0 A;  5CQ8 A;  2PUY A;  4MR6 A;  4NUD A;  4AP4 A;  5I7Y A;  5L99 A;  4Q0O A;  4HBV A;  2KWN A;  3V43 A;  4WZ3 B;  4HXL A;  5DKA A;  2MA6 A;  3Q2F A;  5DYU A;  4IOR A;  2ECN A;  4S3O B;  2D8S A;  4QYL A;  3Q2E A;  5FEY A;  5EVA A;  5HQ7 A;  2K16 A;  5DW1 A;  4QC3 A;  4QEV A;  5DYX A;  5D3R A;  3LRQ A;  4FK5 A;  5DBM A;  4AVX A;  4N4F A;  1VD4 A;  5CY9 A;  1V87 A;  5CQ6 A;  1ZBD B;  4IOO A;  5C8G A;  5LJ1 A;  4A49 A;  3ZPV 1;  4UYE A;  5E9I A;  5I7X A;  2H0D A;  4TZ2 A;  4WHW A;  1U6G B;  2DVR A;  5FG5 A;  4OGI A;  4WA6 A;  2I7K A;  1F68 A;  2LGV A;  3U5N A;  5KU3 A;  2M3H A;  5A5R A;  3ZNI A;  1E6I A;  5FFV A;  4O78 A;  4NRC A;  5I83 A;  4Z1Q A;  1X4I A;  3IHP A;  4W4U A;  4N4G A;  5II2 A;  5IGM A;  4MVT A;  5D3S A;  5AD2 A;  5FH8 A;  5CQ7 A;  4I7C A;  5JWM A;  4HXK A;  3JVJ A;  2KWO A;  2LGK A;  4O64 A;  5I3L A;  4O7F A;  4CL9 A;  3P1E A;  4NR5 A;  2KE1 A;  2MT5 A;  2YSM A;  5F1H A;  3KQI A;  4FO9 A;  5L97 A;  4Z1S A;  4LJN A;  5D3H A;  4J3I A;  2E6S A;  4WZ2 A;  3JVK A;  5ACY A;  1WEE A;  1Z2Q A;  2CKL B;  4IC3 A;  3IU6 A;  5F25 A;  4QZS A;  5E3D A;  3ZVZ B;  3U5O A;  3MQM A;  2YHO A;  2ECI A;  3HCU A;  4Z6I A;  3UW9 A;  5B8D A;  4GPJ A;  2MA5 A;  3L11 A;  4A4B A;  4XY9 A;  4L58 A;  3QZS A;  4R2Y A;  4F52 B;  4HBW A;  4A9O A;  5D0C A;  4AYC A;  3MUK A;  5CRZ A;  3MUL A;  4XYA A;  4TU6 A;  4J1P A;  4CUR A;  3KNV A;  2N9G A;  2JMD A;  5JG6 A;  4N4H A;  4YBM A;  5HLS A;  5J0D A;  1WIL A;  2L0B A;  5A82 A;  2WP1 A;  4PY6 A;  5E3G A;  3KV5 A;  4DON A;  3HCT A;  3O70 A;  4LYI A;  4L7X A;  5HEM A;  4A9F A;  4O71 A;  4MEN A;  1G25 A;  3U5J A;  4O7E A;  2OXQ C;  5DYC A;  4PCE A;  2YQM A;  4J0R A;  5E7D A;  4A9M A;  4KV1 A;  3P5O A;  4PS5 A;  2JMJ A;  5F5Z A;  4LK9 A;  5I40 A;  4ZDT A;  4WIV A;  3HMF A;  4C66 A;  5I80 A;  4GNG A;  5E9L A;  5A85 A;  5E73 A;  2I8N A;  2F6J A;  1XWH A;  5HQ5 A;  3I2D A;  4YH4 A;  5LJ0 A;  4CFL A;  5CQT A;  2YSJ A;  3M99 A;  3UV5 A;  5FFW A;  2DAT A;  4LRG A;  5CQ4 A;  4BW4 A;  4UIV A;  4CUT A;  5A5Q A;  5AD3 A;  4AUQ B;  5F36 A;  1WEN A;  2EGP A;  2KR4 A;  3PUR A;  3MB4 A;  5C89 A;  2VJF B;  4O77 A;  3VK6 A;  4MR4 A;  5BT3 A;  1VFY A;  4NR9 A;  2KYU A;  2LXP C;  2KGG A;  5CUA A;  1JOC A;  4O75 A;  4MEO A;  4GB0 A;  4LKA A;  5FE4 A;  5KTW A;  1JM7 B;  2QJ0 A;  5L8U A;  4A9J A;  4A9N A;  3N9N A;  5D25 A;  4O7C A;  4NUC A;  3M62 A;  3O35 A;  4NYV A;  3GG3 A;  5KH7 A;  4UYH A;  4Z6H A;  5DFB A;  5TAB A;  4NR7 A;  5FB0 A;  1WEM A;  2KFT A;  5EIS A;  4NUE A;  5IGL A;  2JRJ A;  5CGP A;  3U5P A;  4TT6 A;  5E9Y A;  5LJ2 A;  3NXB A;  4R8P K;  4QST A;  5FE8 A;  3N9M A;  2VPG A;  2VJE B;  4B7Y C;  4KCX A;  2R0S A;  5G05 B;  2MIQ A;  5EWD A;  2LGL A;  3SVH A;  3AAD A;  5CS8 A;  2QIZ A;  5J3X A;  4QSP A;  5HQ6 A;  2G6Q A;  5AIT A;  4CCG X;  1HYJ A;  3NG2 A;  4GND A;  4WHU A;  4HXS A;  5TCM A;  2YQD A;  4UI9 B;  3ASL A;  5LKX A;  2M1R A;  4QSU A;  5EWV A;  5CUE A;  5CQA A;  3RCW A;  1WE9 A;  2K1J A;  4HXR A;  4Q6F A;  5C7N A;  3SOX A;  4BW1 A;  5H1U A;  4FLP A;  5H85 A;  4PTB A;  4B86 C;  2CKL A;  2NAA A;  4R7E A;  5TB6 A;  1JSP B;  5EA1 A;  3RPG B;  5FE2 A;  4TYL A;  4QR5 A;  5DKD A;  4MEQ A;  4QC1 A;  4QR4 A;  4ZQL A;  5FE0 A;  5HRX A;  5I29 A;  2LDR A;  3KV6 A;  4AKN A;  3QZV A;  4YAT A;  5JI8 A;  2C2L A;  5C13 A;  4QSS A;  5EGU A;  5I88 A;  3LXJ A;  4BW2 A;  4LYW A;  5A5N A;  5K29 A;  2MNZ A;  5KHM A;  4A9K A;  2KWJ A;  2LQ6 A;  3C5K A;  5LVR A;  3D7C A;  4XUB A;  4C67 A;  3P1C A;  3UV4 A;  3U5M A;  5CUD A;  4IR6 A;  5EPS A;  5IGN A;  2MD7 B;  5FDZ A;  2QIC A;  2F6N A;  2E7N A;  2VNF A;  3HCS A;  4TKP B;  4X2I A;  1K2F A;  5KH9 A;  2ECG A;  4YAB A;  5AME A;  5D1L B;  5EWH A;  2R0Y A;  2LV9 A;  3MHH A;  5EWW A;  2F42 A;  4TT4 A;  4UYF B;  4NS5 A;  2L84 A;  3LQI A;  4LDF A;  2RS9 B;  5C11 A;  3N9Q A;  5I1Q A;  3G0L A;  3I3J A;  4NRB A;  4UYG A;  4UIT A;  5LKU A;  4N3W A;  2RNW A;  2Y1M A;  2VPE A;  3PHD A;  5E9K A;  4A9H A;  4NYW A;  2L80 A;  2YT5 A;  5AMF A;  2CSY A;  3LJW A;  5DX4 A;  4CUS A;  5FE7 A;  2XB1 A;  5HRV A;  2YW8 A;  5D1M B;  5TBN A;  5HEL A;  2VJF A;  4BHW A;  5I86 A;  4Z93 A;  5HFQ A;  4YYK A;  4MSX A;  2D82 A;  1ZS5 A;  1T1H A;  3C6W A;  3FL2 A;  5F60 A;  5EPB A;  2R0V A;  3U5K A;  4BJX A;  2AN6 A;  2VPD A;  4V3K C;  5LCW B;  4UIW A;  2L85 A;  2MD8 C;  4YBS A;  2L75 A;  2MNY A;  2YYR A;  5DW2 A;  2E3K A;  2YEL A;  5EYA F;  4LZS A;  1X4J A;  2OUO A;  4TS8 A;  3N9P A;  4LZR A;  5C85 A;  5KTX A;  5A5S A;  5D3J A;  5EM3 A;  1WEU A;  4X3G A;  4BBQ A;  2DVV A;  2H0D B;  4YH3 A;  5KO4 A;  5EP7 A;  4IR5 A;  4TT2 A;  5CQ5 A;  1MM2 A;  2VJE A;  3M63 A;  1N72 A;  5CUB A;  3MB3 A;  4YYD A;  1FP0 A;  4YK0 A;  4O70 A;  2KU3 A;  5HRW A;  1CHC A;  3U5L A;  5E74 A;  4YYJ A;  3UVD A;  2RSD A;  4YYM A;  2EOD A;  2YW5 A;  5ENF A;  1MM3 A;  5LUU A;  3DPL R;  4Y03 A;  5D7X A;  5EU1 A;  5FG4 A;  5FE5 A;  5D3P A;  5FE3 A;  4PPE A;  2DKW A;  4O72 A;  5ENE A;  5A5O A;  5H1V A;  3ZTG A;  5ETD A;  5EPR A;  4NR8 A;  4YYG A;  1F62 A;  4A9I A;  2L43 A;  4LAD B;  4GNF A;  5HEN A;  1LDK C;  5HJC A;  4A0C D;  4QUU A;  5B79 A;  5DFD A;  2MUM A;  5H1T A;  5FE1 A;  4TZ8 A;  2KRE A;  4TTE A;  3O34 A;  4J0S A;  5HFR A;  3ZYU A;  2KWK A;  2YQL A;  4XY8 A;  5L96 A;  5B77 A;  2OSS A;  4AYC B;  1N87 A;  2FSA A;  3O33 A;  3G0J A;  2RNY A;  3SOW A;  3SVG A;  4C9Z A;  3HME A;  5EV9 A;  4QNS A;  2HDP A;  5CFW A;  4O74 A;  2RO1 A;  4QSR A;  2E6R A;  1FBV A;  2H60 A;  4IR4 A;  2M85 A;  2L5U A;  4NRA A;  3UV2 A;  3UVX A;  4LC2 A;  2DX8 A;  1E4U A;  1WUM A;  5BT5 A;  2YU4 A;  5FH7 A;  3ZYQ A;  5CUG A;  4QEW A;  4QEU A;  3K2J A;  2G45 A;  4UYF A;  1RMD A;  1WUG A;  4A9E A;  4O76 A;  1EQF A;  5HM0 A;  1DVP A;  2CT2 A;  5A83 A;  3S92 A;  2C2V S;  2E7O A;  5DKH A;  4HXP A;  5D24 A;  5ENJ A;  4NR4 A;  5FBX A;  5LKT A;  2YHN A;  2VP7 A;  4QF3 A;  4QR3 A;  5CPE A;  5TDR A;  4NQM A;  2DWW A;  2LSP B;  2YYN A;  3JVL A;  4RVR A;  4TQN A;  1HYI A;  3SVF A;  1WES A;  3ONI A;  5G4S A;  3EB5 A;  5ENG A;  5LKZ A;  3EB6 A;  3O36 A;  5CP5 A;  4HBY A;  4IR3 A;  2K4D A;  4TU4 A;  4UIU A;  4MEP A;  5IBN A;  5E9V A;  3LQJ A;  5D26 A;  5FG6 A;  2I50 A;  2XEU A;  3P1F A;  2KTB B;  4O7A A;  4ZUX U;  3DWY A;  5G04 B;  4HXO A;  3QZT A;  5DLZ A;  5F61 A;  3DAI A;  3HMH A;  1Z6U A;  4CLB A;  5B78 A;  5F62 A;  4NYX A;  2EA6 A;  4QB3 A;  2MJV B;  5IID A;  4E96 A;  4QSQ A;  3GV4 A;  3GL6 A;  2HYE D;  5TRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...