5FB1A

Crystal structure of a phd finger bound to histone h3 k9me3 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
174
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYGPQKPMWLNKVKTSLNEQTYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
molecule keywords Nuclear autoantigen Sp-100
total genus 57
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb1A01
3UVXA 4A9HA 3UVYA 3VK6A 5DLZA 5I40A 4DONA 5D0CA 5K29A 5TBNA 4LRGA 3RPGB 3JVLA 5E3DA 5FG4A 2M85A 4XYAA 4NS5A 4O72A 2LN0A 5J0DA 4V3LC 4FK5A 3ZPVE 5G4RA 4O70A 5CQTA 3SOXA 4O7BA 3EB6A 5E0RA 4MEPA 4N4IA 4GPJA 4Z6IA 5AITA 2YT5A 3M63A 5DLXA 5E9KA 3EB5A 5F1HA 4ZDTA 3NXBA 5DY7A 3IHPA 5D1LB 1Z2QA 2L84A 5EV9A 2MNYA 4R2YA 3HCSA 2YQLA 4UYFB 4KV1A 4QSVA 3AQAA 1E4UA 2YEKA 3HMEA 5E9VA 5I89A 4IC3A 5IGMA 5ENIA 2LGVA 1MM3A 4A9JA 5F5ZA 1DVPA 4NR4A 5E73A 5KTUA 5LKXA 4QB3A 2ECJA 5G4SA 4IOQA 1WIMA 4HXPA 1N87A 5FB0A 5D7XA 5CUEA 5ACYA 5F61A 4OGIA 5FFYA 3O36A 2RI7A 5CUDA 4A9KA 2HDPA 5FG6A 4O7FA 2QJ0A 1EQFA 2G4AA 3KV6A 4Q6FA 2RNYA 1WFKA 2ZETC 2CSZA 4NRCA 5D3SA 4AKNA 2KFTA 5D3PA 4LKAA 2VP7A 5II2A 5B75A 4LJNA 4CFKA 2LRIC 2MNZA 5FFVA 4MENA 3HCUA 3N9QA 4YY6A 2JMDA 5DFDA 1Z60A 5C4QA 5EWCA 3C6WA 4Z1SA 5D25A 5AMFA 2M3HA 3HCTA 2M1RA 2MIQA 1WEVA 2YQDA 5AD3A 1X4JA 3IU5A 5EU1A 1WEEA 2EGPA 5LJ1A 4UP5A 3UW9A 2LDRA 5C13A 2WP1A 5CUGA 5ENEA 4YADA 5BT4A 4IR6A 2KR4A 5F62A 5IG6A 5LJ0A 4UIZA 5HELA 5H1UA 4BHWA 2RO1A 2MA6A 2KE1A 4HXMA 2F42A 5CRZA 5I7YA 5EWVA 3M99A 1ZBDB 3QZVA 4NYXA 4J0RA 4IR4A 4NYWA 4CLBA 4TT4A 1VFYA 5D3HA 5BT5A 2G43A 5FE1A 4QZSA 4XUAA 2VPBA 2CT2A 5HEMA 1LDKC 4CUQA 2L43A 4NUDA 3JVMA 4GNEA 4UYFA 5FE0A 5BT3A 5DKHA 5EWHA 4YY4A 2H0DB 2E3KA 5CQ7A 3RTRB 3DAIA 2LGKA 4F52B 2PNXA 4XUBA 4UI9B 1ZS5A 2E7NA 4ZW1A 5C7NA 4QSPA 4KCXA 5HENA 3N9NA 4HBYA 5CU8A 5HQ6A 4MEQA 5F63A 5C8GA 4PCIA 5L99A 5D26A 4ZQLA 2C2VS 4A9FA 5EI4A 4CUSA 5FE3A 5FBXA 4LYSA 2VJEA 4TU6A 1IYMA 5IGNA 1WEWA 4IOOA 4TT6A 2OSSA 5B77A 1HYIA 4YYNA 5CQ8A 5HRVA 5I7XA 1WEOA 5L96A 4TZ8A 2Y1MA 4QR4A 5C11A 4YYHA 5C89A 1FBVA 2KREA 2KTBB 2WP2A 5DYXA 2D82A 5EICA 5CGPA 4UIUA 5EYAF 4CA1A 1E6IA 2OUOA 5E9LA 4BJXA 5B79A 5L8UA 4AYCA 4BW3A 4LR6A 4NRBA 2YEMA 4O76A 2YSMA 2E6RA 5TCMA 5ETDA 2VJFA 3U5JA 2MT5A 4OGJA 4TKPB 3RCWA 5B76A 4QSUA 5E9IA 4YBSA 4YYIA 4L58A 3G0JA 5J3XA 1JM7B 1JM7A 1X0JA 4NN2A 3Q2EA 5DYUA 5D3LA 2I8NA 1X4UA 5CQ6A 4TZ2A 1T1HA 4FO9A 5A82A 4ZUXU 4FLPA 4QR3A 5FH8A 4O77A 4IORA 2YYRA 4HXSA 5C87A 5I83A 5JWMA 2KGIA 4CUPA 2QICA 3T7LA 1XWHA 2VPDA 2LXPC 4TQNA 4XY9A 4CUTA 2L80A 3LQJA 3MHHA 4WHUA 2KWJA 3O35A 4NR9A 3P1DA 4R7EA 1BORA 5FFWA 3V43A 4GNFA 4NXJA 3SVFA 3FL2A 3LRQA 4QYLA 4FJCA 5EM3A 5HQ7A 5CFWA 5FE5A 2KWKA 5LKUA 4Y03A 5HRXA 4TS8A 4CFLA 3ZPV1 1WILA 3DWYA 5D3NA 3UV4A 4YBMA 2KU3A 1WEQA 4LYWA 2LGGA 2YDWA 4MR4A 4LK9A 5G05B 2OO1A 5KH7A 4TYLA 5A85A 4PS5A 1WEPA 4B7YC 5F25A 2C2LA 4R8PK 3MB4A 5F3AA 3HMHA 4LZSA 4QNSA 5LKTA 5TDWA 2UZGA 4AUQB 4LC2A 5HM0A 3MUKA 2G45A 2L0BA 4J0SA 4YH4A 5LVRA 4PPEA 3U5NA 2YHNA 4XI1A 4S3OB 3RPGC 4W4UA 4I7BA 4QY4A 3U5OA 5D3TA 5A83A 5LVQA 4QC3A 3KV5A 3LJWA 4AVXA 2YURA 4UYHA 4UIVA 5EQ1A 5HJCA 4QSXA 3MHSA 4C67A 3JVJA 5EWWA 2EODA 5TRBA 5ENBA 4PKLA 5FE4A 4UIYA 3U5LA 2L85A 5A7CA 4MVTA 2KIZA 5FE9A 4N3WA 5CTLA 1X4IA 4MR6A 4WA6A 4A9IA 4BBQA 3AADA 5LUUA 5F1LA 4N4FA 3UVDA 2K17A 2YELA 2NXBA 4GB0A 5B8DA 4LADB 2DVRA 2XEUA 4PY6A 5CUBA 3MQMA 4MEOA 4O7EA 5DW1A 3SVHA 4YYMA 4WIVA 3N9MA 5TABA 5EPSA 3ZTGA 3U5MA 2PUYA 4WHWA 4TU4A 5DX4A 3PURA 5COIA 5G0FA 4TT2A 5FH6A 2DVQA 5D1KB 5KHMA 4AYCB 2KWNA 3PHDA 3IU6A 3I2DA 5E9MA 5DBMA 5I86A 4YATA 4YABA 5KTXA 2ECWA 2I7KA 5EA1A 2LGLA 4A9MA 2BAYA 2KYUA 4O7AA 2EA6A 3MB3A 5D1MB 4MR3A 5ENJA 4S3OC 5CPEA 5ENFA 3PUQA 3JVKA 1JSPB 3N9PA 4Q0NA 4HXRA 5A5PA 4N4GA 5CQAA 4O78A 4YYJA 5L8TA 4QEVA 4Z1QA 2NAAA 3HMFA 4NUCA 4GNDA 4PTBA 2YW8A 5CQ5A 2KGGA 2YREA 5DW2A 5FDZA 4WZ2A 3GL6A 5LCWB 4NUEA 5H1VA 4V3KC 3ZVZB 4NR7A 2H0DA 4A4BA 5CP5A 4P5OB 2G6QA 4QSSA 3DPLR 4N4HA 5TDRA 4A9OA 3O70A 2RNXA 5ETBA 2I50A 4HXNA 2L75A 1WE9A 2FUUA 3KNVA 3N9LA 1VYXA 4FIPA 3ZYQA 5F2PA 3Q2FA 5D3JA 4IR5A 5EWDA 3FKMX 4QSQA 5AIUA 2DVVA 3ZNIA 3P1CA 5AD2A 5FG5A 5KU3A 4C9ZA 1N72A 3QZTA 2KWOA 2ECNA 4GNGA 4ALHA 1CHCA 5EGUA 5KTWA 5KH3A 1WENA 4Z93A 2LQ6A 5HFQA 5IBNA 4QEWA 4UYDA 1WUMA 3P5OA 2R0VA 1WESA 2IDAA 2JRJA 5H1TA 2D9EA 4HBWA 5FH7A 4UITA 2YHOA 5H9MA 2YU4A 4BW4A 4A0CD 5CUCA 2JMJA 5JI8A 2YQMA 2RFJA 2RSDA 2DX8A 3SOWA 3TLPA 2YUCA 1JOCA 3LQHA 4TTEA 4NR8A 4NYVA 1U6GB 2MUMA 5JG6A 3N9OA 3UV2A 5I1QA 2OXQC 2M6MA 3O37A 2F6NA 5CUAA 5B78A 4WZ3B 2R10A 4UIXA 5CRMA 5E7DA 5FE6A 5CZGA 5HLSA 5TB6A 1V87A 5F36A 4X2IA 1WGMA 4J3IA 2R0SA 4A49A 2CKLB 5II1A 2LV9A 4YBTA 4QSWA 5A5OA 4QF3A 5FE7A 4CCGX 4NQMA 4WZ0A 2K4DA 2N9GA 4B86C 3MXFA 4QYDA 5I29A 5IGLA 1RMDA 2K16A 5FEYA 2DKWA 5KH9A 4A4CA 5FB1A 2MD7B 4LYIA 4O71A 3P1FA 5L98A 5HRWA 5I3LA 5E74A 4UYEA 5DYCA 5G04B 3LXJA 4YH3A 5DFCA 5EISA 5FE2A 2YW5A 4YYKA 5C85A 3U5KA 2DVSA 4HBXA 4PCEA 4XY8A 4HXKA 3ZVYA 2F6JA 4QSRA 4HXLA 5D3RA 5EPRA 4AP4A 2RNWA 2MA5A 5DFBA 2MJVB 3M62A 5A5NA 3T6RA 3SVGA 4YC9A 5L97A 4UYGA 4UP0A 5EP7A 2VJEB 3O34A 4KV4A 3C5KA 2YYNA 3QZSA 1K2FA 4ALGA 2DWWA 1VD4A 4O75A 2VPGA 2Y43A 5I80A 2XB1A 5ENGA 2DATA 3ONIA 4YK0A 4NR5A 2QIZA 5EK9A 2AN6A 2K1JA 3NG2A 2D8SA 4CURA 4MR5A 4C66A 3O33A 4Q0OA 5HQ5A 5ENCA 1WEUA 5DKCA 4LZRA 2R0YA 4LZ2A 2VPEA 3K2JA 5DYAA 2E7OA 1JM4B 2FUIA 3UV5A 3G0LA 4QF2A 3UVWA 5FE8A 4CL9A 5CY9A 3DQVR 4O64A 4BW2A 5E9YA 2MD8C 5H85A 5E3GA 5D24A 4CUUA 5EVAA 1WEMA 4LDFA 4RVRA 4HBVA 1MM2A 4LLBA 3KQIA 1F62A 4IR3A 5IGKA 2GRCA 4HXOA 5HFRA 2H60A 5LJ2A 3S91A 4O7CA 4YAXA 2JMIA 4QEUA 5DKDA 5I88A 2CSYA 5IIDA 2E6SA 2Y1NA 4A9EA 4OUFA 5CQ3A 4NQNA 3L1XA 2LSPB 3HTKC 5KO4A 4QUTA 4I7DA 1Z6UA 1WUGA 4ZC9A 2ECGA 4NRAA 5ENHA 2RS9B 4QR5A 2CKLA 1F68A 4O74A 4QC1A 2ECIA 5DKAA 3SHBA 4QUUA 5CQ4A 2ECVA 2HYED 3P1EA 3S92A 4MSXA 1HYJA 4A9NA 2ECTA 4J1PA 2FSAA 4IC2A 5A5QA 5DINA 3ASLA 1LDJB 3GV4A 3GG3A 4BW1A 4L7XA 4Z6HA 4X3GA 4I7CA 4UIWA 2L5UA 5A5RA 5LKZA 4E96A 3L1ZB 3SOUA 5A81A 2VJFB 2VNFA 4QSTA 1FP0A 3ZYUA 5HCLA 3O7AA 5EPBA 2YSJA 2LXHC 3I3JA 5F60A 1G25A 3D7CA 5A5SA 3L11A 3LQIA 4YYGA 3U5PA 4A9LA 5FERA 3MULA 4YYDA 4F3IA 5AMEA 5CS8A 2L5EA 4QBMA 4NR6A
chains in the Genus database with same CATH superfamily
3UVXA 4A9HA 3UVYA 3VK6A 5DLZA 5I40A 4DONA 2P57A 5D0CA 5K29A 5TBNA 4LRGA 3RPGB 3JVLA 5E3DA 5FG4A 2M85A 4XYAA 4NS5A 4O72A 2LN0A 5J0DA 4V3LC 4FK5A 3ZPVE 5G4RA 4O70A 5CQTA 3SOXA 4O7BA 3EB6A 5E0RA 4MEPA 4N4IA 4GPJA 4Z6IA 5AITA 2YT5A 3M63A 5DLXA 5E9KA 3EB5A 5F1HA 4ZDTA 3NXBA 5DY7A 3IHPA 5D1LB 1Z2QA 2L84A 5EV9A 2IQJA 2MNYA 3HCSA 2YQLA 4UYFB 4R2YA 4KV1A 5SVIA 4QSVA 3AQAA 1E4UA 2YEKA 3HMEA 5E9VA 5I89A 4IC3A 5IGMA 5ENIA 2XOZA 2LGVA 1MM3A 4A9JA 5F5ZA 1DVPA 4NR4A 5E73A 5KTUA 5LKXA 4QB3A 2ECJA 5G4SA 4IOQA 2M13A 1WIMA 4HXPA 1N87A 5FB0A 5D7XA 5CUEA 5ACYA 5F61A 4OGIA 5FFYA 3O36A 2RI7A 5CUDA 4A9KA 4F1PA 2HDPA 5FG6A 4O7FA 2QJ0A 1EQFA 2G4AA 3KV6A 4Q6FA 2RNYA 1WFKA 2ZETC 2CSZA 3LVRE 4NRCA 5D3SA 4AKNA 2KFTA 5D3PA 2LAUA 4LKAA 2VP7A 5II2A 5B75A 4LJNA 4CFKA 2LRIC 2FD4A 2MNZA 5FFVA 4MENA 3HCUA 3N9QA 4YY6A 2JMDA 5DFDA 1Z60A 4AKHA 5C4QA 5EWCA 3C6WA 4Z1SA 5D25A 5AMFA 2M3HA 3HCTA 2M1RA 2MIQA 1WEVA 2YQDA 5AD3A 1X4JA 4Z0OA 3IU5A 5EU1A 1WEEA 2EGPA 5LJ1A 4UP5A 3UW9A 2LDRA 5C13A 2WP1A 2XOYA 5CUGA 5ENEA 4YADA 5BT4A 2B0OE 4IR6A 2KR4A 5F62A 5IG6A 5LJ0A 4UIZA 5HELA 5H1UA 4BHWA 2RO1A 2MA6A 2KE1A 4HXMA 2F42A 5CRZA 5I7YA 5EWVA 3M99A 2CONA 1ZBDB 3QZVA 4NYXA 4J0RA 4IR4A 4NYWA 4CLBA 4TT4A 1VFYA 5D3HA 5BT5A 2G43A 5FE1A 4QZSA 4XUAA 2VPBA 2CT2A 5HEMA 1LDKC 4CUQA 2L43A 4NUDA 3JVMA 4GNEA 4UYFA 5FE0A 2CRRA 5BT3A 5DKHA 5EWHA 4YY4A 2H0DB 2E3KA 5CQ7A 3RTRB 3DAIA 2LGKA 4F52B 2PNXA 4XUBA 4UI9B 1ZS5A 2E7NA 4ZW1A 5C7NA 3VKGA 4QSPA 4KCXA 5HENA 3N9NA 4HBYA 5CU8A 5HQ6A 4MEQA 5F63A 5C8GA 4PCIA 5L99A 5D26A 4ZQLA 2C2VS 4A9FA 5EI4A 4CUSA 5FE3A 5FBXA 4AKIA 4LYSA 2VJEA 4TU6A 1IYMA 5IGNA 1WEWA 4IOOA 4TT6A 2OSSA 5B77A 1HYIA 4YYNA 5CQ8A 5HRVA 5I7XA 1WEOA 5L96A 4TZ8A 2Y1MA 4QR4A 5C11A 4YYHA 5C89A 1FBVA 2KREA 2KTBB 2WP2A 5DYXA 2D82A 5EICA 5CGPA 3FEHA 4UIUA 3Q1DA 5EYAF 1E6IA 2OUOA 5E9LA 4BJXA 4CA1A 5L8UA 5B79A 4AYCA 4BW3A 4LR6A 4NRBA 2YEMA 4O76A 2CSVA 2YSMA 2E6RA 5TCMA 3LDYA 5ETDA 2VJFA 3U5JA 2MT5A 4OGJA 4TKPB 3RCWA 5B76A 4QSUA 5E9IA 4YBSA 4OGCA 4YYIA 4L58A 3G0JA 3FANA 5J3XA 1JM7B 1JM7A 1X0JA 4NN2A 3Q2EA 3M7KA 5DYUA 5D3LA 2I8NA 1X4UA 5CQ6A 4TZ2A 1T1HA 4FO9A 5A82A 4ZUXU 4FLPA 5K3QA 4QR3A 5FH8A 4O77A 4IORA 2YYRA 4HXSA 5C87A 5I83A 5JWMA 3O47A 2KGIA 4CUPA 2QICA 3T7LA 1XWHA 2VPDA 2DSMA 2LXPC 4TQNA 4XY9A 4CUTA 2L80A 3LQJA 3LVQE 4WHUA 2KWJA 3MHHA 3O35A 2JUNA 4NR9A 3P1DA 4R7EA 1BORA 5FFWA 3V43A 4GNFA 4NXJA 3SVFA 3FL2A 3FJUB 3LRQA 4QYLA 4FJCA 5EM3A 3FAOA 5HQ7A 5CFWA 5FE5A 2KWKA 5LKUA 4Y03A 5HRXA 4TS8A 4CFLA 3ZPV1 1WILA 3DWYA 5D3NA 3UV4A 4YBMA 2KU3A 1WEQA 4LYWA 2LGGA 2YDWA 1MBMA 4MR4A 4LK9A 5G05B 2OO1A 5KH7A 4TYLA 5A85A 4PS5A 1WEPA 4B7YC 5F25A 2C2LA 4R8PK 3MB4A 5F3AA 3HMHA 1DCQA 4LZSA 4QNSA 5LKTA 3FM8C 5TDWA 4AKGA 2UZGA 4AUQB 4LC2A 5HM0A 3MUKA 2JM3A 2G45A 2L0BA 4J0SA 4YH4A 5LVRA 4PPEA 3U5NA 2YHNA 4XI1A 4S3OB 2EGMA 3RPGC 4W4UA 4I7BA 4QY4A 3U5OA 5D3TA 5A83A 5LVQA 4QC3A 3KV5A 3LJWA 4AVXA 2YURA 4UYHA 4UIVA 5EQ1A 5HJCA 4QSXA 2RR4A 4C67A 3JVJA 5EWWA 2EODA 3MHSA 5TRBA 5ENBA 4PKLA 5FE4A 4UIYA 3U5LA 2L85A 5A7CA 4MVTA 2KIZA 5FE9A 4N3WA 5CTLA 1X4IA 4MR6A 4WA6A 4A9IA 4BBQA 3AADA 5LUUA 5F1LA 4N4FA 3UVDA 2K17A 2YELA 2NXBA 4GB0A 5B8DA 4LADB 2DVRA 2XEUA 4PY6A 5CUBA 3MQMA 4MEOA 4O7EA 5DW1A 3SVHA 2KKYA 4YYMA 3E2DA 4WIVA 3N9MA 5TABA 5EPSA 3ZTGA 3U5MA 2PUYA 4WHWA 4TU4A 5DX4A 3PURA 5COIA 5G0FA 4TT2A 5FH6A 2DVQA 5D1KB 5KHMA 4AYCB 2KWNA 3H7HA 3PHDA 3IU6A 3I2DA 5E9MA 5DBMA 5I86A 4YATA 4YABA 5KTXA 2ECWA 2I7KA 5EA1A 2LGLA 5SVXA 4A9MA 2BAYA 2KYUA 4O7AA 2EA6A 3MB3A 5D1MB 4MR3A 5SVIB 5ENJA 4S3OC 5CPEA 5ENFA 3PUQA 3JVKA 1JSPB 3N9PA 4Q0NA 4HXRA 5A5PA 4N4GA 5CQAA 4O78A 4YYJA 5L8TA 3D1BA 4QEVA 4Z1QA 2EXUA 2NAAA 3HMFA 4NUCA 4GNDA 4PTBA 2YW8A 5CQ5A 2KGGA 2YREA 5DW2A 5FDZA 4WZ2A 3GL6A 5LCWB 4NUEA 5H1VA 4V3KC 3ZVZB 4NR7A 2H0DA 4H9DA 4A4BA 5CP5A 4P5OB 2G6QA 4QSSA 3DPLR 4N4HA 5TDRA 4A9OA 3O70A 2RNXA 5ETBA 2I50A 4HXNA 2L75A 1WE9A 2FUUA 3KNVA 3N9LA 1VYXA 4Z0RA 4FIPA 3ZYQA 5F2PA 3Q2FA 5D3JA 4IR5A 5EWDA 3FKMX 4QSQA 5AIUA 2DVVA 3ZNIA 2OWAA 3P1CA 2D8UA 5AD2A 5FG5A 5KU3A 4C9ZA 1N72A 2L7PA 2KKXA 3QZTA 2KWOA 2CRWA 2ECNA 4GNGA 4ALHA 1CHCA 5EGUA 5KTWA 5KH3A 1WENA 4Z93A 2LQ6A 5HFQA 5IBNA 4QEWA 4UYDA 3MDBC 1WUMA 3P5OA 2R0VA 1WESA 2IDAA 2JRJA 5H1TA 2D9EA 4HBWA 5FH7A 4UITA 2YHOA 5H9MA 2YU4A 4BW4A 4A0CD 5CUCA 2JMJA 5JI8A 4QQ4A 2YQMA 2RFJA 2RSDA 3T9KA 2DX8A 3SOWA 3TLPA 2YUCA 1JOCA 3LQHA 4TTEA 4NR8A 4NYVA 1U6GB 2MUMA 5JG6A 3N9OA 3UV2A 5I1QA 2OXQC 2M6MA 3O37A 2F6NA 5CUAA 5B78A 4WZ3B 2R10A 4UIXA 5CRMA 5E7DA 5FE6A 5CZGA 5HLSA 5TB6A 1V87A 5F36A 4X2IA 1WGMA 4J3IA 2R0SA 3DWDA 4A49A 2CKLB 5II1A 2LV9A 4YBTA 4QSWA 3SOUA 5A5OA 4QF3A 5FE7A 4CCGX 4NQMA 4WZ0A 2K4DA 2N9GA 4B86C 3MXFA 4QYDA 5I29A 5IGLA 1ZKRA 1RMDA 3DDTA 2K16A 5FEYA 2DKWA 2XOCA 3JUEA 5KH9A 4A4CA 5FB1A 2MD7B 2YVRA 4LYIA 4O71A 3P1FA 5L98A 5HRWA 3LJUX 5I3LA 5E74A 2EJNA 4UYEA 5DYCA 5G04B 3LXJA 4YH3A 5DFCA 5EISA 5FE2A 5SVYA 2YW5A 4YYKA 5C85A 3U5KA 2DVSA 4HBXA 4PCEA 4XY8A 4HXKA 3ZVYA 2F6JA 4QSRA 4HXLA 5D3RA 5EPRA 2FFWA 4AP4A 2RNWA 2MA5A 5DFBA 2MJVB 3M62A 5A5NA 3T6RA 3SVGA 4YC9A 5L97A 4UYGA 4UP0A 5EP7A 2VJEB 3O34A 4KV4A 3C5KA 2YYNA 3QZSA 1K2FA 4ALGA 2DWWA 1VD4A 4O75A 2VPGA 2Y43A 5I80A 2XB1A 5ENGA 3ERRA 2DATA 3D1DA 3ONIA 4NR5A 4YK0A 2QIZA 5EK9A 2AN6A 2K1JA 3NG2A 2D8SA 4CURA 4MR5A 4C66A 3O33A 4Q0OA 5HQ5A 5ENCA 1WEUA 5DKCA 4LZRA 2R0YA 4LZ2A 2VPEA 3K2JA 5DYAA 2E7OA 1JM4B 2FUIA 3SUBA 3UV5A 3G0LA 4QF2A 3UVWA 5FE8A 4CL9A 5CY9A 3DQVR 4O64A 4BW2A 4O62A 5E9YA 2MD8C 5H85A 5E3GA 1PUOA 5D24A 3PLWA 4CUUA 5EVAA 1WEMA 4LDFA 4RVRA 4HBVA 1MM2A 4LLBA 3KQIA 1F62A 4IR3A 5IGKA 2GRCA 4HXOA 5HFRA 2H60A 5LJ2A 3KDEC 3S91A 4O7CA 4YAXA 2JMIA 4QEUA 5DKDA 5I88A 2CSYA 5IIDA 2E6SA 2DJAA 2Y1NA 4A9EA 4AI6A 4OUFA 5CQ3A 4NQNA 3L1XA 2LSPB 3HTKC 5KO4A 4QUTA 4I7DA 1Z6UA 1WUGA 4ZC9A 2ECGA 4NRAA 5ENHA 2RS9B 4QR5A 2CKLA 1F68A 4O74A 4QC1A 2ECIA 5DKAA 3SHBA 4QUUA 5CQ4A 2ECVA 2HYED 3P1EA 3S92A 4MSXA 1HYJA 4A9NA 2ECTA 4J1PA 2FSAA 4IC2A 5A5QA 5DINA 3ASLA 1LDJB 2E61A 3GV4A 3GG3A 4BW1A 4L7XA 4Z6HA 4X3GA 4I7CA 4UIWA 2L5UA 5A5RA 5LKZA 4E96A 2MKEA 3L1ZB 4OGEA 5A81A 2VJFB 2VNFA 4QSTA 1FP0A 3ZYUA 5HCLA 3O7AA 5EPBA 3VKHA 2YSJA 2LXHC 3I3JA 5F60A 2XP0A 1G25A 3D7CA 5A5SA 3L11A 3LQIA 4YYGA 3U5PA 4A9LA 5FERA 3MULA 4YYDA 4F3IA 5AMEA 5CS8A 2L5EA 4QBMA 4NR6A
chains in the Genus database with same CATH topology
3UVXA 4A9HA 3UVYA 3VK6A 5DLZA 5I40A 4DONA 5D0CA 5K29A 5TBNA 4LRGA 3RPGB 3JVLA 5E3DA 5FG4A 2M85A 4XYAA 4NS5A 4O72A 2LN0A 5J0DA 4V3LC 4FK5A 3ZPVE 5G4RA 4O70A 5CQTA 3SOXA 4O7BA 3EB6A 5E0RA 4MEPA 4N4IA 4GPJA 4Z6IA 5AITA 2YT5A 3M63A 5DLXA 5E9KA 3EB5A 5F1HA 4ZDTA 3NXBA 5DY7A 3IHPA 5D1LB 1Z2QA 2L84A 5EV9A 2MNYA 4R2YA 3HCSA 2YQLA 4UYFB 4KV1A 4QSVA 3AQAA 1E4UA 2YEKA 3HMEA 5E9VA 5I89A 4IC3A 5IGMA 5ENIA 2LGVA 1MM3A 4A9JA 5F5ZA 1DVPA 4NR4A 5E73A 5KTUA 5LKXA 4QB3A 2ECJA 5G4SA 4IOQA 1WIMA 4HXPA 1N87A 5FB0A 5D7XA 5CUEA 5ACYA 5F61A 4OGIA 5FFYA 3O36A 2RI7A 5CUDA 4A9KA 2HDPA 5FG6A 4O7FA 2QJ0A 1EQFA 2G4AA 3KV6A 4Q6FA 2RNYA 1WFKA 2ZETC 2CSZA 4NRCA 5D3SA 4AKNA 2KFTA 5D3PA 4LKAA 2VP7A 5II2A 5B75A 4LJNA 4CFKA 2LRIC 2MNZA 5FFVA 4MENA 3HCUA 3N9QA 4YY6A 2JMDA 5DFDA 1Z60A 5C4QA 5EWCA 3C6WA 4Z1SA 5D25A 5AMFA 2M3HA 3HCTA 2M1RA 2MIQA 1WEVA 2YQDA 5AD3A 1X4JA 3IU5A 5EU1A 1WEEA 2EGPA 5LJ1A 4UP5A 3UW9A 2LDRA 5C13A 2WP1A 5CUGA 5ENEA 4YADA 5BT4A 4IR6A 2KR4A 5F62A 5IG6A 5LJ0A 4UIZA 5HELA 5H1UA 4BHWA 2RO1A 2MA6A 2KE1A 4HXMA 2F42A 5CRZA 5I7YA 5EWVA 3M99A 1ZBDB 3QZVA 4NYXA 4J0RA 4IR4A 4NYWA 4CLBA 4TT4A 1VFYA 5D3HA 5BT5A 2G43A 5FE1A 4QZSA 4XUAA 2VPBA 2CT2A 5HEMA 1LDKC 4CUQA 2L43A 4NUDA 3JVMA 4GNEA 4UYFA 5FE0A 5BT3A 5DKHA 5EWHA 4YY4A 2H0DB 2E3KA 5CQ7A 3RTRB 3DAIA 2LGKA 4F52B 2PNXA 4XUBA 4UI9B 1ZS5A 2E7NA 4ZW1A 5C7NA 4QSPA 4KCXA 5HENA 3N9NA 4HBYA 5CU8A 5HQ6A 4MEQA 5F63A 5C8GA 4PCIA 5L99A 5D26A 4ZQLA 2C2VS 4A9FA 5EI4A 4CUSA 5FE3A 5FBXA 4LYSA 2VJEA 4TU6A 1IYMA 5IGNA 1WEWA 4IOOA 4TT6A 2OSSA 5B77A 1HYIA 4YYNA 5CQ8A 5HRVA 5I7XA 1WEOA 5L96A 4TZ8A 2Y1MA 4QR4A 5C11A 4YYHA 5C89A 1FBVA 2KREA 2KTBB 2WP2A 5DYXA 2D82A 5EICA 5CGPA 4UIUA 5EYAF 4CA1A 1E6IA 2OUOA 5E9LA 4BJXA 5B79A 5L8UA 4AYCA 4BW3A 4LR6A 4NRBA 2YEMA 4O76A 2YSMA 2E6RA 5TCMA 5ETDA 2VJFA 3U5JA 2MT5A 4OGJA 4TKPB 3RCWA 5B76A 4QSUA 5E9IA 4YBSA 4YYIA 4L58A 3G0JA 5J3XA 1JM7B 1JM7A 1X0JA 4NN2A 3Q2EA 5DYUA 5D3LA 2I8NA 1X4UA 5CQ6A 4TZ2A 1T1HA 4FO9A 5A82A 4ZUXU 4FLPA 4QR3A 5FH8A 4O77A 4IORA 2YYRA 4HXSA 5C87A 5I83A 5JWMA 2KGIA 4CUPA 2QICA 3T7LA 1XWHA 2VPDA 2LXPC 4TQNA 4XY9A 4CUTA 2L80A 3LQJA 3MHHA 4WHUA 2KWJA 3O35A 4NR9A 3P1DA 4R7EA 1BORA 5FFWA 3V43A 4GNFA 4NXJA 3SVFA 3FL2A 3LRQA 4QYLA 4FJCA 5EM3A 5HQ7A 5CFWA 5FE5A 2KWKA 5LKUA 4Y03A 5HRXA 4TS8A 4CFLA 3ZPV1 1WILA 3DWYA 5D3NA 3UV4A 4YBMA 2KU3A 1WEQA 4LYWA 2LGGA 2YDWA 4MR4A 4LK9A 5G05B 2OO1A 5KH7A 4TYLA 5A85A 4PS5A 1WEPA 4B7YC 5F25A 2C2LA 4R8PK 3MB4A 5F3AA 3HMHA 4LZSA 4QNSA 5LKTA 5TDWA 2UZGA 4AUQB 4LC2A 5HM0A 3MUKA 2G45A 2L0BA 4J0SA 4YH4A 5LVRA 4PPEA 3U5NA 2YHNA 4XI1A 4S3OB 3RPGC 4W4UA 4I7BA 4QY4A 3U5OA 5D3TA 5A83A 5LVQA 4QC3A 3KV5A 3LJWA 4AVXA 2YURA 4UYHA 4UIVA 5EQ1A 5HJCA 4QSXA 3MHSA 4C67A 3JVJA 5EWWA 2EODA 5TRBA 5ENBA 4PKLA 5FE4A 4UIYA 3U5LA 2L85A 5A7CA 4MVTA 2KIZA 5FE9A 4N3WA 5CTLA 1X4IA 4MR6A 4WA6A 4A9IA 4BBQA 3AADA 5LUUA 5F1LA 4N4FA 3UVDA 2K17A 2YELA 2NXBA 4GB0A 5B8DA 4LADB 2DVRA 2XEUA 4PY6A 5CUBA 3MQMA 4MEOA 4O7EA 5DW1A 3SVHA 4YYMA 4WIVA 3N9MA 5TABA 5EPSA 3ZTGA 3U5MA 2PUYA 4WHWA 4TU4A 5DX4A 3PURA 5COIA 5G0FA 4TT2A 5FH6A 2DVQA 5D1KB 5KHMA 4AYCB 2KWNA 3PHDA 3IU6A 3I2DA 5E9MA 5DBMA 5I86A 4YATA 4YABA 5KTXA 2ECWA 2I7KA 5EA1A 2LGLA 4A9MA 2BAYA 2KYUA 4O7AA 2EA6A 3MB3A 5D1MB 4MR3A 5ENJA 4S3OC 5CPEA 5ENFA 3PUQA 3JVKA 1JSPB 3N9PA 4Q0NA 4HXRA 5A5PA 4N4GA 5CQAA 4O78A 4YYJA 5L8TA 4QEVA 4Z1QA 2NAAA 3HMFA 4NUCA 4GNDA 4PTBA 2YW8A 5CQ5A 2KGGA 2YREA 5DW2A 5FDZA 4WZ2A 3GL6A 5LCWB 4NUEA 5H1VA 4V3KC 3ZVZB 4NR7A 2H0DA 4A4BA 5CP5A 4P5OB 2G6QA 4QSSA 3DPLR 4N4HA 5TDRA 4A9OA 3O70A 2RNXA 5ETBA 2I50A 4HXNA 2L75A 1WE9A 2FUUA 3KNVA 3N9LA 1VYXA 4FIPA 3ZYQA 5F2PA 3Q2FA 5D3JA 4IR5A 5EWDA 3FKMX 4QSQA 5AIUA 2DVVA 3ZNIA 3P1CA 5AD2A 5FG5A 5KU3A 4C9ZA 1N72A 3QZTA 2KWOA 2ECNA 4GNGA 4ALHA 1CHCA 5EGUA 5KTWA 5KH3A 1WENA 4Z93A 2LQ6A 5HFQA 5IBNA 4QEWA 4UYDA 1WUMA 3P5OA 2R0VA 1WESA 2IDAA 2JRJA 5H1TA 2D9EA 4HBWA 5FH7A 4UITA 2YHOA 5H9MA 2YU4A 4BW4A 4A0CD 5CUCA 2JMJA 5JI8A 2YQMA 2RFJA 2RSDA 2DX8A 3SOWA 3TLPA 2YUCA 1JOCA 3LQHA 4TTEA 4NR8A 4NYVA 1U6GB 2MUMA 5JG6A 3N9OA 3UV2A 5I1QA 2OXQC 2M6MA 3O37A 2F6NA 5CUAA 5B78A 4WZ3B 2R10A 4UIXA 5CRMA 5E7DA 5FE6A 5CZGA 5HLSA 5TB6A 1V87A 5F36A 4X2IA 1WGMA 4J3IA 2R0SA 4A49A 2CKLB 5II1A 2LV9A 4YBTA 4QSWA 5A5OA 4QF3A 5FE7A 4CCGX 4NQMA 4WZ0A 2K4DA 2N9GA 4B86C 3MXFA 4QYDA 5I29A 5IGLA 1RMDA 2K16A 5FEYA 2DKWA 5KH9A 4A4CA 5FB1A 2MD7B 4LYIA 4O71A 3P1FA 5L98A 5HRWA 5I3LA 5E74A 4UYEA 5DYCA 5G04B 3LXJA 4YH3A 5DFCA 5EISA 5FE2A 2YW5A 4YYKA 5C85A 3U5KA 2DVSA 4HBXA 4PCEA 4XY8A 4HXKA 3ZVYA 2F6JA 4QSRA 4HXLA 5D3RA 5EPRA 4AP4A 2RNWA 2MA5A 5DFBA 2MJVB 3M62A 5A5NA 3T6RA 3SVGA 4YC9A 5L97A 4UYGA 4UP0A 5EP7A 2VJEB 3O34A 4KV4A 3C5KA 2YYNA 3QZSA 1K2FA 4ALGA 2DWWA 1VD4A 4O75A 2VPGA 2Y43A 5I80A 2XB1A 5ENGA 2DATA 3ONIA 4YK0A 4NR5A 2QIZA 5EK9A 2AN6A 2K1JA 3NG2A 2D8SA 4CURA 4MR5A 4C66A 3O33A 4Q0OA 5HQ5A 5ENCA 1WEUA 5DKCA 4LZRA 2R0YA 4LZ2A 2VPEA 3K2JA 5DYAA 2E7OA 1JM4B 2FUIA 3UV5A 3G0LA 4QF2A 3UVWA 5FE8A 4CL9A 5CY9A 3DQVR 4O64A 4BW2A 5E9YA 2MD8C 5H85A 5E3GA 5D24A 4CUUA 5EVAA 1WEMA 4LDFA 4RVRA 4HBVA 1MM2A 4LLBA 3KQIA 1F62A 4IR3A 5IGKA 2GRCA 4HXOA 5HFRA 2H60A 5LJ2A 3S91A 4O7CA 4YAXA 2JMIA 4QEUA 5DKDA 5I88A 2CSYA 5IIDA 2E6SA 2Y1NA 4A9EA 4OUFA 5CQ3A 4NQNA 3L1XA 2LSPB 3HTKC 5KO4A 4QUTA 4I7DA 1Z6UA 1WUGA 4ZC9A 2ECGA 4NRAA 5ENHA 2RS9B 4QR5A 2CKLA 1F68A 4O74A 4QC1A 2ECIA 5DKAA 3SHBA 4QUUA 5CQ4A 2ECVA 2HYED 3P1EA 3S92A 4MSXA 1HYJA 4A9NA 2ECTA 4J1PA 2FSAA 4IC2A 5A5QA 5DINA 3ASLA 1LDJB 3GV4A 3GG3A 4BW1A 4L7XA 4Z6HA 4X3GA 4I7CA 4UIWA 2L5UA 5A5RA 5LKZA 4E96A 3L1ZB 3SOUA 5A81A 2VJFB 2VNFA 4QSTA 1FP0A 3ZYUA 5HCLA 3O7AA 5EPBA 2YSJA 2LXHC 3I3JA 5F60A 1G25A 3D7CA 5A5SA 3L11A 3LQIA 4YYGA 3U5PA 4A9LA 5FERA 3MULA 4YYDA 4F3IA 5AMEA 5CS8A 2L5EA 4QBMA 4NR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVX A;  4A9H A;  3UVY A;  3VK6 A;  5DLZ A;  5I40 A;  4DON A;  5D0C A;  5K29 A;  5TBN A;  4LRG A;  3RPG B;  3JVL A;  5E3D A;  5FG4 A;  2M85 A;  4XYA A;  4NS5 A;  4O72 A;  2LN0 A;  5J0D A;  4V3L C;  4FK5 A;  3ZPV E;  5G4R A;  4O70 A;  5CQT A;  3SOX A;  4O7B A;  3EB6 A;  5E0R A;  4MEP A;  4N4I A;  4GPJ A;  4Z6I A;  5AIT A;  2YT5 A;  3M63 A;  5DLX A;  5E9K A;  3EB5 A;  5F1H A;  4ZDT A;  3NXB A;  5DY7 A;  3IHP A;  5D1L B;  1Z2Q A;  2L84 A;  5EV9 A;  2MNY A;  4R2Y A;  3HCS A;  2YQL A;  4UYF B;  4KV1 A;  4QSV A;  3AQA A;  1E4U A;  2YEK A;  3HME A;  5E9V A;  5I89 A;  4IC3 A;  5IGM A;  5ENI A;  2LGV A;  1MM3 A;  4A9J A;  5F5Z A;  1DVP A;  4NR4 A;  5E73 A;  5KTU A;  5LKX A;  4QB3 A;  2ECJ A;  5G4S A;  4IOQ A;  1WIM A;  4HXP A;  1N87 A;  5FB0 A;  5D7X A;  5CUE A;  5ACY A;  5F61 A;  4OGI A;  5FFY A;  3O36 A;  2RI7 A;  5CUD A;  4A9K A;  2HDP A;  5FG6 A;  4O7F A;  2QJ0 A;  1EQF A;  2G4A A;  3KV6 A;  4Q6F A;  2RNY A;  1WFK A;  2ZET C;  2CSZ A;  4NRC A;  5D3S A;  4AKN A;  2KFT A;  5D3P A;  4LKA A;  2VP7 A;  5II2 A;  5B75 A;  4LJN A;  4CFK A;  2LRI C;  2MNZ A;  5FFV A;  4MEN A;  3HCU A;  3N9Q A;  4YY6 A;  2JMD A;  5DFD A;  1Z60 A;  5C4Q A;  5EWC A;  3C6W A;  4Z1S A;  5D25 A;  5AMF A;  2M3H A;  3HCT A;  2M1R A;  2MIQ A;  1WEV A;  2YQD A;  5AD3 A;  1X4J A;  3IU5 A;  5EU1 A;  1WEE A;  2EGP A;  5LJ1 A;  4UP5 A;  3UW9 A;  2LDR A;  5C13 A;  2WP1 A;  5CUG A;  5ENE A;  4YAD A;  5BT4 A;  4IR6 A;  2KR4 A;  5F62 A;  5IG6 A;  5LJ0 A;  4UIZ A;  5HEL A;  5H1U A;  4BHW A;  2RO1 A;  2MA6 A;  2KE1 A;  4HXM A;  2F42 A;  5CRZ A;  5I7Y A;  5EWV A;  3M99 A;  1ZBD B;  3QZV A;  4NYX A;  4J0R A;  4IR4 A;  4NYW A;  4CLB A;  4TT4 A;  1VFY A;  5D3H A;  5BT5 A;  2G43 A;  5FE1 A;  4QZS A;  4XUA A;  2VPB A;  2CT2 A;  5HEM A;  1LDK C;  4CUQ A;  2L43 A;  4NUD A;  3JVM A;  4GNE A;  4UYF A;  5FE0 A;  5BT3 A;  5DKH A;  5EWH A;  4YY4 A;  2H0D B;  2E3K A;  5CQ7 A;  3RTR B;  3DAI A;  2LGK A;  4F52 B;  2PNX A;  4XUB A;  4UI9 B;  1ZS5 A;  2E7N A;  4ZW1 A;  5C7N A;  4QSP A;  4KCX A;  5HEN A;  3N9N A;  4HBY A;  5CU8 A;  5HQ6 A;  4MEQ A;  5F63 A;  5C8G A;  4PCI A;  5L99 A;  5D26 A;  4ZQL A;  2C2V S;  4A9F A;  5EI4 A;  4CUS A;  5FE3 A;  5FBX A;  4LYS A;  2VJE A;  4TU6 A;  1IYM A;  5IGN A;  1WEW A;  4IOO A;  4TT6 A;  2OSS A;  5B77 A;  1HYI A;  4YYN A;  5CQ8 A;  5HRV A;  5I7X A;  1WEO A;  5L96 A;  4TZ8 A;  2Y1M A;  4QR4 A;  5C11 A;  4YYH A;  5C89 A;  1FBV A;  2KRE A;  2KTB B;  2WP2 A;  5DYX A;  2D82 A;  5EIC A;  5CGP A;  4UIU A;  5EYA F;  4CA1 A;  1E6I A;  2OUO A;  5E9L A;  4BJX A;  5B79 A;  5L8U A;  4AYC A;  4BW3 A;  4LR6 A;  4NRB A;  2YEM A;  4O76 A;  2YSM A;  2E6R A;  5TCM A;  5ETD A;  2VJF A;  3U5J A;  2MT5 A;  4OGJ A;  4TKP B;  3RCW A;  5B76 A;  4QSU A;  5E9I A;  4YBS A;  4YYI A;  4L58 A;  3G0J A;  5J3X A;  1JM7 B;  1JM7 A;  1X0J A;  4NN2 A;  3Q2E A;  5DYU A;  5D3L A;  2I8N A;  1X4U A;  5CQ6 A;  4TZ2 A;  1T1H A;  4FO9 A;  5A82 A;  4ZUX U;  4FLP A;  4QR3 A;  5FH8 A;  4O77 A;  4IOR A;  2YYR A;  4HXS A;  5C87 A;  5I83 A;  5JWM A;  2KGI A;  4CUP A;  2QIC A;  3T7L A;  1XWH A;  2VPD A;  2LXP C;  4TQN A;  4XY9 A;  4CUT A;  2L80 A;  3LQJ A;  3MHH A;  4WHU A;  2KWJ A;  3O35 A;  4NR9 A;  3P1D A;  4R7E A;  1BOR A;  5FFW A;  3V43 A;  4GNF A;  4NXJ A;  3SVF A;  3FL2 A;  3LRQ A;  4QYL A;  4FJC A;  5EM3 A;  5HQ7 A;  5CFW A;  5FE5 A;  2KWK A;  5LKU A;  4Y03 A;  5HRX A;  4TS8 A;  4CFL A;  3ZPV 1;  1WIL A;  3DWY A;  5D3N A;  3UV4 A;  4YBM A;  2KU3 A;  1WEQ A;  4LYW A;  2LGG A;  2YDW A;  4MR4 A;  4LK9 A;  5G05 B;  2OO1 A;  5KH7 A;  4TYL A;  5A85 A;  4PS5 A;  1WEP A;  4B7Y C;  5F25 A;  2C2L A;  4R8P K;  3MB4 A;  5F3A A;  3HMH A;  4LZS A;  4QNS A;  5LKT A;  5TDW A;  2UZG A;  4AUQ B;  4LC2 A;  5HM0 A;  3MUK A;  2G45 A;  2L0B A;  4J0S A;  4YH4 A;  5LVR A;  4PPE A;  3U5N A;  2YHN A;  4XI1 A;  4S3O B;  3RPG C;  4W4U A;  4I7B A;  4QY4 A;  3U5O A;  5D3T A;  5A83 A;  5LVQ A;  4QC3 A;  3KV5 A;  3LJW A;  4AVX A;  2YUR A;  4UYH A;  4UIV A;  5EQ1 A;  5HJC A;  4QSX A;  3MHS A;  4C67 A;  3JVJ A;  5EWW A;  2EOD A;  5TRB A;  5ENB A;  4PKL A;  5FE4 A;  4UIY A;  3U5L A;  2L85 A;  5A7C A;  4MVT A;  2KIZ A;  5FE9 A;  4N3W A;  5CTL A;  1X4I A;  4MR6 A;  4WA6 A;  4A9I A;  4BBQ A;  3AAD A;  5LUU A;  5F1L A;  4N4F A;  3UVD A;  2K17 A;  2YEL A;  2NXB A;  4GB0 A;  5B8D A;  4LAD B;  2DVR A;  2XEU A;  4PY6 A;  5CUB A;  3MQM A;  4MEO A;  4O7E A;  5DW1 A;  3SVH A;  4YYM A;  4WIV A;  3N9M A;  5TAB A;  5EPS A;  3ZTG A;  3U5M A;  2PUY A;  4WHW A;  4TU4 A;  5DX4 A;  3PUR A;  5COI A;  5G0F A;  4TT2 A;  5FH6 A;  2DVQ A;  5D1K B;  5KHM A;  4AYC B;  2KWN A;  3PHD A;  3IU6 A;  3I2D A;  5E9M A;  5DBM A;  5I86 A;  4YAT A;  4YAB A;  5KTX A;  2ECW A;  2I7K A;  5EA1 A;  2LGL A;  4A9M A;  2BAY A;  2KYU A;  4O7A A;  2EA6 A;  3MB3 A;  5D1M B;  4MR3 A;  5ENJ A;  4S3O C;  5CPE A;  5ENF A;  3PUQ A;  3JVK A;  1JSP B;  3N9P A;  4Q0N A;  4HXR A;  5A5P A;  4N4G A;  5CQA A;  4O78 A;  4YYJ A;  5L8T A;  4QEV A;  4Z1Q A;  2NAA A;  3HMF A;  4NUC A;  4GND A;  4PTB A;  2YW8 A;  5CQ5 A;  2KGG A;  2YRE A;  5DW2 A;  5FDZ A;  4WZ2 A;  3GL6 A;  5LCW B;  4NUE A;  5H1V A;  4V3K C;  3ZVZ B;  4NR7 A;  2H0D A;  4A4B A;  5CP5 A;  4P5O B;  2G6Q A;  4QSS A;  3DPL R;  4N4H A;  5TDR A;  4A9O A;  3O70 A;  2RNX A;  5ETB A;  2I50 A;  4HXN A;  2L75 A;  1WE9 A;  2FUU A;  3KNV A;  3N9L A;  1VYX A;  4FIP A;  3ZYQ A;  5F2P A;  3Q2F A;  5D3J A;  4IR5 A;  5EWD A;  3FKM X;  4QSQ A;  5AIU A;  2DVV A;  3ZNI A;  3P1C A;  5AD2 A;  5FG5 A;  5KU3 A;  4C9Z A;  1N72 A;  3QZT A;  2KWO A;  2ECN A;  4GNG A;  4ALH A;  1CHC A;  5EGU A;  5KTW A;  5KH3 A;  1WEN A;  4Z93 A;  2LQ6 A;  5HFQ A;  5IBN A;  4QEW A;  4UYD A;  1WUM A;  3P5O A;  2R0V A;  1WES A;  2IDA A;  2JRJ A;  5H1T A;  2D9E A;  4HBW A;  5FH7 A;  4UIT A;  2YHO A;  5H9M A;  2YU4 A;  4BW4 A;  4A0C D;  5CUC A;  2JMJ A;  5JI8 A;  2YQM A;  2RFJ A;  2RSD A;  2DX8 A;  3SOW A;  3TLP A;  2YUC A;  1JOC A;  3LQH A;  4TTE A;  4NR8 A;  4NYV A;  1U6G B;  2MUM A;  5JG6 A;  3N9O A;  3UV2 A;  5I1Q A;  2OXQ C;  2M6M A;  3O37 A;  2F6N A;  5CUA A;  5B78 A;  4WZ3 B;  2R10 A;  4UIX A;  5CRM A;  5E7D A;  5FE6 A;  5CZG A;  5HLS A;  5TB6 A;  1V87 A;  5F36 A;  4X2I A;  1WGM A;  4J3I A;  2R0S A;  4A49 A;  2CKL B;  5II1 A;  2LV9 A;  4YBT A;  4QSW A;  5A5O A;  4QF3 A;  5FE7 A;  4CCG X;  4NQM A;  4WZ0 A;  2K4D A;  2N9G A;  4B86 C;  3MXF A;  4QYD A;  5I29 A;  5IGL A;  1RMD A;  2K16 A;  5FEY A;  2DKW A;  5KH9 A;  4A4C A;  5FB1 A;  2MD7 B;  4LYI A;  4O71 A;  3P1F A;  5L98 A;  5HRW A;  5I3L A;  5E74 A;  4UYE A;  5DYC A;  5G04 B;  3LXJ A;  4YH3 A;  5DFC A;  5EIS A;  5FE2 A;  2YW5 A;  4YYK A;  5C85 A;  3U5K A;  2DVS A;  4HBX A;  4PCE A;  4XY8 A;  4HXK A;  3ZVY A;  2F6J A;  4QSR A;  4HXL A;  5D3R A;  5EPR A;  4AP4 A;  2RNW A;  2MA5 A;  5DFB A;  2MJV B;  3M62 A;  5A5N A;  3T6R A;  3SVG A;  4YC9 A;  5L97 A;  4UYG A;  4UP0 A;  5EP7 A;  2VJE B;  3O34 A;  4KV4 A;  3C5K A;  2YYN A;  3QZS A;  1K2F A;  4ALG A;  2DWW A;  1VD4 A;  4O75 A;  2VPG A;  2Y43 A;  5I80 A;  2XB1 A;  5ENG A;  2DAT A;  3ONI A;  4YK0 A;  4NR5 A;  2QIZ A;  5EK9 A;  2AN6 A;  2K1J A;  3NG2 A;  2D8S A;  4CUR A;  4MR5 A;  4C66 A;  3O33 A;  4Q0O A;  5HQ5 A;  5ENC A;  1WEU A;  5DKC A;  4LZR A;  2R0Y A;  4LZ2 A;  2VPE A;  3K2J A;  5DYA A;  2E7O A;  1JM4 B;  2FUI A;  3UV5 A;  3G0L A;  4QF2 A;  3UVW A;  5FE8 A;  4CL9 A;  5CY9 A;  3DQV R;  4O64 A;  4BW2 A;  5E9Y A;  2MD8 C;  5H85 A;  5E3G A;  5D24 A;  4CUU A;  5EVA A;  1WEM A;  4LDF A;  4RVR A;  4HBV A;  1MM2 A;  4LLB A;  3KQI A;  1F62 A;  4IR3 A;  5IGK A;  2GRC A;  4HXO A;  5HFR A;  2H60 A;  5LJ2 A;  3S91 A;  4O7C A;  4YAX A;  2JMI A;  4QEU A;  5DKD A;  5I88 A;  2CSY A;  5IID A;  2E6S A;  2Y1N A;  4A9E A;  4OUF A;  5CQ3 A;  4NQN A;  3L1X A;  2LSP B;  3HTK C;  5KO4 A;  4QUT A;  4I7D A;  1Z6U A;  1WUG A;  4ZC9 A;  2ECG A;  4NRA A;  5ENH A;  2RS9 B;  4QR5 A;  2CKL A;  1F68 A;  4O74 A;  4QC1 A;  2ECI A;  5DKA A;  3SHB A;  4QUU A;  5CQ4 A;  2ECV A;  2HYE D;  3P1E A;  3S92 A;  4MSX A;  1HYJ A;  4A9N A;  2ECT A;  4J1P A;  2FSA A;  4IC2 A;  5A5Q A;  5DIN A;  3ASL A;  1LDJ B;  3GV4 A;  3GG3 A;  4BW1 A;  4L7X A;  4Z6H A;  4X3G A;  4I7C A;  4UIW A;  2L5U A;  5A5R A;  5LKZ A;  4E96 A;  3L1Z B;  3SOU A;  5A81 A;  2VJF B;  2VNF A;  4QST A;  1FP0 A;  3ZYU A;  5HCL A;  3O7A A;  5EPB A;  2YSJ A;  2LXH C;  3I3J A;  5F60 A;  1G25 A;  3D7C A;  5A5S A;  3L11 A;  3LQI A;  4YYG A;  3U5P A;  4A9L A;  5FER A;  3MUL A;  4YYD A;  4F3I A;  5AME A;  5CS8 A;  2L5E A;  4QBM A;  4NR6 A; 
#chains in the Genus database with same CATH topology
 3UVX A;  4A9H A;  3UVY A;  3VK6 A;  5DLZ A;  5I40 A;  4DON A;  2P57 A;  5D0C A;  5K29 A;  5TBN A;  4LRG A;  3RPG B;  3JVL A;  5E3D A;  5FG4 A;  2M85 A;  4XYA A;  4NS5 A;  4O72 A;  2LN0 A;  5J0D A;  4V3L C;  4FK5 A;  3ZPV E;  5G4R A;  4O70 A;  5CQT A;  3SOX A;  4O7B A;  3EB6 A;  5E0R A;  4MEP A;  4N4I A;  4GPJ A;  4Z6I A;  5AIT A;  2YT5 A;  3M63 A;  5DLX A;  5E9K A;  3EB5 A;  5F1H A;  4ZDT A;  3NXB A;  5DY7 A;  3IHP A;  5D1L B;  1Z2Q A;  2L84 A;  5EV9 A;  2IQJ A;  2MNY A;  3HCS A;  2YQL A;  4UYF B;  4R2Y A;  4KV1 A;  5SVI A;  4QSV A;  3AQA A;  1E4U A;  2YEK A;  3HME A;  5E9V A;  5I89 A;  4IC3 A;  5IGM A;  5ENI A;  2XOZ A;  2LGV A;  1MM3 A;  4A9J A;  5F5Z A;  1DVP A;  4NR4 A;  5E73 A;  5KTU A;  5LKX A;  4QB3 A;  2ECJ A;  5G4S A;  4IOQ A;  2M13 A;  1WIM A;  4HXP A;  1N87 A;  5FB0 A;  5D7X A;  5CUE A;  5ACY A;  5F61 A;  4OGI A;  5FFY A;  3O36 A;  2RI7 A;  5CUD A;  4A9K A;  4F1P A;  2HDP A;  5FG6 A;  4O7F A;  2QJ0 A;  1EQF A;  2G4A A;  3KV6 A;  4Q6F A;  2RNY A;  1WFK A;  2ZET C;  2CSZ A;  3LVR E;  4NRC A;  5D3S A;  4AKN A;  2KFT A;  5D3P A;  2LAU A;  4LKA A;  2VP7 A;  5II2 A;  5B75 A;  4LJN A;  4CFK A;  2LRI C;  2FD4 A;  2MNZ A;  5FFV A;  4MEN A;  3HCU A;  3N9Q A;  4YY6 A;  2JMD A;  5DFD A;  1Z60 A;  4AKH A;  5C4Q A;  5EWC A;  3C6W A;  4Z1S A;  5D25 A;  5AMF A;  2M3H A;  3HCT A;  2M1R A;  2MIQ A;  1WEV A;  2YQD A;  5AD3 A;  1X4J A;  4Z0O A;  3IU5 A;  5EU1 A;  1WEE A;  2EGP A;  5LJ1 A;  4UP5 A;  3UW9 A;  2LDR A;  5C13 A;  2WP1 A;  2XOY A;  5CUG A;  5ENE A;  4YAD A;  5BT4 A;  2B0O E;  4IR6 A;  2KR4 A;  5F62 A;  5IG6 A;  5LJ0 A;  4UIZ A;  5HEL A;  5H1U A;  4BHW A;  2RO1 A;  2MA6 A;  2KE1 A;  4HXM A;  2F42 A;  5CRZ A;  5I7Y A;  5EWV A;  3M99 A;  2CON A;  1ZBD B;  3QZV A;  4NYX A;  4J0R A;  4IR4 A;  4NYW A;  4CLB A;  4TT4 A;  1VFY A;  5D3H A;  5BT5 A;  2G43 A;  5FE1 A;  4QZS A;  4XUA A;  2VPB A;  2CT2 A;  5HEM A;  1LDK C;  4CUQ A;  2L43 A;  4NUD A;  3JVM A;  4GNE A;  4UYF A;  5FE0 A;  2CRR A;  5BT3 A;  5DKH A;  5EWH A;  4YY4 A;  2H0D B;  2E3K A;  5CQ7 A;  3RTR B;  3DAI A;  2LGK A;  4F52 B;  2PNX A;  4XUB A;  4UI9 B;  1ZS5 A;  2E7N A;  4ZW1 A;  5C7N A;  3VKG A;  4QSP A;  4KCX A;  5HEN A;  3N9N A;  4HBY A;  5CU8 A;  5HQ6 A;  4MEQ A;  5F63 A;  5C8G A;  4PCI A;  5L99 A;  5D26 A;  4ZQL A;  2C2V S;  4A9F A;  5EI4 A;  4CUS A;  5FE3 A;  5FBX A;  4AKI A;  4LYS A;  2VJE A;  4TU6 A;  1IYM A;  5IGN A;  1WEW A;  4IOO A;  4TT6 A;  2OSS A;  5B77 A;  1HYI A;  4YYN A;  5CQ8 A;  5HRV A;  5I7X A;  1WEO A;  5L96 A;  4TZ8 A;  2Y1M A;  4QR4 A;  5C11 A;  4YYH A;  5C89 A;  1FBV A;  2KRE A;  2KTB B;  2WP2 A;  5DYX A;  2D82 A;  5EIC A;  5CGP A;  3FEH A;  4UIU A;  3Q1D A;  5EYA F;  1E6I A;  2OUO A;  5E9L A;  4BJX A;  4CA1 A;  5L8U A;  5B79 A;  4AYC A;  4BW3 A;  4LR6 A;  4NRB A;  2YEM A;  4O76 A;  2CSV A;  2YSM A;  2E6R A;  5TCM A;  3LDY A;  5ETD A;  2VJF A;  3U5J A;  2MT5 A;  4OGJ A;  4TKP B;  3RCW A;  5B76 A;  4QSU A;  5E9I A;  4YBS A;  4OGC A;  4YYI A;  4L58 A;  3G0J A;  3FAN A;  5J3X A;  1JM7 B;  1JM7 A;  1X0J A;  4NN2 A;  3Q2E A;  3M7K A;  5DYU A;  5D3L A;  2I8N A;  1X4U A;  5CQ6 A;  4TZ2 A;  1T1H A;  4FO9 A;  5A82 A;  4ZUX U;  4FLP A;  5K3Q A;  4QR3 A;  5FH8 A;  4O77 A;  4IOR A;  2YYR A;  4HXS A;  5C87 A;  5I83 A;  5JWM A;  3O47 A;  2KGI A;  4CUP A;  2QIC A;  3T7L A;  1XWH A;  2VPD A;  2DSM A;  2LXP C;  4TQN A;  4XY9 A;  4CUT A;  2L80 A;  3LQJ A;  3LVQ E;  4WHU A;  2KWJ A;  3MHH A;  3O35 A;  2JUN A;  4NR9 A;  3P1D A;  4R7E A;  1BOR A;  5FFW A;  3V43 A;  4GNF A;  4NXJ A;  3SVF A;  3FL2 A;  3FJU B;  3LRQ A;  4QYL A;  4FJC A;  5EM3 A;  3FAO A;  5HQ7 A;  5CFW A;  5FE5 A;  2KWK A;  5LKU A;  4Y03 A;  5HRX A;  4TS8 A;  4CFL A;  3ZPV 1;  1WIL A;  3DWY A;  5D3N A;  3UV4 A;  4YBM A;  2KU3 A;  1WEQ A;  4LYW A;  2LGG A;  2YDW A;  1MBM A;  4MR4 A;  4LK9 A;  5G05 B;  2OO1 A;  5KH7 A;  4TYL A;  5A85 A;  4PS5 A;  1WEP A;  4B7Y C;  5F25 A;  2C2L A;  4R8P K;  3MB4 A;  5F3A A;  3HMH A;  1DCQ A;  4LZS A;  4QNS A;  5LKT A;  3FM8 C;  5TDW A;  4AKG A;  2UZG A;  4AUQ B;  4LC2 A;  5HM0 A;  3MUK A;  2JM3 A;  2G45 A;  2L0B A;  4J0S A;  4YH4 A;  5LVR A;  4PPE A;  3U5N A;  2YHN A;  4XI1 A;  4S3O B;  2EGM A;  3RPG C;  4W4U A;  4I7B A;  4QY4 A;  3U5O A;  5D3T A;  5A83 A;  5LVQ A;  4QC3 A;  3KV5 A;  3LJW A;  4AVX A;  2YUR A;  4UYH A;  4UIV A;  5EQ1 A;  5HJC A;  4QSX A;  2RR4 A;  4C67 A;  3JVJ A;  5EWW A;  2EOD A;  3MHS A;  5TRB A;  5ENB A;  4PKL A;  5FE4 A;  4UIY A;  3U5L A;  2L85 A;  5A7C A;  4MVT A;  2KIZ A;  5FE9 A;  4N3W A;  5CTL A;  1X4I A;  4MR6 A;  4WA6 A;  4A9I A;  4BBQ A;  3AAD A;  5LUU A;  5F1L A;  4N4F A;  3UVD A;  2K17 A;  2YEL A;  2NXB A;  4GB0 A;  5B8D A;  4LAD B;  2DVR A;  2XEU A;  4PY6 A;  5CUB A;  3MQM A;  4MEO A;  4O7E A;  5DW1 A;  3SVH A;  2KKY A;  4YYM A;  3E2D A;  4WIV A;  3N9M A;  5TAB A;  5EPS A;  3ZTG A;  3U5M A;  2PUY A;  4WHW A;  4TU4 A;  5DX4 A;  3PUR A;  5COI A;  5G0F A;  4TT2 A;  5FH6 A;  2DVQ A;  5D1K B;  5KHM A;  4AYC B;  2KWN A;  3H7H A;  3PHD A;  3IU6 A;  3I2D A;  5E9M A;  5DBM A;  5I86 A;  4YAT A;  4YAB A;  5KTX A;  2ECW A;  2I7K A;  5EA1 A;  2LGL A;  5SVX A;  4A9M A;  2BAY A;  2KYU A;  4O7A A;  2EA6 A;  3MB3 A;  5D1M B;  4MR3 A;  5SVI B;  5ENJ A;  4S3O C;  5CPE A;  5ENF A;  3PUQ A;  3JVK A;  1JSP B;  3N9P A;  4Q0N A;  4HXR A;  5A5P A;  4N4G A;  5CQA A;  4O78 A;  4YYJ A;  5L8T A;  3D1B A;  4QEV A;  4Z1Q A;  2EXU A;  2NAA A;  3HMF A;  4NUC A;  4GND A;  4PTB A;  2YW8 A;  5CQ5 A;  2KGG A;  2YRE A;  5DW2 A;  5FDZ A;  4WZ2 A;  3GL6 A;  5LCW B;  4NUE A;  5H1V A;  4V3K C;  3ZVZ B;  4NR7 A;  2H0D A;  4H9D A;  4A4B A;  5CP5 A;  4P5O B;  2G6Q A;  4QSS A;  3DPL R;  4N4H A;  5TDR A;  4A9O A;  3O70 A;  2RNX A;  5ETB A;  2I50 A;  4HXN A;  2L75 A;  1WE9 A;  2FUU A;  3KNV A;  3N9L A;  1VYX A;  4Z0R A;  4FIP A;  3ZYQ A;  5F2P A;  3Q2F A;  5D3J A;  4IR5 A;  5EWD A;  3FKM X;  4QSQ A;  5AIU A;  2DVV A;  3ZNI A;  2OWA A;  3P1C A;  2D8U A;  5AD2 A;  5FG5 A;  5KU3 A;  4C9Z A;  1N72 A;  2L7P A;  2KKX A;  3QZT A;  2KWO A;  2CRW A;  2ECN A;  4GNG A;  4ALH A;  1CHC A;  5EGU A;  5KTW A;  5KH3 A;  1WEN A;  4Z93 A;  2LQ6 A;  5HFQ A;  5IBN A;  4QEW A;  4UYD A;  3MDB C;  1WUM A;  3P5O A;  2R0V A;  1WES A;  2IDA A;  2JRJ A;  5H1T A;  2D9E A;  4HBW A;  5FH7 A;  4UIT A;  2YHO A;  5H9M A;  2YU4 A;  4BW4 A;  4A0C D;  5CUC A;  2JMJ A;  5JI8 A;  4QQ4 A;  2YQM A;  2RFJ A;  2RSD A;  3T9K A;  2DX8 A;  3SOW A;  3TLP A;  2YUC A;  1JOC A;  3LQH A;  4TTE A;  4NR8 A;  4NYV A;  1U6G B;  2MUM A;  5JG6 A;  3N9O A;  3UV2 A;  5I1Q A;  2OXQ C;  2M6M A;  3O37 A;  2F6N A;  5CUA A;  5B78 A;  4WZ3 B;  2R10 A;  4UIX A;  5CRM A;  5E7D A;  5FE6 A;  5CZG A;  5HLS A;  5TB6 A;  1V87 A;  5F36 A;  4X2I A;  1WGM A;  4J3I A;  2R0S A;  3DWD A;  4A49 A;  2CKL B;  5II1 A;  2LV9 A;  4YBT A;  4QSW A;  3SOU A;  5A5O A;  4QF3 A;  5FE7 A;  4CCG X;  4NQM A;  4WZ0 A;  2K4D A;  2N9G A;  4B86 C;  3MXF A;  4QYD A;  5I29 A;  5IGL A;  1ZKR A;  1RMD A;  3DDT A;  2K16 A;  5FEY A;  2DKW A;  2XOC A;  3JUE A;  5KH9 A;  4A4C A;  5FB1 A;  2MD7 B;  2YVR A;  4LYI A;  4O71 A;  3P1F A;  5L98 A;  5HRW A;  3LJU X;  5I3L A;  5E74 A;  2EJN A;  4UYE A;  5DYC A;  5G04 B;  3LXJ A;  4YH3 A;  5DFC A;  5EIS A;  5FE2 A;  5SVY A;  2YW5 A;  4YYK A;  5C85 A;  3U5K A;  2DVS A;  4HBX A;  4PCE A;  4XY8 A;  4HXK A;  3ZVY A;  2F6J A;  4QSR A;  4HXL A;  5D3R A;  5EPR A;  2FFW A;  4AP4 A;  2RNW A;  2MA5 A;  5DFB A;  2MJV B;  3M62 A;  5A5N A;  3T6R A;  3SVG A;  4YC9 A;  5L97 A;  4UYG A;  4UP0 A;  5EP7 A;  2VJE B;  3O34 A;  4KV4 A;  3C5K A;  2YYN A;  3QZS A;  1K2F A;  4ALG A;  2DWW A;  1VD4 A;  4O75 A;  2VPG A;  2Y43 A;  5I80 A;  2XB1 A;  5ENG A;  3ERR A;  2DAT A;  3D1D A;  3ONI A;  4NR5 A;  4YK0 A;  2QIZ A;  5EK9 A;  2AN6 A;  2K1J A;  3NG2 A;  2D8S A;  4CUR A;  4MR5 A;  4C66 A;  3O33 A;  4Q0O A;  5HQ5 A;  5ENC A;  1WEU A;  5DKC A;  4LZR A;  2R0Y A;  4LZ2 A;  2VPE A;  3K2J A;  5DYA A;  2E7O A;  1JM4 B;  2FUI A;  3SUB A;  3UV5 A;  3G0L A;  4QF2 A;  3UVW A;  5FE8 A;  4CL9 A;  5CY9 A;  3DQV R;  4O64 A;  4BW2 A;  4O62 A;  5E9Y A;  2MD8 C;  5H85 A;  5E3G A;  1PUO A;  5D24 A;  3PLW A;  4CUU A;  5EVA A;  1WEM A;  4LDF A;  4RVR A;  4HBV A;  1MM2 A;  4LLB A;  3KQI A;  1F62 A;  4IR3 A;  5IGK A;  2GRC A;  4HXO A;  5HFR A;  2H60 A;  5LJ2 A;  3KDE C;  3S91 A;  4O7C A;  4YAX A;  2JMI A;  4QEU A;  5DKD A;  5I88 A;  2CSY A;  5IID A;  2E6S A;  2DJA A;  2Y1N A;  4A9E A;  4AI6 A;  4OUF A;  5CQ3 A;  4NQN A;  3L1X A;  2LSP B;  3HTK C;  5KO4 A;  4QUT A;  4I7D A;  1Z6U A;  1WUG A;  4ZC9 A;  2ECG A;  4NRA A;  5ENH A;  2RS9 B;  4QR5 A;  2CKL A;  1F68 A;  4O74 A;  4QC1 A;  2ECI A;  5DKA A;  3SHB A;  4QUU A;  5CQ4 A;  2ECV A;  2HYE D;  3P1E A;  3S92 A;  4MSX A;  1HYJ A;  4A9N A;  2ECT A;  4J1P A;  2FSA A;  4IC2 A;  5A5Q A;  5DIN A;  3ASL A;  1LDJ B;  2E61 A;  3GV4 A;  3GG3 A;  4BW1 A;  4L7X A;  4Z6H A;  4X3G A;  4I7C A;  4UIW A;  2L5U A;  5A5R A;  5LKZ A;  4E96 A;  2MKE A;  3L1Z B;  4OGE A;  5A81 A;  2VJF B;  2VNF A;  4QST A;  1FP0 A;  3ZYU A;  5HCL A;  3O7A A;  5EPB A;  3VKH A;  2YSJ A;  2LXH C;  3I3J A;  5F60 A;  2XP0 A;  1G25 A;  3D7C A;  5A5S A;  3L11 A;  3LQI A;  4YYG A;  3U5P A;  4A9L A;  5FER A;  3MUL A;  4YYD A;  4F3I A;  5AME A;  5CS8 A;  2L5E A;  4QBM A;  4NR6 A; 
#chains in the Genus database with same CATH homology
 3UVX A;  4A9H A;  3UVY A;  3VK6 A;  5DLZ A;  5I40 A;  4DON A;  5D0C A;  5K29 A;  5TBN A;  4LRG A;  3RPG B;  3JVL A;  5E3D A;  5FG4 A;  2M85 A;  4XYA A;  4NS5 A;  4O72 A;  2LN0 A;  5J0D A;  4V3L C;  4FK5 A;  3ZPV E;  5G4R A;  4O70 A;  5CQT A;  3SOX A;  4O7B A;  3EB6 A;  5E0R A;  4MEP A;  4N4I A;  4GPJ A;  4Z6I A;  5AIT A;  2YT5 A;  3M63 A;  5DLX A;  5E9K A;  3EB5 A;  5F1H A;  4ZDT A;  3NXB A;  5DY7 A;  3IHP A;  5D1L B;  1Z2Q A;  2L84 A;  5EV9 A;  2MNY A;  4R2Y A;  3HCS A;  2YQL A;  4UYF B;  4KV1 A;  4QSV A;  3AQA A;  1E4U A;  2YEK A;  3HME A;  5E9V A;  5I89 A;  4IC3 A;  5IGM A;  5ENI A;  2LGV A;  1MM3 A;  4A9J A;  5F5Z A;  1DVP A;  4NR4 A;  5E73 A;  5KTU A;  5LKX A;  4QB3 A;  2ECJ A;  5G4S A;  4IOQ A;  1WIM A;  4HXP A;  1N87 A;  5FB0 A;  5D7X A;  5CUE A;  5ACY A;  5F61 A;  4OGI A;  5FFY A;  3O36 A;  2RI7 A;  5CUD A;  4A9K A;  2HDP A;  5FG6 A;  4O7F A;  2QJ0 A;  1EQF A;  2G4A A;  3KV6 A;  4Q6F A;  2RNY A;  1WFK A;  2ZET C;  2CSZ A;  4NRC A;  5D3S A;  4AKN A;  2KFT A;  5D3P A;  4LKA A;  2VP7 A;  5II2 A;  5B75 A;  4LJN A;  4CFK A;  2LRI C;  2MNZ A;  5FFV A;  4MEN A;  3HCU A;  3N9Q A;  4YY6 A;  2JMD A;  5DFD A;  1Z60 A;  5C4Q A;  5EWC A;  3C6W A;  4Z1S A;  5D25 A;  5AMF A;  2M3H A;  3HCT A;  2M1R A;  2MIQ A;  1WEV A;  2YQD A;  5AD3 A;  1X4J A;  3IU5 A;  5EU1 A;  1WEE A;  2EGP A;  5LJ1 A;  4UP5 A;  3UW9 A;  2LDR A;  5C13 A;  2WP1 A;  5CUG A;  5ENE A;  4YAD A;  5BT4 A;  4IR6 A;  2KR4 A;  5F62 A;  5IG6 A;  5LJ0 A;  4UIZ A;  5HEL A;  5H1U A;  4BHW A;  2RO1 A;  2MA6 A;  2KE1 A;  4HXM A;  2F42 A;  5CRZ A;  5I7Y A;  5EWV A;  3M99 A;  1ZBD B;  3QZV A;  4NYX A;  4J0R A;  4IR4 A;  4NYW A;  4CLB A;  4TT4 A;  1VFY A;  5D3H A;  5BT5 A;  2G43 A;  5FE1 A;  4QZS A;  4XUA A;  2VPB A;  2CT2 A;  5HEM A;  1LDK C;  4CUQ A;  2L43 A;  4NUD A;  3JVM A;  4GNE A;  4UYF A;  5FE0 A;  5BT3 A;  5DKH A;  5EWH A;  4YY4 A;  2H0D B;  2E3K A;  5CQ7 A;  3RTR B;  3DAI A;  2LGK A;  4F52 B;  2PNX A;  4XUB A;  4UI9 B;  1ZS5 A;  2E7N A;  4ZW1 A;  5C7N A;  4QSP A;  4KCX A;  5HEN A;  3N9N A;  4HBY A;  5CU8 A;  5HQ6 A;  4MEQ A;  5F63 A;  5C8G A;  4PCI A;  5L99 A;  5D26 A;  4ZQL A;  2C2V S;  4A9F A;  5EI4 A;  4CUS A;  5FE3 A;  5FBX A;  4LYS A;  2VJE A;  4TU6 A;  1IYM A;  5IGN A;  1WEW A;  4IOO A;  4TT6 A;  2OSS A;  5B77 A;  1HYI A;  4YYN A;  5CQ8 A;  5HRV A;  5I7X A;  1WEO A;  5L96 A;  4TZ8 A;  2Y1M A;  4QR4 A;  5C11 A;  4YYH A;  5C89 A;  1FBV A;  2KRE A;  2KTB B;  2WP2 A;  5DYX A;  2D82 A;  5EIC A;  5CGP A;  4UIU A;  5EYA F;  4CA1 A;  1E6I A;  2OUO A;  5E9L A;  4BJX A;  5B79 A;  5L8U A;  4AYC A;  4BW3 A;  4LR6 A;  4NRB A;  2YEM A;  4O76 A;  2YSM A;  2E6R A;  5TCM A;  5ETD A;  2VJF A;  3U5J A;  2MT5 A;  4OGJ A;  4TKP B;  3RCW A;  5B76 A;  4QSU A;  5E9I A;  4YBS A;  4YYI A;  4L58 A;  3G0J A;  5J3X A;  1JM7 B;  1JM7 A;  1X0J A;  4NN2 A;  3Q2E A;  5DYU A;  5D3L A;  2I8N A;  1X4U A;  5CQ6 A;  4TZ2 A;  1T1H A;  4FO9 A;  5A82 A;  4ZUX U;  4FLP A;  4QR3 A;  5FH8 A;  4O77 A;  4IOR A;  2YYR A;  4HXS A;  5C87 A;  5I83 A;  5JWM A;  2KGI A;  4CUP A;  2QIC A;  3T7L A;  1XWH A;  2VPD A;  2LXP C;  4TQN A;  4XY9 A;  4CUT A;  2L80 A;  3LQJ A;  3MHH A;  4WHU A;  2KWJ A;  3O35 A;  4NR9 A;  3P1D A;  4R7E A;  1BOR A;  5FFW A;  3V43 A;  4GNF A;  4NXJ A;  3SVF A;  3FL2 A;  3LRQ A;  4QYL A;  4FJC A;  5EM3 A;  5HQ7 A;  5CFW A;  5FE5 A;  2KWK A;  5LKU A;  4Y03 A;  5HRX A;  4TS8 A;  4CFL A;  3ZPV 1;  1WIL A;  3DWY A;  5D3N A;  3UV4 A;  4YBM A;  2KU3 A;  1WEQ A;  4LYW A;  2LGG A;  2YDW A;  4MR4 A;  4LK9 A;  5G05 B;  2OO1 A;  5KH7 A;  4TYL A;  5A85 A;  4PS5 A;  1WEP A;  4B7Y C;  5F25 A;  2C2L A;  4R8P K;  3MB4 A;  5F3A A;  3HMH A;  4LZS A;  4QNS A;  5LKT A;  5TDW A;  2UZG A;  4AUQ B;  4LC2 A;  5HM0 A;  3MUK A;  2G45 A;  2L0B A;  4J0S A;  4YH4 A;  5LVR A;  4PPE A;  3U5N A;  2YHN A;  4XI1 A;  4S3O B;  3RPG C;  4W4U A;  4I7B A;  4QY4 A;  3U5O A;  5D3T A;  5A83 A;  5LVQ A;  4QC3 A;  3KV5 A;  3LJW A;  4AVX A;  2YUR A;  4UYH A;  4UIV A;  5EQ1 A;  5HJC A;  4QSX A;  3MHS A;  4C67 A;  3JVJ A;  5EWW A;  2EOD A;  5TRB A;  5ENB A;  4PKL A;  5FE4 A;  4UIY A;  3U5L A;  2L85 A;  5A7C A;  4MVT A;  2KIZ A;  5FE9 A;  4N3W A;  5CTL A;  1X4I A;  4MR6 A;  4WA6 A;  4A9I A;  4BBQ A;  3AAD A;  5LUU A;  5F1L A;  4N4F A;  3UVD A;  2K17 A;  2YEL A;  2NXB A;  4GB0 A;  5B8D A;  4LAD B;  2DVR A;  2XEU A;  4PY6 A;  5CUB A;  3MQM A;  4MEO A;  4O7E A;  5DW1 A;  3SVH A;  4YYM A;  4WIV A;  3N9M A;  5TAB A;  5EPS A;  3ZTG A;  3U5M A;  2PUY A;  4WHW A;  4TU4 A;  5DX4 A;  3PUR A;  5COI A;  5G0F A;  4TT2 A;  5FH6 A;  2DVQ A;  5D1K B;  5KHM A;  4AYC B;  2KWN A;  3PHD A;  3IU6 A;  3I2D A;  5E9M A;  5DBM A;  5I86 A;  4YAT A;  4YAB A;  5KTX A;  2ECW A;  2I7K A;  5EA1 A;  2LGL A;  4A9M A;  2BAY A;  2KYU A;  4O7A A;  2EA6 A;  3MB3 A;  5D1M B;  4MR3 A;  5ENJ A;  4S3O C;  5CPE A;  5ENF A;  3PUQ A;  3JVK A;  1JSP B;  3N9P A;  4Q0N A;  4HXR A;  5A5P A;  4N4G A;  5CQA A;  4O78 A;  4YYJ A;  5L8T A;  4QEV A;  4Z1Q A;  2NAA A;  3HMF A;  4NUC A;  4GND A;  4PTB A;  2YW8 A;  5CQ5 A;  2KGG A;  2YRE A;  5DW2 A;  5FDZ A;  4WZ2 A;  3GL6 A;  5LCW B;  4NUE A;  5H1V A;  4V3K C;  3ZVZ B;  4NR7 A;  2H0D A;  4A4B A;  5CP5 A;  4P5O B;  2G6Q A;  4QSS A;  3DPL R;  4N4H A;  5TDR A;  4A9O A;  3O70 A;  2RNX A;  5ETB A;  2I50 A;  4HXN A;  2L75 A;  1WE9 A;  2FUU A;  3KNV A;  3N9L A;  1VYX A;  4FIP A;  3ZYQ A;  5F2P A;  3Q2F A;  5D3J A;  4IR5 A;  5EWD A;  3FKM X;  4QSQ A;  5AIU A;  2DVV A;  3ZNI A;  3P1C A;  5AD2 A;  5FG5 A;  5KU3 A;  4C9Z A;  1N72 A;  3QZT A;  2KWO A;  2ECN A;  4GNG A;  4ALH A;  1CHC A;  5EGU A;  5KTW A;  5KH3 A;  1WEN A;  4Z93 A;  2LQ6 A;  5HFQ A;  5IBN A;  4QEW A;  4UYD A;  1WUM A;  3P5O A;  2R0V A;  1WES A;  2IDA A;  2JRJ A;  5H1T A;  2D9E A;  4HBW A;  5FH7 A;  4UIT A;  2YHO A;  5H9M A;  2YU4 A;  4BW4 A;  4A0C D;  5CUC A;  2JMJ A;  5JI8 A;  2YQM A;  2RFJ A;  2RSD A;  2DX8 A;  3SOW A;  3TLP A;  2YUC A;  1JOC A;  3LQH A;  4TTE A;  4NR8 A;  4NYV A;  1U6G B;  2MUM A;  5JG6 A;  3N9O A;  3UV2 A;  5I1Q A;  2OXQ C;  2M6M A;  3O37 A;  2F6N A;  5CUA A;  5B78 A;  4WZ3 B;  2R10 A;  4UIX A;  5CRM A;  5E7D A;  5FE6 A;  5CZG A;  5HLS A;  5TB6 A;  1V87 A;  5F36 A;  4X2I A;  1WGM A;  4J3I A;  2R0S A;  4A49 A;  2CKL B;  5II1 A;  2LV9 A;  4YBT A;  4QSW A;  5A5O A;  4QF3 A;  5FE7 A;  4CCG X;  4NQM A;  4WZ0 A;  2K4D A;  2N9G A;  4B86 C;  3MXF A;  4QYD A;  5I29 A;  5IGL A;  1RMD A;  2K16 A;  5FEY A;  2DKW A;  5KH9 A;  4A4C A;  5FB1 A;  2MD7 B;  4LYI A;  4O71 A;  3P1F A;  5L98 A;  5HRW A;  5I3L A;  5E74 A;  4UYE A;  5DYC A;  5G04 B;  3LXJ A;  4YH3 A;  5DFC A;  5EIS A;  5FE2 A;  2YW5 A;  4YYK A;  5C85 A;  3U5K A;  2DVS A;  4HBX A;  4PCE A;  4XY8 A;  4HXK A;  3ZVY A;  2F6J A;  4QSR A;  4HXL A;  5D3R A;  5EPR A;  4AP4 A;  2RNW A;  2MA5 A;  5DFB A;  2MJV B;  3M62 A;  5A5N A;  3T6R A;  3SVG A;  4YC9 A;  5L97 A;  4UYG A;  4UP0 A;  5EP7 A;  2VJE B;  3O34 A;  4KV4 A;  3C5K A;  2YYN A;  3QZS A;  1K2F A;  4ALG A;  2DWW A;  1VD4 A;  4O75 A;  2VPG A;  2Y43 A;  5I80 A;  2XB1 A;  5ENG A;  2DAT A;  3ONI A;  4YK0 A;  4NR5 A;  2QIZ A;  5EK9 A;  2AN6 A;  2K1J A;  3NG2 A;  2D8S A;  4CUR A;  4MR5 A;  4C66 A;  3O33 A;  4Q0O A;  5HQ5 A;  5ENC A;  1WEU A;  5DKC A;  4LZR A;  2R0Y A;  4LZ2 A;  2VPE A;  3K2J A;  5DYA A;  2E7O A;  1JM4 B;  2FUI A;  3UV5 A;  3G0L A;  4QF2 A;  3UVW A;  5FE8 A;  4CL9 A;  5CY9 A;  3DQV R;  4O64 A;  4BW2 A;  5E9Y A;  2MD8 C;  5H85 A;  5E3G A;  5D24 A;  4CUU A;  5EVA A;  1WEM A;  4LDF A;  4RVR A;  4HBV A;  1MM2 A;  4LLB A;  3KQI A;  1F62 A;  4IR3 A;  5IGK A;  2GRC A;  4HXO A;  5HFR A;  2H60 A;  5LJ2 A;  3S91 A;  4O7C A;  4YAX A;  2JMI A;  4QEU A;  5DKD A;  5I88 A;  2CSY A;  5IID A;  2E6S A;  2Y1N A;  4A9E A;  4OUF A;  5CQ3 A;  4NQN A;  3L1X A;  2LSP B;  3HTK C;  5KO4 A;  4QUT A;  4I7D A;  1Z6U A;  1WUG A;  4ZC9 A;  2ECG A;  4NRA A;  5ENH A;  2RS9 B;  4QR5 A;  2CKL A;  1F68 A;  4O74 A;  4QC1 A;  2ECI A;  5DKA A;  3SHB A;  4QUU A;  5CQ4 A;  2ECV A;  2HYE D;  3P1E A;  3S92 A;  4MSX A;  1HYJ A;  4A9N A;  2ECT A;  4J1P A;  2FSA A;  4IC2 A;  5A5Q A;  5DIN A;  3ASL A;  1LDJ B;  3GV4 A;  3GG3 A;  4BW1 A;  4L7X A;  4Z6H A;  4X3G A;  4I7C A;  4UIW A;  2L5U A;  5A5R A;  5LKZ A;  4E96 A;  3L1Z B;  3SOU A;  5A81 A;  2VJF B;  2VNF A;  4QST A;  1FP0 A;  3ZYU A;  5HCL A;  3O7A A;  5EPB A;  2YSJ A;  2LXH C;  3I3J A;  5F60 A;  1G25 A;  3D7C A;  5A5S A;  3L11 A;  3LQI A;  4YYG A;  3U5P A;  4A9L A;  5FER A;  3MUL A;  4YYD A;  4F3I A;  5AME A;  5CS8 A;  2L5E A;  4QBM A;  4NR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...