5FB1A

Crystal structure of a phd finger bound to histone h3 k9me3 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
174
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYGPQKPMWLNKVKTSLNEQTYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/structural protein
molecule keywords Nuclear autoantigen Sp-100
publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb1A01
4O7AA 2DATA 3DAIA 2G43A 4PY6A 2WP2A 4UIYA 2KFTA 4J3IA 3O35A 4CLBA 2VPDA 5ENGA 4NS5A 5ETDA 4IC2A 4NUDA 2L0BA 4W4UA 4NYVA 4WZ0A 4MR6A 5C87A 2OSSA 5KTXA 4CUTA 1MM3A 4AYCA 5I3LA 3LJWA 5CUCA 2YQLA 4XY8A 2E6RA 2RSDA 5HRWA 5DW1A 5DFBA 1EQFA 2OO1A 4N4GA 4O7BA 5EP7A 4Y03A 4A9FA 4MEOA 5CUGA 2H0DB 4X3GA 5CQAA 3MXFA 5J0DA 4MR4A 4YYMA 2HDPA 5C11A 5CUDA 2C2LA 4O76A 5F3AA 5C8GA 4GNEA 3L1ZB 2DVSA 5KO4A 2OUOA 4O78A 5FG6A 1HYIA 2RNYA 3P5OA 2LGGA 2YEKA 5E9MA 4QC3A 5FE2A 2LRIC 4P5OB 4XUAA 5ENJA 5EPBA 2YQDA 5FB1A 5HLSA 3ONIA 5A5NA 4QF3A 4ZDTA 2KYUA 2MT5A 4B7YC 3N9NA 4QSRA 3V43A 5C13A 2L80A 1WEUA 5HCLA 4FO9A 5I88A 4UIVA 4QYDA 4A9EA 4AUQB 5A83A 2LQ6A 5DKCA 4A9NA 3EB6A 4YBTA 2YSMA 2MIQA 1N72A 4ZUXU 3DQVR 2LV9A 3C5KA 4AYCB 3O7AA 4GNGA 3MULA 2DX8A 3LQJA 4UP0A 4BHWA 2G4AA 4L58A 2L84A 5COIA 5CFWA 5E9VA 5HM0A 4Z6HA 2G45A 5CQ8A 4UYFB 1Z6UA 4O7EA 5K29A 5E3DA 2WP1A 4UYHA 2E7OA 5FE6A 5F63A 4BJXA 4YK0A 4HXNA 4PCIA 4QR5A 4QUTA 4F3IA 2K17A 5HFRA 4YABA 1G25A 2MJVB 2KWNA 5CUBA 3SVFA 5EI4A 2F6JA 2L43A 4A9LA 5CS8A 2OXQC 5LKZA 3MQMA 4PTBA 4NXJA 5ETBA 5IGNA 2NAAA 3P1DA 4ALGA 2LN0A 4CUPA 3L1XA 3N9QA 2FUIA 4YYHA 2YW5A 3AQAA 1K2FA 1MM2A 4UYGA 5A5OA 2ZETC 5J3XA 2KTBB 4HBVA 4Z93A 5I86A 5D7XA 3JVJA 2VPGA 3ZPV1 4QEUA 5E3GA 5LJ1A 1RMDA 5CPEA 4TU4A 4YH4A 2XB1A 2I8NA 4O70A 4WIVA 5F1LA 1CHCA 4LJNA 5CQ7A 3HMFA 2Y1NA 3LQHA 4LYWA 2ECWA 5F60A 4TT4A 4NR8A 1WUGA 2MA6A 3M63A 4N3WA 1U6GB 1WEOA 5CQ4A 5FE1A 4Z1QA 2EA6A 1WESA 2LSPB 5CTLA 5DY7A 4E96A 5L97A 3O70A 2R0SA 5CGPA 5F25A 4HBWA 5LVQA 1FP0A 4UYDA 4IORA 4AKNA 4UITA 4Z6IA 4BW2A 4O7FA 4UIWA 5EWCA 4O77A 1E4UA 5CRMA 2QIZA 5G4SA 4A9KA 4LADB 2MA5A 4A9IA 4A9HA 2JRJA 2JMDA 4PPEA 2VJFB 5TABA 1X0JA 5FH6A 1WILA 4O72A 2G6QA 4NR6A 1WGMA 3DPLR 3VK6A 5E73A 3U5PA 4PS5A 2LXPC 5A85A 4HXLA 3O34A 4YY6A 5TRBA 3RPGB 5EPSA 5I29A 5HFQA 4BW3A 3DWYA 3O33A 3UW9A 2ECNA 4I7CA 3U5OA 4HXMA 1WE9A 5FBXA 4UIXA 3MB4A 4B86C 2NXBA 2KWJA 4NR9A 4A9OA 3O36A 4Q6FA 3N9LA 4QSSA 5LKUA 3S91A 3K2JA 4FJCA 2D9EA 2YDWA 5FFVA 5LJ2A 5B76A 4O71A 4KCXA 4QZSA 1WEMA 5HQ5A 3ZVYA 4A49A 4OGIA 2LDRA 5CU8A 2QICA 3P1FA 4DONA 2FUUA 4QUUA 4CCGX 1E6IA 1DVPA 4QSPA 3QZTA 5FE9A 3SOXA 3SOUA 4MEPA 3NG2A 5C85A 5FB0A 1FBVA 3FL2A 4A9MA 5TDWA 3ZVZB 4A4BA 3QZSA 5EU1A 4PKLA 3NXBA 3AADA 2E6SA 4QR3A 4YBSA 5HRXA 4TQNA 5D3PA 4NR4A 2RO1A 2QJ0A 3N9PA 4HXOA 3N9OA 1WFKA 2M6MA 5G4RA 3HCTA 3ZNIA 5E9KA 2M3HA 4C66A 4S3OB 4HBYA 4LRGA 2MD7B 5FERA 4HXRA 3ZPVE 5D3SA 4L7XA 3LRQA 1VD4A 3UVDA 5A5SA 2FSAA 4HXPA 1IYMA 5I7XA 3N9MA 1LDKC 4XUBA 5KH3A 5DYXA 4LK9A 5G05B 4RVRA 5EYAF 5HQ7A 5ENIA 5KU3A 2L5EA 2YUCA 5I80A 2R0VA 2RI7A 5HRVA 4TS8A 5TCMA 4TKPB 5DLXA 2JMIA 5LVRA 5IBNA 2D82A 4LDFA 2DKWA 5CP5A 2MD8C 5ACYA 5D3TA 2YSJA 3MHSA 2MNZA 5A82A 3RPGC 5D3JA 5F2PA 4V3LC 2GRCA 2DWWA 4LZRA 5E74A 4LZSA 1WEVA 4LYIA 5ENCA 5B77A 5D3RA 2YHNA 5ENHA 5B79A 4MR3A 5AMEA 3UV4A 4QBMA 5E9YA 4O7CA 4IOQA 4N4HA 3M62A 2L85A 5C89A 2YELA 5G04B 5HEMA 5LKTA 4NQMA 5EWWA 5FDZA 5FE8A 4UYEA 5HENA 3IU6A 5E9LA 4QYLA 4WA6A 4UIUA 5FFYA 3O37A 5CQ6A 5D3NA 2VP7A 2RS9B 4HXKA 5L96A 3KQIA 5H1UA 5I40A 2F42A 4TT2A 5A81A 5DFDA 4QB3A 4YC9A 2DVQA 5CUAA 5HELA 5C7NA 4IR3A 1X4JA 5D1MB 4MENA 5TBNA 4WHUA 3KV5A 5I83A 2VPEA 4CFLA 4UP5A 3RCWA 2ECVA 5AIUA 5L8UA 4WZ2A 4XYAA 5KHMA 4HBXA 5FE3A 3GV4A 3PUQA 3GG3A 4MSXA 3RTRB 4R7EA 3JVLA 5CQTA 5I7YA 5EK9A 4ZC9A 4XY9A 2C2VS 1JOCA 5DKAA 4LR6A 4N4FA 1V87A 4AP4A 1WENA 3PHDA 3I2DA 5DINA 5D3LA 4C67A 3IU5A 4CUSA 5F61A 1JSPB 2I50A 3IHPA 5FG5A 3HMHA 5JWMA 5DYAA 5A5PA 5BT4A 4O64A 4BBQA 4UI9B 4CL9A 4S3OC 3Q2FA 3U5KA 3HTKC 5DYUA 2KWKA 5E0RA 5CQ3A 3UVWA 5EVAA 2UZGA 3HCUA 4QY4A 4NYWA 4O75A 4IC3A 4YBMA 2AN6A 5H1VA 4FK5A 5D0CA 3ZTGA 5ENFA 4YATA 3L11A 5A7CA 5CZGA 1JM4B 2F6NA 1XWHA 2KE1A 3KV6A 5B78A 1X4IA 4QSTA 4QSWA 3MB3A 2LGKA 5LCWB 3FKMX 5F5ZA 5FFWA 2KGIA 4NRAA 5EGUA 2MNYA 4OUFA 1ZS5A 4QNSA 1VYXA 5FG4A 2ECJA 5DBMA 4PCEA 5B75A 4C9ZA 4TZ8A 1F68A 3TLPA 3ZYQA 3UV2A 2H60A 5DX4A 5ENBA 2YQMA 2E3KA 5C4QA 5DYCA 4YH3A 5A5QA 2VNFA 5D1LB 2M1RA 1WEWA 3M99A 2JMJA 4ZQLA 5I89A 4NN2A 5LUUA 2K4DA 2LGLA 2MUMA 2VJEA 4IR5A 3ZYUA 3ASLA 4NRCA 5IGLA 4QEWA 2Y43A 1X4UA 3T6RA 5L98A 3UVXA 5AMFA 5EISA 1ZBDB 3U5NA 4TU6A 5A5RA 4NUCA 2RNXA 5TB6A 4CFKA 5CY9A 5EWDA 4IR6A 4CURA 2I7KA 1WEPA 4J0RA 4UIZA 2EGPA 4NR5A 5DFCA 2BAYA 1LDJB 2E7NA 4UYFA 3UV5A 3SVHA 5IG6A 5EWVA 3G0JA 4FLPA 5EWHA 4NRBA 5HJCA 5L8TA 4Q0NA 2PUYA 5DKHA 5F36A 4YYDA 2RNWA 5AD2A 2KREA 2DVRA 4GNFA 4A0CD 2CKLA 5LKXA 2N9GA 4MR5A 5D26A 4YADA 3P1EA 5KH7A 4QSXA 2IDAA 2VJEB 2YU4A 3HCSA 3JVMA 4AVXA 3GL6A 5AD3A 5CRZA 4I7BA 5H9MA 4YAXA 5JG6A 3U5JA 4LZ2A 2YURA 5FH8A 4GB0A 2EODA 3D7CA 5H1TA 2YT5A 2XEUA 2YW8A 3U5LA 4A9JA 3HMEA 4YYJA 1T1HA 4QSUA 2KIZA 4YYGA 2CT2A 3LQIA 4WZ3B 3UVYA 3SOWA 3EB5A 5DLZA 4NYXA 4CUUA 4R8PK 4LYSA 2DVVA 4Q0OA 5EICA 1JM7A 3Q2EA 5D3HA 5BT5A 2RFJA 4YYNA 5KTUA 3G0LA 5FE7A 4LLBA 4I7DA 5D24A 5F62A 2KWOA 4TT6A 2ECGA 5E7DA 1N87A 4X2IA 2Y1MA 4YYIA 3MHHA 2CKLB 3LXJA 5KTWA 3KNVA 4FIPA 4WHWA 5HQ6A 2KR4A 3P1CA 4QF2A 5FEYA 5EA1A 4QSQA 4CUQA 4BW1A 5H85A 5G0FA 4LKAA 2VJFA 5JI8A 5L99A 5D1KB 5D25A 2YYNA 1WEQA 4KV1A 4BW4A 3C6WA 3JVKA 5EQ1A 5FE5A 1HYJA 4IR4A 3PURA 4ALHA 4ZW1A 2ECTA 4QEVA 1VFYA 1WUMA 2R0YA 5AITA 2KGGA 4HXSA 2HYED 2M85A 2LGVA 3T7LA 4J0SA 4GNDA 2L5UA 4NUEA 5II1A 4GPJA 1JM7B 1F62A 5IGKA 4QR4A 5II2A 3QZVA 1Z60A 5ENEA 5I1QA 4TTEA 4XI1A 4F52B 4LC2A 1Z2QA 2CSYA 5FH7A 4O74A 4OGJA 4IOOA 5FE4A 5IGMA 4V3KC 3I3JA 5EM3A 2YYRA 4YY4A 2LXHC 4TZ2A 4YYKA 5EV9A 5DKDA 5E9IA 5CQ5A 5EPRA 5TDRA 1WIMA 5DW2A 2VPBA 2PNXA 3SHBA 1WEEA 2L75A 3U5MA 2KU3A 2H0DA 5LJ0A 4A4CA 4R2YA 2K16A 1BORA 2K1JA 2ECIA 4MEQA 5IIDA 4KV4A 5B8DA 4QSVA 2R10A 5F1HA 2D8SA 4N4IA 4J1PA 3SVGA 2YHOA 4MVTA 5KH9A 4QC1A 5CUEA 3S92A 2YEMA 4NQNA 4CA1A 4Z1SA 5BT3A 2YREA 2CSZA 3MUKA 4NR7A 4TYLA 5FE0A
chains in the Genus database with same CATH superfamily
4O7AA 2DATA 3DAIA 2G43A 4PY6A 2WP2A 4UIYA 2KFTA 4J3IA 3O35A 4CLBA 2VPDA 5ENGA 4NS5A 5ETDA 4IC2A 4NUDA 2L0BA 4W4UA 4NYVA 4WZ0A 4MR6A 5C87A 2OSSA 5KTXA 4CUTA 1MM3A 3FEHA 4AYCA 5I3LA 3LDYA 3LJWA 5CUCA 2YQLA 4XY8A 2E6RA 2RSDA 5HRWA 5DW1A 5DFBA 1EQFA 2OO1A 4N4GA 4O7BA 5EP7A 4Y03A 4A9FA 4MEOA 5CUGA 2H0DB 4X3GA 5CQAA 3MXFA 5J0DA 4MR4A 4YYMA 2HDPA 3H7HA 5C11A 5CUDA 2C2LA 4Z0RA 3DWDA 4O76A 5F3AA 5C8GA 4GNEA 3L1ZB 2DVSA 5KO4A 2OUOA 4O78A 5FG6A 1HYIA 2RNYA 3P5OA 2LGGA 2YEKA 5E9MA 4QC3A 5FE2A 2LRIC 4P5OB 4XUAA 5ENJA 5EPBA 2YQDA 5FB1A 5HLSA 3ONIA 5A5NA 4QF3A 4ZDTA 2KYUA 2MT5A 4B7YC 3N9NA 4QSRA 3V43A 5C13A 2L80A 1WEUA 5HCLA 2XOZA 4FO9A 5I88A 4UIVA 4QYDA 4A9EA 4AUQB 5A83A 2LQ6A 5DKCA 4A9NA 3EB6A 2KKXA 4YBTA 2YSMA 2MIQA 1N72A 4ZUXU 3DQVR 2LV9A 3C5KA 4AYCB 3O7AA 4GNGA 3MULA 2DX8A 3LQJA 4UP0A 2IQJA 4BHWA 2G4AA 1MBMA 4L58A 2L84A 5COIA 5CFWA 3SUBA 5E9VA 5HM0A 4Z6HA 2G45A 5CQ8A 4UYFB 1Z6UA 4O7EA 5K29A 5E3DA 2WP1A 4UYHA 2E7OA 5FE6A 5F63A 4BJXA 4YK0A 4HXNA 4PCIA 4QR5A 4QUTA 4F3IA 2K17A 3VKHA 5HFRA 4YABA 1G25A 2MJVB 2KWNA 5CUBA 3SVFA 5EI4A 2F6JA 2L43A 4A9LA 5CS8A 2OXQC 5K3QA 5LKZA 3MQMA 4PTBA 2YVRA 4NXJA 5ETBA 5IGNA 2NAAA 3P1DA 4ALGA 2LN0A 4CUPA 3L1XA 3N9QA 2FUIA 4YYHA 2YW5A 3AQAA 1K2FA 1MM2A 4UYGA 5A5OA 2ZETC 5J3XA 2KTBB 4HBVA 4Z93A 5I86A 5D7XA 3JVJA 2VPGA 3ZPV1 4QEUA 5E3GA 5LJ1A 1RMDA 5CPEA 4TU4A 4YH4A 2OWAA 2XB1A 2I8NA 4O70A 4WIVA 5F1LA 1CHCA 4LJNA 5CQ7A 3DDTA 3HMFA 2Y1NA 3LQHA 4LYWA 2ECWA 5F60A 4TT4A 4NR8A 1WUGA 2MA6A 2CONA 4N3WA 1U6GB 3M63A 1WEOA 5CQ4A 5FE1A 4Z1QA 2EA6A 1WESA 2LSPB 5CTLA 5DY7A 4E96A 5L97A 3O70A 2R0SA 5CGPA 5F25A 4HBWA 5LVQA 1FP0A 4UYDA 2RR4A 4IORA 4AKNA 4UITA 3E2DA 3FANA 4Z6IA 4BW2A 4O7FA 4AKGA 4UIWA 5EWCA 4O77A 1E4UA 5CRMA 2QIZA 5G4SA 4A9KA 4LADB 2MA5A 4A9IA 4A9HA 2JRJA 2JMDA 4PPEA 2VJFB 5TABA 3KDEC 1X0JA 5FH6A 1WILA 4QQ4A 4O72A 2G6QA 4NR6A 1WGMA 3DPLR 3VK6A 5E73A 3U5PA 4PS5A 2LXPC 5A85A 4HXLA 3O34A 4YY6A 5TRBA 3RPGB 5EPSA 5I29A 5HFQA 4BW3A 3DWYA 3O33A 3UW9A 2ECNA 4I7CA 3U5OA 4HXMA 1WE9A 5FBXA 3ERRA 4UIXA 2L7PA 3MB4A 4B86C 2NXBA 2KWJA 1DCQA 4NR9A 4A9OA 3O36A 4Q6FA 3N9LA 4QSSA 5LKUA 3S91A 3K2JA 4FJCA 3LJUX 2D9EA 2YDWA 5FFVA 5LJ2A 5B76A 4O71A 4KCXA 4QZSA 1WEMA 5HQ5A 3ZVYA 2XOYA 4A49A 4OGIA 2LDRA 5CU8A 2QICA 3P1FA 4DONA 2FUUA 4QUUA 4CCGX 1E6IA 1DVPA 4QSPA 3QZTA 5FE9A 3SOXA 3D1BA 4MEPA 3NG2A 3SOUA 3M7KA 5C85A 5FB0A 1FBVA 3FL2A 4A9MA 5TDWA 3ZVZB 4A4BA 3QZSA 5EU1A 4PKLA 3NXBA 3AADA 2E6SA 4QR3A 4YBSA 5HRXA 4TQNA 5D3PA 4AKIA 4NR4A 2RO1A 2QJ0A 3N9PA 4HXOA 3N9OA 1WFKA 2M6MA 5G4RA 3HCTA 3ZNIA 5E9KA 2M3HA 3LVRE 4C66A 2MKEA 4S3OB 4HBYA 4LRGA 2MD7B 5FERA 4HXRA 3ZPVE 5D3SA 4L7XA 3LRQA 1VD4A 3UVDA 5A5SA 2FSAA 4HXPA 1IYMA 5I7XA 3VKGA 1LDKC 4XUBA 3N9MA 5DYXA 4LK9A 5G05B 4RVRA 5KH3A 5EYAF 5HQ7A 5ENIA 5KU3A 2L5EA 2YUCA 5I80A 2R0VA 2RI7A 5HRVA 4TS8A 5TCMA 4TKPB 5DLXA 2JMIA 5LVRA 5IBNA 2D82A 4LDFA 2DKWA 4OGCA 5CP5A 2MD8C 2EGMA 5ACYA 5D3TA 2YSJA 3MHSA 2MNZA 5A82A 3RPGC 5D3JA 5F2PA 4V3LC 2GRCA 2DWWA 4LZRA 2DSMA 5E74A 4LZSA 1WEVA 4LYIA 4Z0OA 5ENCA 5B77A 5D3RA 2YHNA 5ENHA 5B79A 4MR3A 5AMEA 3UV4A 4QBMA 5E9YA 4O7CA 4IOQA 4N4HA 3M62A 2L85A 5C89A 2YELA 5G04B 5HEMA 5LKTA 4NQMA 5EWWA 5FDZA 5FE8A 4UYEA 5HENA 3IU6A 5E9LA 4QYLA 4WA6A 4UIUA 5FFYA 3O37A 5CQ6A 5D3NA 2VP7A 2RS9B 4HXKA 5L96A 3KQIA 5H1UA 5I40A 2F42A 2CRWA 4TT2A 5A81A 1PUOA 4QB3A 4YC9A 2DVQA 5CUAA 5DFDA 5HELA 5C7NA 4IR3A 1X4JA 5D1MB 4MENA 5TBNA 4WHUA 3KV5A 5I83A 2VPEA 2XP0A 4CFLA 5SVIA 4UP5A 3RCWA 2ECVA 5AIUA 5L8UA 4WZ2A 4XYAA 5KHMA 4HBXA 5FE3A 3GV4A 3PUQA 3GG3A 4MSXA 3RTRB 4R7EA 3JVLA 5CQTA 5I7YA 5EK9A 4ZC9A 4XY9A 2C2VS 3O47A 1JOCA 5DKAA 4LR6A 4N4FA 1V87A 3MDBC 3T9KA 4AP4A 1WENA 3PHDA 3I2DA 5DINA 5D3LA 4C67A 3IU5A 4CUSA 5F61A 1JSPB 2I50A 3IHPA 5FG5A 3HMHA 5JWMA 5DYAA 5A5PA 5BT4A 4O64A 4BBQA 4UI9B 4CL9A 4S3OC 3Q2FA 3U5KA 3HTKC 5DYUA 2KWKA 5E0RA 5CQ3A 3UVWA 2M13A 5EVAA 2UZGA 3HCUA 4QY4A 2XOCA 4NYWA 4O75A 4IC3A 4YBMA 2AN6A 5H1VA 4FK5A 5D0CA 3ZTGA 5ENFA 4YATA 3L11A 5A7CA 5CZGA 1JM4B 2F6NA 1XWHA 2KE1A 3KV6A 5B78A 1X4IA 4QSTA 4QSWA 3MB3A 2LGKA 5LCWB 3FKMX 5F5ZA 5FFWA 2KGIA 4NRAA 5EGUA 2MNYA 4F1PA 4OUFA 1ZS5A 4QNSA 1VYXA 5FG4A 2ECJA 5DBMA 4PCEA 5B75A 4C9ZA 4TZ8A 1F68A 3TLPA 3ZYQA 3UV2A 2H60A 2CSVA 5DX4A 5ENBA 2YQMA 2E3KA 5C4QA 5DYCA 4YH3A 5A5QA 2VNFA 5D1LB 2M1RA 1WEWA 3M99A 2JMJA 4ZQLA 5I89A 4NN2A 5LUUA 2K4DA 2LGLA 2MUMA 2VJEA 4IR5A 3ZYUA 3ASLA 4NRCA 5IGLA 4OGEA 4QEWA 2EJNA 3D1DA 2Y43A 1X4UA 3T6RA 5L98A 3UVXA 2P57A 5AMFA 5EISA 1ZBDB 3U5NA 4TU6A 5A5RA 4NUCA 2RNXA 5TB6A 4CFKA 5CY9A 5EWDA 4AKHA 3FJUB 4IR6A 4CURA 2I7KA 1WEPA 4J0RA 4UIZA 2EGPA 4NR5A 5DFCA 2BAYA 1LDJB 2E7NA 4UYFA 3UV5A 3SVHA 2E61A 3FM8C 5IG6A 5EWVA 3G0JA 4FLPA 5EWHA 4NRBA 5HJCA 5L8TA 4H9DA 4Q0NA 2PUYA 5DKHA 5F36A 4YYDA 2RNWA 5AD2A 2KREA 2DVRA 2LAUA 4GNFA 2CKLA 4A0CD 5LKXA 2N9GA 2DJAA 4MR5A 5D26A 4YADA 3P1EA 2D8UA 2CRRA 5KH7A 4QSXA 2IDAA 2VJEB 2YU4A 3HCSA 3JVMA 2KKYA 4AVXA 3GL6A 5AD3A 5CRZA 4I7BA 4AI6A 5H9MA 2B0OE 4YAXA 5JG6A 3U5JA 4LZ2A 2YURA 5FH8A 4GB0A 2EODA 3D7CA 5H1TA 2YT5A 2XEUA 2YW8A 3U5LA 4A9JA 3HMEA 4YYJA 3FAOA 1T1HA 4QSUA 2KIZA 4YYGA 2CT2A 3LQIA 4WZ3B 3UVYA 3SOWA 3EB5A 5DLZA 4NYXA 4CUUA 4R8PK 4LYSA 2DVVA 4Q0OA 5EICA 1JM7A 3Q2EA 5D3HA 5BT5A 2RFJA 4YYNA 5SVYA 5KTUA 3G0LA 5FE7A 3PLWA 4LLBA 4I7DA 5D24A 5F62A 2KWOA 4TT6A 2ECGA 5E7DA 1N87A 4X2IA 2Y1MA 4YYIA 3MHHA 2CKLB 3LXJA 5KTWA 3KNVA 4FIPA 4WHWA 5HQ6A 2KR4A 3P1CA 4QF2A 5FEYA 5EA1A 4QSQA 4CUQA 4BW1A 5H85A 5G0FA 4LKAA 2VJFA 5JI8A 5L99A 2JUNA 5D1KB 5D25A 2YYNA 1WEQA 4KV1A 4BW4A 3C6WA 3JVKA 5EQ1A 5FE5A 1HYJA 4IR4A 3PURA 4ALHA 4ZW1A 2ECTA 4QEVA 1VFYA 1WUMA 2R0YA 5AITA 2KGGA 4HXSA 2HYED 2M85A 2LGVA 3T7LA 4J0SA 4GNDA 2L5UA 4NUEA 5II1A 4GPJA 1JM7B 1F62A 5IGKA 4QR4A 5II2A 3QZVA 1Z60A 5ENEA 5I1QA 4TTEA 4XI1A 4F52B 4LC2A 1Z2QA 2CSYA 5FH7A 4O74A 4OGJA 4IOOA 5FE4A 5IGMA 4V3KC 3I3JA 5EM3A 2YYRA 4YY4A 2LXHC 3JUEA 4TZ2A 4YYKA 5EV9A 5DKDA 5E9IA 5CQ5A 5EPRA 5SVIB 5TDRA 1WIMA 5SVXA 2FD4A 5DW2A 2JM3A 2VPBA 2PNXA 3SHBA 1WEEA 2L75A 3U5MA 2KU3A 3Q1DA 2H0DA 5LJ0A 4A4CA 2FFWA 4R2YA 2K16A 1BORA 2K1JA 2ECIA 3LVQE 4MEQA 5IIDA 4KV4A 2EXUA 5B8DA 4QSVA 2R10A 5F1HA 2D8SA 4N4IA 4J1PA 4O62A 3SVGA 2YHOA 4MVTA 5KH9A 4QC1A 5CUEA 3S92A 2YEMA 4NQNA 4CA1A 4Z1SA 5BT3A 1ZKRA 2YREA 2CSZA 3MUKA 4NR7A 4TYLA 5FE0A
chains in the Genus database with same CATH topology
4O7AA 2DATA 3DAIA 2G43A 4PY6A 2WP2A 4UIYA 2KFTA 4J3IA 3O35A 4CLBA 2VPDA 5ENGA 4NS5A 5ETDA 4IC2A 4NUDA 2L0BA 4W4UA 4NYVA 4WZ0A 4MR6A 5C87A 2OSSA 5KTXA 4CUTA 1MM3A 4AYCA 5I3LA 3LJWA 5CUCA 2YQLA 4XY8A 2E6RA 2RSDA 5HRWA 5DW1A 5DFBA 1EQFA 2OO1A 4N4GA 4O7BA 5EP7A 4Y03A 4A9FA 4MEOA 5CUGA 2H0DB 4X3GA 5CQAA 3MXFA 5J0DA 4MR4A 4YYMA 2HDPA 5C11A 5CUDA 2C2LA 4O76A 5F3AA 5C8GA 4GNEA 3L1ZB 2DVSA 5KO4A 2OUOA 4O78A 5FG6A 1HYIA 2RNYA 3P5OA 2LGGA 2YEKA 5E9MA 4QC3A 5FE2A 2LRIC 4P5OB 4XUAA 5ENJA 5EPBA 2YQDA 5FB1A 5HLSA 3ONIA 5A5NA 4QF3A 4ZDTA 2KYUA 2MT5A 4B7YC 3N9NA 4QSRA 3V43A 5C13A 2L80A 1WEUA 5HCLA 4FO9A 5I88A 4UIVA 4QYDA 4A9EA 4AUQB 5A83A 2LQ6A 5DKCA 4A9NA 3EB6A 4YBTA 2YSMA 2MIQA 1N72A 4ZUXU 3DQVR 2LV9A 3C5KA 4AYCB 3O7AA 4GNGA 3MULA 2DX8A 3LQJA 4UP0A 4BHWA 2G4AA 4L58A 2L84A 5COIA 5CFWA 5E9VA 5HM0A 4Z6HA 2G45A 5CQ8A 4UYFB 1Z6UA 4O7EA 5K29A 5E3DA 2WP1A 4UYHA 2E7OA 5FE6A 5F63A 4BJXA 4YK0A 4HXNA 4PCIA 4QR5A 4QUTA 4F3IA 2K17A 5HFRA 4YABA 1G25A 2MJVB 2KWNA 5CUBA 3SVFA 5EI4A 2F6JA 2L43A 4A9LA 5CS8A 2OXQC 5LKZA 3MQMA 4PTBA 4NXJA 5ETBA 5IGNA 2NAAA 3P1DA 4ALGA 2LN0A 4CUPA 3L1XA 3N9QA 2FUIA 4YYHA 2YW5A 3AQAA 1K2FA 1MM2A 4UYGA 5A5OA 2ZETC 5J3XA 2KTBB 4HBVA 4Z93A 5I86A 5D7XA 3JVJA 2VPGA 3ZPV1 4QEUA 5E3GA 5LJ1A 1RMDA 5CPEA 4TU4A 4YH4A 2XB1A 2I8NA 4O70A 4WIVA 5F1LA 1CHCA 4LJNA 5CQ7A 3HMFA 2Y1NA 3LQHA 4LYWA 2ECWA 5F60A 4TT4A 4NR8A 1WUGA 2MA6A 3M63A 4N3WA 1U6GB 1WEOA 5CQ4A 5FE1A 4Z1QA 2EA6A 1WESA 2LSPB 5CTLA 5DY7A 4E96A 5L97A 3O70A 2R0SA 5CGPA 5F25A 4HBWA 5LVQA 1FP0A 4UYDA 4IORA 4AKNA 4UITA 4Z6IA 4BW2A 4O7FA 4UIWA 5EWCA 4O77A 1E4UA 5CRMA 2QIZA 5G4SA 4A9KA 4LADB 2MA5A 4A9IA 4A9HA 2JRJA 2JMDA 4PPEA 2VJFB 5TABA 1X0JA 5FH6A 1WILA 4O72A 2G6QA 4NR6A 1WGMA 3DPLR 3VK6A 5E73A 3U5PA 4PS5A 2LXPC 5A85A 4HXLA 3O34A 4YY6A 5TRBA 3RPGB 5EPSA 5I29A 5HFQA 4BW3A 3DWYA 3O33A 3UW9A 2ECNA 4I7CA 3U5OA 4HXMA 1WE9A 5FBXA 4UIXA 3MB4A 4B86C 2NXBA 2KWJA 4NR9A 4A9OA 3O36A 4Q6FA 3N9LA 4QSSA 5LKUA 3S91A 3K2JA 4FJCA 2D9EA 2YDWA 5FFVA 5LJ2A 5B76A 4O71A 4KCXA 4QZSA 1WEMA 5HQ5A 3ZVYA 4A49A 4OGIA 2LDRA 5CU8A 2QICA 3P1FA 4DONA 2FUUA 4QUUA 4CCGX 1E6IA 1DVPA 4QSPA 3QZTA 5FE9A 3SOXA 3SOUA 4MEPA 3NG2A 5C85A 5FB0A 1FBVA 3FL2A 4A9MA 5TDWA 3ZVZB 4A4BA 3QZSA 5EU1A 4PKLA 3NXBA 3AADA 2E6SA 4QR3A 4YBSA 5HRXA 4TQNA 5D3PA 4NR4A 2RO1A 2QJ0A 3N9PA 4HXOA 3N9OA 1WFKA 2M6MA 5G4RA 3HCTA 3ZNIA 5E9KA 2M3HA 4C66A 4S3OB 4HBYA 4LRGA 2MD7B 5FERA 4HXRA 3ZPVE 5D3SA 4L7XA 3LRQA 1VD4A 3UVDA 5A5SA 2FSAA 4HXPA 1IYMA 5I7XA 3N9MA 1LDKC 4XUBA 5KH3A 5DYXA 4LK9A 5G05B 4RVRA 5EYAF 5HQ7A 5ENIA 5KU3A 2L5EA 2YUCA 5I80A 2R0VA 2RI7A 5HRVA 4TS8A 5TCMA 4TKPB 5DLXA 2JMIA 5LVRA 5IBNA 2D82A 4LDFA 2DKWA 5CP5A 2MD8C 5ACYA 5D3TA 2YSJA 3MHSA 2MNZA 5A82A 3RPGC 5D3JA 5F2PA 4V3LC 2GRCA 2DWWA 4LZRA 5E74A 4LZSA 1WEVA 4LYIA 5ENCA 5B77A 5D3RA 2YHNA 5ENHA 5B79A 4MR3A 5AMEA 3UV4A 4QBMA 5E9YA 4O7CA 4IOQA 4N4HA 3M62A 2L85A 5C89A 2YELA 5G04B 5HEMA 5LKTA 4NQMA 5EWWA 5FDZA 5FE8A 4UYEA 5HENA 3IU6A 5E9LA 4QYLA 4WA6A 4UIUA 5FFYA 3O37A 5CQ6A 5D3NA 2VP7A 2RS9B 4HXKA 5L96A 3KQIA 5H1UA 5I40A 2F42A 4TT2A 5A81A 5DFDA 4QB3A 4YC9A 2DVQA 5CUAA 5HELA 5C7NA 4IR3A 1X4JA 5D1MB 4MENA 5TBNA 4WHUA 3KV5A 5I83A 2VPEA 4CFLA 4UP5A 3RCWA 2ECVA 5AIUA 5L8UA 4WZ2A 4XYAA 5KHMA 4HBXA 5FE3A 3GV4A 3PUQA 3GG3A 4MSXA 3RTRB 4R7EA 3JVLA 5CQTA 5I7YA 5EK9A 4ZC9A 4XY9A 2C2VS 1JOCA 5DKAA 4LR6A 4N4FA 1V87A 4AP4A 1WENA 3PHDA 3I2DA 5DINA 5D3LA 4C67A 3IU5A 4CUSA 5F61A 1JSPB 2I50A 3IHPA 5FG5A 3HMHA 5JWMA 5DYAA 5A5PA 5BT4A 4O64A 4BBQA 4UI9B 4CL9A 4S3OC 3Q2FA 3U5KA 3HTKC 5DYUA 2KWKA 5E0RA 5CQ3A 3UVWA 5EVAA 2UZGA 3HCUA 4QY4A 4NYWA 4O75A 4IC3A 4YBMA 2AN6A 5H1VA 4FK5A 5D0CA 3ZTGA 5ENFA 4YATA 3L11A 5A7CA 5CZGA 1JM4B 2F6NA 1XWHA 2KE1A 3KV6A 5B78A 1X4IA 4QSTA 4QSWA 3MB3A 2LGKA 5LCWB 3FKMX 5F5ZA 5FFWA 2KGIA 4NRAA 5EGUA 2MNYA 4OUFA 1ZS5A 4QNSA 1VYXA 5FG4A 2ECJA 5DBMA 4PCEA 5B75A 4C9ZA 4TZ8A 1F68A 3TLPA 3ZYQA 3UV2A 2H60A 5DX4A 5ENBA 2YQMA 2E3KA 5C4QA 5DYCA 4YH3A 5A5QA 2VNFA 5D1LB 2M1RA 1WEWA 3M99A 2JMJA 4ZQLA 5I89A 4NN2A 5LUUA 2K4DA 2LGLA 2MUMA 2VJEA 4IR5A 3ZYUA 3ASLA 4NRCA 5IGLA 4QEWA 2Y43A 1X4UA 3T6RA 5L98A 3UVXA 5AMFA 5EISA 1ZBDB 3U5NA 4TU6A 5A5RA 4NUCA 2RNXA 5TB6A 4CFKA 5CY9A 5EWDA 4IR6A 4CURA 2I7KA 1WEPA 4J0RA 4UIZA 2EGPA 4NR5A 5DFCA 2BAYA 1LDJB 2E7NA 4UYFA 3UV5A 3SVHA 5IG6A 5EWVA 3G0JA 4FLPA 5EWHA 4NRBA 5HJCA 5L8TA 4Q0NA 2PUYA 5DKHA 5F36A 4YYDA 2RNWA 5AD2A 2KREA 2DVRA 4GNFA 4A0CD 2CKLA 5LKXA 2N9GA 4MR5A 5D26A 4YADA 3P1EA 5KH7A 4QSXA 2IDAA 2VJEB 2YU4A 3HCSA 3JVMA 4AVXA 3GL6A 5AD3A 5CRZA 4I7BA 5H9MA 4YAXA 5JG6A 3U5JA 4LZ2A 2YURA 5FH8A 4GB0A 2EODA 3D7CA 5H1TA 2YT5A 2XEUA 2YW8A 3U5LA 4A9JA 3HMEA 4YYJA 1T1HA 4QSUA 2KIZA 4YYGA 2CT2A 3LQIA 4WZ3B 3UVYA 3SOWA 3EB5A 5DLZA 4NYXA 4CUUA 4R8PK 4LYSA 2DVVA 4Q0OA 5EICA 1JM7A 3Q2EA 5D3HA 5BT5A 2RFJA 4YYNA 5KTUA 3G0LA 5FE7A 4LLBA 4I7DA 5D24A 5F62A 2KWOA 4TT6A 2ECGA 5E7DA 1N87A 4X2IA 2Y1MA 4YYIA 3MHHA 2CKLB 3LXJA 5KTWA 3KNVA 4FIPA 4WHWA 5HQ6A 2KR4A 3P1CA 4QF2A 5FEYA 5EA1A 4QSQA 4CUQA 4BW1A 5H85A 5G0FA 4LKAA 2VJFA 5JI8A 5L99A 5D1KB 5D25A 2YYNA 1WEQA 4KV1A 4BW4A 3C6WA 3JVKA 5EQ1A 5FE5A 1HYJA 4IR4A 3PURA 4ALHA 4ZW1A 2ECTA 4QEVA 1VFYA 1WUMA 2R0YA 5AITA 2KGGA 4HXSA 2HYED 2M85A 2LGVA 3T7LA 4J0SA 4GNDA 2L5UA 4NUEA 5II1A 4GPJA 1JM7B 1F62A 5IGKA 4QR4A 5II2A 3QZVA 1Z60A 5ENEA 5I1QA 4TTEA 4XI1A 4F52B 4LC2A 1Z2QA 2CSYA 5FH7A 4O74A 4OGJA 4IOOA 5FE4A 5IGMA 4V3KC 3I3JA 5EM3A 2YYRA 4YY4A 2LXHC 4TZ2A 4YYKA 5EV9A 5DKDA 5E9IA 5CQ5A 5EPRA 5TDRA 1WIMA 5DW2A 2VPBA 2PNXA 3SHBA 1WEEA 2L75A 3U5MA 2KU3A 2H0DA 5LJ0A 4A4CA 4R2YA 2K16A 1BORA 2K1JA 2ECIA 4MEQA 5IIDA 4KV4A 5B8DA 4QSVA 2R10A 5F1HA 2D8SA 4N4IA 4J1PA 3SVGA 2YHOA 4MVTA 5KH9A 4QC1A 5CUEA 3S92A 2YEMA 4NQNA 4CA1A 4Z1SA 5BT3A 2YREA 2CSZA 3MUKA 4NR7A 4TYLA 5FE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7A A;  2DAT A;  3DAI A;  2G43 A;  4PY6 A;  2WP2 A;  4UIY A;  2KFT A;  4J3I A;  3O35 A;  4CLB A;  2VPD A;  5ENG A;  4NS5 A;  5ETD A;  4IC2 A;  4NUD A;  2L0B A;  4W4U A;  4NYV A;  4WZ0 A;  4MR6 A;  5C87 A;  2OSS A;  5KTX A;  4CUT A;  1MM3 A;  4AYC A;  5I3L A;  3LJW A;  5CUC A;  2YQL A;  4XY8 A;  2E6R A;  2RSD A;  5HRW A;  5DW1 A;  5DFB A;  1EQF A;  2OO1 A;  4N4G A;  4O7B A;  5EP7 A;  4Y03 A;  4A9F A;  4MEO A;  5CUG A;  2H0D B;  4X3G A;  5CQA A;  3MXF A;  5J0D A;  4MR4 A;  4YYM A;  2HDP A;  5C11 A;  5CUD A;  2C2L A;  4O76 A;  5F3A A;  5C8G A;  4GNE A;  3L1Z B;  2DVS A;  5KO4 A;  2OUO A;  4O78 A;  5FG6 A;  1HYI A;  2RNY A;  3P5O A;  2LGG A;  2YEK A;  5E9M A;  4QC3 A;  5FE2 A;  2LRI C;  4P5O B;  4XUA A;  5ENJ A;  5EPB A;  2YQD A;  5FB1 A;  5HLS A;  3ONI A;  5A5N A;  4QF3 A;  4ZDT A;  2KYU A;  2MT5 A;  4B7Y C;  3N9N A;  4QSR A;  3V43 A;  5C13 A;  2L80 A;  1WEU A;  5HCL A;  4FO9 A;  5I88 A;  4UIV A;  4QYD A;  4A9E A;  4AUQ B;  5A83 A;  2LQ6 A;  5DKC A;  4A9N A;  3EB6 A;  4YBT A;  2YSM A;  2MIQ A;  1N72 A;  4ZUX U;  3DQV R;  2LV9 A;  3C5K A;  4AYC B;  3O7A A;  4GNG A;  3MUL A;  2DX8 A;  3LQJ A;  4UP0 A;  4BHW A;  2G4A A;  4L58 A;  2L84 A;  5COI A;  5CFW A;  5E9V A;  5HM0 A;  4Z6H A;  2G45 A;  5CQ8 A;  4UYF B;  1Z6U A;  4O7E A;  5K29 A;  5E3D A;  2WP1 A;  4UYH A;  2E7O A;  5FE6 A;  5F63 A;  4BJX A;  4YK0 A;  4HXN A;  4PCI A;  4QR5 A;  4QUT A;  4F3I A;  2K17 A;  5HFR A;  4YAB A;  1G25 A;  2MJV B;  2KWN A;  5CUB A;  3SVF A;  5EI4 A;  2F6J A;  2L43 A;  4A9L A;  5CS8 A;  2OXQ C;  5LKZ A;  3MQM A;  4PTB A;  4NXJ A;  5ETB A;  5IGN A;  2NAA A;  3P1D A;  4ALG A;  2LN0 A;  4CUP A;  3L1X A;  3N9Q A;  2FUI A;  4YYH A;  2YW5 A;  3AQA A;  1K2F A;  1MM2 A;  4UYG A;  5A5O A;  2ZET C;  5J3X A;  2KTB B;  4HBV A;  4Z93 A;  5I86 A;  5D7X A;  3JVJ A;  2VPG A;  3ZPV 1;  4QEU A;  5E3G A;  5LJ1 A;  1RMD A;  5CPE A;  4TU4 A;  4YH4 A;  2XB1 A;  2I8N A;  4O70 A;  4WIV A;  5F1L A;  1CHC A;  4LJN A;  5CQ7 A;  3HMF A;  2Y1N A;  3LQH A;  4LYW A;  2ECW A;  5F60 A;  4TT4 A;  4NR8 A;  1WUG A;  2MA6 A;  3M63 A;  4N3W A;  1U6G B;  1WEO A;  5CQ4 A;  5FE1 A;  4Z1Q A;  2EA6 A;  1WES A;  2LSP B;  5CTL A;  5DY7 A;  4E96 A;  5L97 A;  3O70 A;  2R0S A;  5CGP A;  5F25 A;  4HBW A;  5LVQ A;  1FP0 A;  4UYD A;  4IOR A;  4AKN A;  4UIT A;  4Z6I A;  4BW2 A;  4O7F A;  4UIW A;  5EWC A;  4O77 A;  1E4U A;  5CRM A;  2QIZ A;  5G4S A;  4A9K A;  4LAD B;  2MA5 A;  4A9I A;  4A9H A;  2JRJ A;  2JMD A;  4PPE A;  2VJF B;  5TAB A;  1X0J A;  5FH6 A;  1WIL A;  4O72 A;  2G6Q A;  4NR6 A;  1WGM A;  3DPL R;  3VK6 A;  5E73 A;  3U5P A;  4PS5 A;  2LXP C;  5A85 A;  4HXL A;  3O34 A;  4YY6 A;  5TRB A;  3RPG B;  5EPS A;  5I29 A;  5HFQ A;  4BW3 A;  3DWY A;  3O33 A;  3UW9 A;  2ECN A;  4I7C A;  3U5O A;  4HXM A;  1WE9 A;  5FBX A;  4UIX A;  3MB4 A;  4B86 C;  2NXB A;  2KWJ A;  4NR9 A;  4A9O A;  3O36 A;  4Q6F A;  3N9L A;  4QSS A;  5LKU A;  3S91 A;  3K2J A;  4FJC A;  2D9E A;  2YDW A;  5FFV A;  5LJ2 A;  5B76 A;  4O71 A;  4KCX A;  4QZS A;  1WEM A;  5HQ5 A;  3ZVY A;  4A49 A;  4OGI A;  2LDR A;  5CU8 A;  2QIC A;  3P1F A;  4DON A;  2FUU A;  4QUU A;  4CCG X;  1E6I A;  1DVP A;  4QSP A;  3QZT A;  5FE9 A;  3SOX A;  3SOU A;  4MEP A;  3NG2 A;  5C85 A;  5FB0 A;  1FBV A;  3FL2 A;  4A9M A;  5TDW A;  3ZVZ B;  4A4B A;  3QZS A;  5EU1 A;  4PKL A;  3NXB A;  3AAD A;  2E6S A;  4QR3 A;  4YBS A;  5HRX A;  4TQN A;  5D3P A;  4NR4 A;  2RO1 A;  2QJ0 A;  3N9P A;  4HXO A;  3N9O A;  1WFK A;  2M6M A;  5G4R A;  3HCT A;  3ZNI A;  5E9K A;  2M3H A;  4C66 A;  4S3O B;  4HBY A;  4LRG A;  2MD7 B;  5FER A;  4HXR A;  3ZPV E;  5D3S A;  4L7X A;  3LRQ A;  1VD4 A;  3UVD A;  5A5S A;  2FSA A;  4HXP A;  1IYM A;  5I7X A;  3N9M A;  1LDK C;  4XUB A;  5KH3 A;  5DYX A;  4LK9 A;  5G05 B;  4RVR A;  5EYA F;  5HQ7 A;  5ENI A;  5KU3 A;  2L5E A;  2YUC A;  5I80 A;  2R0V A;  2RI7 A;  5HRV A;  4TS8 A;  5TCM A;  4TKP B;  5DLX A;  2JMI A;  5LVR A;  5IBN A;  2D82 A;  4LDF A;  2DKW A;  5CP5 A;  2MD8 C;  5ACY A;  5D3T A;  2YSJ A;  3MHS A;  2MNZ A;  5A82 A;  3RPG C;  5D3J A;  5F2P A;  4V3L C;  2GRC A;  2DWW A;  4LZR A;  5E74 A;  4LZS A;  1WEV A;  4LYI A;  5ENC A;  5B77 A;  5D3R A;  2YHN A;  5ENH A;  5B79 A;  4MR3 A;  5AME A;  3UV4 A;  4QBM A;  5E9Y A;  4O7C A;  4IOQ A;  4N4H A;  3M62 A;  2L85 A;  5C89 A;  2YEL A;  5G04 B;  5HEM A;  5LKT A;  4NQM A;  5EWW A;  5FDZ A;  5FE8 A;  4UYE A;  5HEN A;  3IU6 A;  5E9L A;  4QYL A;  4WA6 A;  4UIU A;  5FFY A;  3O37 A;  5CQ6 A;  5D3N A;  2VP7 A;  2RS9 B;  4HXK A;  5L96 A;  3KQI A;  5H1U A;  5I40 A;  2F42 A;  4TT2 A;  5A81 A;  5DFD A;  4QB3 A;  4YC9 A;  2DVQ A;  5CUA A;  5HEL A;  5C7N A;  4IR3 A;  1X4J A;  5D1M B;  4MEN A;  5TBN A;  4WHU A;  3KV5 A;  5I83 A;  2VPE A;  4CFL A;  4UP5 A;  3RCW A;  2ECV A;  5AIU A;  5L8U A;  4WZ2 A;  4XYA A;  5KHM A;  4HBX A;  5FE3 A;  3GV4 A;  3PUQ A;  3GG3 A;  4MSX A;  3RTR B;  4R7E A;  3JVL A;  5CQT A;  5I7Y A;  5EK9 A;  4ZC9 A;  4XY9 A;  2C2V S;  1JOC A;  5DKA A;  4LR6 A;  4N4F A;  1V87 A;  4AP4 A;  1WEN A;  3PHD A;  3I2D A;  5DIN A;  5D3L A;  4C67 A;  3IU5 A;  4CUS A;  5F61 A;  1JSP B;  2I50 A;  3IHP A;  5FG5 A;  3HMH A;  5JWM A;  5DYA A;  5A5P A;  5BT4 A;  4O64 A;  4BBQ A;  4UI9 B;  4CL9 A;  4S3O C;  3Q2F A;  3U5K A;  3HTK C;  5DYU A;  2KWK A;  5E0R A;  5CQ3 A;  3UVW A;  5EVA A;  2UZG A;  3HCU A;  4QY4 A;  4NYW A;  4O75 A;  4IC3 A;  4YBM A;  2AN6 A;  5H1V A;  4FK5 A;  5D0C A;  3ZTG A;  5ENF A;  4YAT A;  3L11 A;  5A7C A;  5CZG A;  1JM4 B;  2F6N A;  1XWH A;  2KE1 A;  3KV6 A;  5B78 A;  1X4I A;  4QST A;  4QSW A;  3MB3 A;  2LGK A;  5LCW B;  3FKM X;  5F5Z A;  5FFW A;  2KGI A;  4NRA A;  5EGU A;  2MNY A;  4OUF A;  1ZS5 A;  4QNS A;  1VYX A;  5FG4 A;  2ECJ A;  5DBM A;  4PCE A;  5B75 A;  4C9Z A;  4TZ8 A;  1F68 A;  3TLP A;  3ZYQ A;  3UV2 A;  2H60 A;  5DX4 A;  5ENB A;  2YQM A;  2E3K A;  5C4Q A;  5DYC A;  4YH3 A;  5A5Q A;  2VNF A;  5D1L B;  2M1R A;  1WEW A;  3M99 A;  2JMJ A;  4ZQL A;  5I89 A;  4NN2 A;  5LUU A;  2K4D A;  2LGL A;  2MUM A;  2VJE A;  4IR5 A;  3ZYU A;  3ASL A;  4NRC A;  5IGL A;  4QEW A;  2Y43 A;  1X4U A;  3T6R A;  5L98 A;  3UVX A;  5AMF A;  5EIS A;  1ZBD B;  3U5N A;  4TU6 A;  5A5R A;  4NUC A;  2RNX A;  5TB6 A;  4CFK A;  5CY9 A;  5EWD A;  4IR6 A;  4CUR A;  2I7K A;  1WEP A;  4J0R A;  4UIZ A;  2EGP A;  4NR5 A;  5DFC A;  2BAY A;  1LDJ B;  2E7N A;  4UYF A;  3UV5 A;  3SVH A;  5IG6 A;  5EWV A;  3G0J A;  4FLP A;  5EWH A;  4NRB A;  5HJC A;  5L8T A;  4Q0N A;  2PUY A;  5DKH A;  5F36 A;  4YYD A;  2RNW A;  5AD2 A;  2KRE A;  2DVR A;  4GNF A;  4A0C D;  2CKL A;  5LKX A;  2N9G A;  4MR5 A;  5D26 A;  4YAD A;  3P1E A;  5KH7 A;  4QSX A;  2IDA A;  2VJE B;  2YU4 A;  3HCS A;  3JVM A;  4AVX A;  3GL6 A;  5AD3 A;  5CRZ A;  4I7B A;  5H9M A;  4YAX A;  5JG6 A;  3U5J A;  4LZ2 A;  2YUR A;  5FH8 A;  4GB0 A;  2EOD A;  3D7C A;  5H1T A;  2YT5 A;  2XEU A;  2YW8 A;  3U5L A;  4A9J A;  3HME A;  4YYJ A;  1T1H A;  4QSU A;  2KIZ A;  4YYG A;  2CT2 A;  3LQI A;  4WZ3 B;  3UVY A;  3SOW A;  3EB5 A;  5DLZ A;  4NYX A;  4CUU A;  4R8P K;  4LYS A;  2DVV A;  4Q0O A;  5EIC A;  1JM7 A;  3Q2E A;  5D3H A;  5BT5 A;  2RFJ A;  4YYN A;  5KTU A;  3G0L A;  5FE7 A;  4LLB A;  4I7D A;  5D24 A;  5F62 A;  2KWO A;  4TT6 A;  2ECG A;  5E7D A;  1N87 A;  4X2I A;  2Y1M A;  4YYI A;  3MHH A;  2CKL B;  3LXJ A;  5KTW A;  3KNV A;  4FIP A;  4WHW A;  5HQ6 A;  2KR4 A;  3P1C A;  4QF2 A;  5FEY A;  5EA1 A;  4QSQ A;  4CUQ A;  4BW1 A;  5H85 A;  5G0F A;  4LKA A;  2VJF A;  5JI8 A;  5L99 A;  5D1K B;  5D25 A;  2YYN A;  1WEQ A;  4KV1 A;  4BW4 A;  3C6W A;  3JVK A;  5EQ1 A;  5FE5 A;  1HYJ A;  4IR4 A;  3PUR A;  4ALH A;  4ZW1 A;  2ECT A;  4QEV A;  1VFY A;  1WUM A;  2R0Y A;  5AIT A;  2KGG A;  4HXS A;  2HYE D;  2M85 A;  2LGV A;  3T7L A;  4J0S A;  4GND A;  2L5U A;  4NUE A;  5II1 A;  4GPJ A;  1JM7 B;  1F62 A;  5IGK A;  4QR4 A;  5II2 A;  3QZV A;  1Z60 A;  5ENE A;  5I1Q A;  4TTE A;  4XI1 A;  4F52 B;  4LC2 A;  1Z2Q A;  2CSY A;  5FH7 A;  4O74 A;  4OGJ A;  4IOO A;  5FE4 A;  5IGM A;  4V3K C;  3I3J A;  5EM3 A;  2YYR A;  4YY4 A;  2LXH C;  4TZ2 A;  4YYK A;  5EV9 A;  5DKD A;  5E9I A;  5CQ5 A;  5EPR A;  5TDR A;  1WIM A;  5DW2 A;  2VPB A;  2PNX A;  3SHB A;  1WEE A;  2L75 A;  3U5M A;  2KU3 A;  2H0D A;  5LJ0 A;  4A4C A;  4R2Y A;  2K16 A;  1BOR A;  2K1J A;  2ECI A;  4MEQ A;  5IID A;  4KV4 A;  5B8D A;  4QSV A;  2R10 A;  5F1H A;  2D8S A;  4N4I A;  4J1P A;  3SVG A;  2YHO A;  4MVT A;  5KH9 A;  4QC1 A;  5CUE A;  3S92 A;  2YEM A;  4NQN A;  4CA1 A;  4Z1S A;  5BT3 A;  2YRE A;  2CSZ A;  3MUK A;  4NR7 A;  4TYL A;  5FE0 A; 
#chains in the Genus database with same CATH topology
 4O7A A;  2DAT A;  3DAI A;  2G43 A;  4PY6 A;  2WP2 A;  4UIY A;  2KFT A;  4J3I A;  3O35 A;  4CLB A;  2VPD A;  5ENG A;  4NS5 A;  5ETD A;  4IC2 A;  4NUD A;  2L0B A;  4W4U A;  4NYV A;  4WZ0 A;  4MR6 A;  5C87 A;  2OSS A;  5KTX A;  4CUT A;  1MM3 A;  3FEH A;  4AYC A;  5I3L A;  3LDY A;  3LJW A;  5CUC A;  2YQL A;  4XY8 A;  2E6R A;  2RSD A;  5HRW A;  5DW1 A;  5DFB A;  1EQF A;  2OO1 A;  4N4G A;  4O7B A;  5EP7 A;  4Y03 A;  4A9F A;  4MEO A;  5CUG A;  2H0D B;  4X3G A;  5CQA A;  3MXF A;  5J0D A;  4MR4 A;  4YYM A;  2HDP A;  3H7H A;  5C11 A;  5CUD A;  2C2L A;  4Z0R A;  3DWD A;  4O76 A;  5F3A A;  5C8G A;  4GNE A;  3L1Z B;  2DVS A;  5KO4 A;  2OUO A;  4O78 A;  5FG6 A;  1HYI A;  2RNY A;  3P5O A;  2LGG A;  2YEK A;  5E9M A;  4QC3 A;  5FE2 A;  2LRI C;  4P5O B;  4XUA A;  5ENJ A;  5EPB A;  2YQD A;  5FB1 A;  5HLS A;  3ONI A;  5A5N A;  4QF3 A;  4ZDT A;  2KYU A;  2MT5 A;  4B7Y C;  3N9N A;  4QSR A;  3V43 A;  5C13 A;  2L80 A;  1WEU A;  5HCL A;  2XOZ A;  4FO9 A;  5I88 A;  4UIV A;  4QYD A;  4A9E A;  4AUQ B;  5A83 A;  2LQ6 A;  5DKC A;  4A9N A;  3EB6 A;  2KKX A;  4YBT A;  2YSM A;  2MIQ A;  1N72 A;  4ZUX U;  3DQV R;  2LV9 A;  3C5K A;  4AYC B;  3O7A A;  4GNG A;  3MUL A;  2DX8 A;  3LQJ A;  4UP0 A;  2IQJ A;  4BHW A;  2G4A A;  1MBM A;  4L58 A;  2L84 A;  5COI A;  5CFW A;  3SUB A;  5E9V A;  5HM0 A;  4Z6H A;  2G45 A;  5CQ8 A;  4UYF B;  1Z6U A;  4O7E A;  5K29 A;  5E3D A;  2WP1 A;  4UYH A;  2E7O A;  5FE6 A;  5F63 A;  4BJX A;  4YK0 A;  4HXN A;  4PCI A;  4QR5 A;  4QUT A;  4F3I A;  2K17 A;  3VKH A;  5HFR A;  4YAB A;  1G25 A;  2MJV B;  2KWN A;  5CUB A;  3SVF A;  5EI4 A;  2F6J A;  2L43 A;  4A9L A;  5CS8 A;  2OXQ C;  5K3Q A;  5LKZ A;  3MQM A;  4PTB A;  2YVR A;  4NXJ A;  5ETB A;  5IGN A;  2NAA A;  3P1D A;  4ALG A;  2LN0 A;  4CUP A;  3L1X A;  3N9Q A;  2FUI A;  4YYH A;  2YW5 A;  3AQA A;  1K2F A;  1MM2 A;  4UYG A;  5A5O A;  2ZET C;  5J3X A;  2KTB B;  4HBV A;  4Z93 A;  5I86 A;  5D7X A;  3JVJ A;  2VPG A;  3ZPV 1;  4QEU A;  5E3G A;  5LJ1 A;  1RMD A;  5CPE A;  4TU4 A;  4YH4 A;  2OWA A;  2XB1 A;  2I8N A;  4O70 A;  4WIV A;  5F1L A;  1CHC A;  4LJN A;  5CQ7 A;  3DDT A;  3HMF A;  2Y1N A;  3LQH A;  4LYW A;  2ECW A;  5F60 A;  4TT4 A;  4NR8 A;  1WUG A;  2MA6 A;  2CON A;  4N3W A;  1U6G B;  3M63 A;  1WEO A;  5CQ4 A;  5FE1 A;  4Z1Q A;  2EA6 A;  1WES A;  2LSP B;  5CTL A;  5DY7 A;  4E96 A;  5L97 A;  3O70 A;  2R0S A;  5CGP A;  5F25 A;  4HBW A;  5LVQ A;  1FP0 A;  4UYD A;  2RR4 A;  4IOR A;  4AKN A;  4UIT A;  3E2D A;  3FAN A;  4Z6I A;  4BW2 A;  4O7F A;  4AKG A;  4UIW A;  5EWC A;  4O77 A;  1E4U A;  5CRM A;  2QIZ A;  5G4S A;  4A9K A;  4LAD B;  2MA5 A;  4A9I A;  4A9H A;  2JRJ A;  2JMD A;  4PPE A;  2VJF B;  5TAB A;  3KDE C;  1X0J A;  5FH6 A;  1WIL A;  4QQ4 A;  4O72 A;  2G6Q A;  4NR6 A;  1WGM A;  3DPL R;  3VK6 A;  5E73 A;  3U5P A;  4PS5 A;  2LXP C;  5A85 A;  4HXL A;  3O34 A;  4YY6 A;  5TRB A;  3RPG B;  5EPS A;  5I29 A;  5HFQ A;  4BW3 A;  3DWY A;  3O33 A;  3UW9 A;  2ECN A;  4I7C A;  3U5O A;  4HXM A;  1WE9 A;  5FBX A;  3ERR A;  4UIX A;  2L7P A;  3MB4 A;  4B86 C;  2NXB A;  2KWJ A;  1DCQ A;  4NR9 A;  4A9O A;  3O36 A;  4Q6F A;  3N9L A;  4QSS A;  5LKU A;  3S91 A;  3K2J A;  4FJC A;  3LJU X;  2D9E A;  2YDW A;  5FFV A;  5LJ2 A;  5B76 A;  4O71 A;  4KCX A;  4QZS A;  1WEM A;  5HQ5 A;  3ZVY A;  2XOY A;  4A49 A;  4OGI A;  2LDR A;  5CU8 A;  2QIC A;  3P1F A;  4DON A;  2FUU A;  4QUU A;  4CCG X;  1E6I A;  1DVP A;  4QSP A;  3QZT A;  5FE9 A;  3SOX A;  3D1B A;  4MEP A;  3NG2 A;  3SOU A;  3M7K A;  5C85 A;  5FB0 A;  1FBV A;  3FL2 A;  4A9M A;  5TDW A;  3ZVZ B;  4A4B A;  3QZS A;  5EU1 A;  4PKL A;  3NXB A;  3AAD A;  2E6S A;  4QR3 A;  4YBS A;  5HRX A;  4TQN A;  5D3P A;  4AKI A;  4NR4 A;  2RO1 A;  2QJ0 A;  3N9P A;  4HXO A;  3N9O A;  1WFK A;  2M6M A;  5G4R A;  3HCT A;  3ZNI A;  5E9K A;  2M3H A;  3LVR E;  4C66 A;  2MKE A;  4S3O B;  4HBY A;  4LRG A;  2MD7 B;  5FER A;  4HXR A;  3ZPV E;  5D3S A;  4L7X A;  3LRQ A;  1VD4 A;  3UVD A;  5A5S A;  2FSA A;  4HXP A;  1IYM A;  5I7X A;  3VKG A;  1LDK C;  4XUB A;  3N9M A;  5DYX A;  4LK9 A;  5G05 B;  4RVR A;  5KH3 A;  5EYA F;  5HQ7 A;  5ENI A;  5KU3 A;  2L5E A;  2YUC A;  5I80 A;  2R0V A;  2RI7 A;  5HRV A;  4TS8 A;  5TCM A;  4TKP B;  5DLX A;  2JMI A;  5LVR A;  5IBN A;  2D82 A;  4LDF A;  2DKW A;  4OGC A;  5CP5 A;  2MD8 C;  2EGM A;  5ACY A;  5D3T A;  2YSJ A;  3MHS A;  2MNZ A;  5A82 A;  3RPG C;  5D3J A;  5F2P A;  4V3L C;  2GRC A;  2DWW A;  4LZR A;  2DSM A;  5E74 A;  4LZS A;  1WEV A;  4LYI A;  4Z0O A;  5ENC A;  5B77 A;  5D3R A;  2YHN A;  5ENH A;  5B79 A;  4MR3 A;  5AME A;  3UV4 A;  4QBM A;  5E9Y A;  4O7C A;  4IOQ A;  4N4H A;  3M62 A;  2L85 A;  5C89 A;  2YEL A;  5G04 B;  5HEM A;  5LKT A;  4NQM A;  5EWW A;  5FDZ A;  5FE8 A;  4UYE A;  5HEN A;  3IU6 A;  5E9L A;  4QYL A;  4WA6 A;  4UIU A;  5FFY A;  3O37 A;  5CQ6 A;  5D3N A;  2VP7 A;  2RS9 B;  4HXK A;  5L96 A;  3KQI A;  5H1U A;  5I40 A;  2F42 A;  2CRW A;  4TT2 A;  5A81 A;  1PUO A;  4QB3 A;  4YC9 A;  2DVQ A;  5CUA A;  5DFD A;  5HEL A;  5C7N A;  4IR3 A;  1X4J A;  5D1M B;  4MEN A;  5TBN A;  4WHU A;  3KV5 A;  5I83 A;  2VPE A;  2XP0 A;  4CFL A;  5SVI A;  4UP5 A;  3RCW A;  2ECV A;  5AIU A;  5L8U A;  4WZ2 A;  4XYA A;  5KHM A;  4HBX A;  5FE3 A;  3GV4 A;  3PUQ A;  3GG3 A;  4MSX A;  3RTR B;  4R7E A;  3JVL A;  5CQT A;  5I7Y A;  5EK9 A;  4ZC9 A;  4XY9 A;  2C2V S;  3O47 A;  1JOC A;  5DKA A;  4LR6 A;  4N4F A;  1V87 A;  3MDB C;  3T9K A;  4AP4 A;  1WEN A;  3PHD A;  3I2D A;  5DIN A;  5D3L A;  4C67 A;  3IU5 A;  4CUS A;  5F61 A;  1JSP B;  2I50 A;  3IHP A;  5FG5 A;  3HMH A;  5JWM A;  5DYA A;  5A5P A;  5BT4 A;  4O64 A;  4BBQ A;  4UI9 B;  4CL9 A;  4S3O C;  3Q2F A;  3U5K A;  3HTK C;  5DYU A;  2KWK A;  5E0R A;  5CQ3 A;  3UVW A;  2M13 A;  5EVA A;  2UZG A;  3HCU A;  4QY4 A;  2XOC A;  4NYW A;  4O75 A;  4IC3 A;  4YBM A;  2AN6 A;  5H1V A;  4FK5 A;  5D0C A;  3ZTG A;  5ENF A;  4YAT A;  3L11 A;  5A7C A;  5CZG A;  1JM4 B;  2F6N A;  1XWH A;  2KE1 A;  3KV6 A;  5B78 A;  1X4I A;  4QST A;  4QSW A;  3MB3 A;  2LGK A;  5LCW B;  3FKM X;  5F5Z A;  5FFW A;  2KGI A;  4NRA A;  5EGU A;  2MNY A;  4F1P A;  4OUF A;  1ZS5 A;  4QNS A;  1VYX A;  5FG4 A;  2ECJ A;  5DBM A;  4PCE A;  5B75 A;  4C9Z A;  4TZ8 A;  1F68 A;  3TLP A;  3ZYQ A;  3UV2 A;  2H60 A;  2CSV A;  5DX4 A;  5ENB A;  2YQM A;  2E3K A;  5C4Q A;  5DYC A;  4YH3 A;  5A5Q A;  2VNF A;  5D1L B;  2M1R A;  1WEW A;  3M99 A;  2JMJ A;  4ZQL A;  5I89 A;  4NN2 A;  5LUU A;  2K4D A;  2LGL A;  2MUM A;  2VJE A;  4IR5 A;  3ZYU A;  3ASL A;  4NRC A;  5IGL A;  4OGE A;  4QEW A;  2EJN A;  3D1D A;  2Y43 A;  1X4U A;  3T6R A;  5L98 A;  3UVX A;  2P57 A;  5AMF A;  5EIS A;  1ZBD B;  3U5N A;  4TU6 A;  5A5R A;  4NUC A;  2RNX A;  5TB6 A;  4CFK A;  5CY9 A;  5EWD A;  4AKH A;  3FJU B;  4IR6 A;  4CUR A;  2I7K A;  1WEP A;  4J0R A;  4UIZ A;  2EGP A;  4NR5 A;  5DFC A;  2BAY A;  1LDJ B;  2E7N A;  4UYF A;  3UV5 A;  3SVH A;  2E61 A;  3FM8 C;  5IG6 A;  5EWV A;  3G0J A;  4FLP A;  5EWH A;  4NRB A;  5HJC A;  5L8T A;  4H9D A;  4Q0N A;  2PUY A;  5DKH A;  5F36 A;  4YYD A;  2RNW A;  5AD2 A;  2KRE A;  2DVR A;  2LAU A;  4GNF A;  2CKL A;  4A0C D;  5LKX A;  2N9G A;  2DJA A;  4MR5 A;  5D26 A;  4YAD A;  3P1E A;  2D8U A;  2CRR A;  5KH7 A;  4QSX A;  2IDA A;  2VJE B;  2YU4 A;  3HCS A;  3JVM A;  2KKY A;  4AVX A;  3GL6 A;  5AD3 A;  5CRZ A;  4I7B A;  4AI6 A;  5H9M A;  2B0O E;  4YAX A;  5JG6 A;  3U5J A;  4LZ2 A;  2YUR A;  5FH8 A;  4GB0 A;  2EOD A;  3D7C A;  5H1T A;  2YT5 A;  2XEU A;  2YW8 A;  3U5L A;  4A9J A;  3HME A;  4YYJ A;  3FAO A;  1T1H A;  4QSU A;  2KIZ A;  4YYG A;  2CT2 A;  3LQI A;  4WZ3 B;  3UVY A;  3SOW A;  3EB5 A;  5DLZ A;  4NYX A;  4CUU A;  4R8P K;  4LYS A;  2DVV A;  4Q0O A;  5EIC A;  1JM7 A;  3Q2E A;  5D3H A;  5BT5 A;  2RFJ A;  4YYN A;  5SVY A;  5KTU A;  3G0L A;  5FE7 A;  3PLW A;  4LLB A;  4I7D A;  5D24 A;  5F62 A;  2KWO A;  4TT6 A;  2ECG A;  5E7D A;  1N87 A;  4X2I A;  2Y1M A;  4YYI A;  3MHH A;  2CKL B;  3LXJ A;  5KTW A;  3KNV A;  4FIP A;  4WHW A;  5HQ6 A;  2KR4 A;  3P1C A;  4QF2 A;  5FEY A;  5EA1 A;  4QSQ A;  4CUQ A;  4BW1 A;  5H85 A;  5G0F A;  4LKA A;  2VJF A;  5JI8 A;  5L99 A;  2JUN A;  5D1K B;  5D25 A;  2YYN A;  1WEQ A;  4KV1 A;  4BW4 A;  3C6W A;  3JVK A;  5EQ1 A;  5FE5 A;  1HYJ A;  4IR4 A;  3PUR A;  4ALH A;  4ZW1 A;  2ECT A;  4QEV A;  1VFY A;  1WUM A;  2R0Y A;  5AIT A;  2KGG A;  4HXS A;  2HYE D;  2M85 A;  2LGV A;  3T7L A;  4J0S A;  4GND A;  2L5U A;  4NUE A;  5II1 A;  4GPJ A;  1JM7 B;  1F62 A;  5IGK A;  4QR4 A;  5II2 A;  3QZV A;  1Z60 A;  5ENE A;  5I1Q A;  4TTE A;  4XI1 A;  4F52 B;  4LC2 A;  1Z2Q A;  2CSY A;  5FH7 A;  4O74 A;  4OGJ A;  4IOO A;  5FE4 A;  5IGM A;  4V3K C;  3I3J A;  5EM3 A;  2YYR A;  4YY4 A;  2LXH C;  3JUE A;  4TZ2 A;  4YYK A;  5EV9 A;  5DKD A;  5E9I A;  5CQ5 A;  5EPR A;  5SVI B;  5TDR A;  1WIM A;  5SVX A;  2FD4 A;  5DW2 A;  2JM3 A;  2VPB A;  2PNX A;  3SHB A;  1WEE A;  2L75 A;  3U5M A;  2KU3 A;  3Q1D A;  2H0D A;  5LJ0 A;  4A4C A;  2FFW A;  4R2Y A;  2K16 A;  1BOR A;  2K1J A;  2ECI A;  3LVQ E;  4MEQ A;  5IID A;  4KV4 A;  2EXU A;  5B8D A;  4QSV A;  2R10 A;  5F1H A;  2D8S A;  4N4I A;  4J1P A;  4O62 A;  3SVG A;  2YHO A;  4MVT A;  5KH9 A;  4QC1 A;  5CUE A;  3S92 A;  2YEM A;  4NQN A;  4CA1 A;  4Z1S A;  5BT3 A;  1ZKR A;  2YRE A;  2CSZ A;  3MUK A;  4NR7 A;  4TYL A;  5FE0 A; 
#chains in the Genus database with same CATH homology
 4O7A A;  2DAT A;  3DAI A;  2G43 A;  4PY6 A;  2WP2 A;  4UIY A;  2KFT A;  4J3I A;  3O35 A;  4CLB A;  2VPD A;  5ENG A;  4NS5 A;  5ETD A;  4IC2 A;  4NUD A;  2L0B A;  4W4U A;  4NYV A;  4WZ0 A;  4MR6 A;  5C87 A;  2OSS A;  5KTX A;  4CUT A;  1MM3 A;  4AYC A;  5I3L A;  3LJW A;  5CUC A;  2YQL A;  4XY8 A;  2E6R A;  2RSD A;  5HRW A;  5DW1 A;  5DFB A;  1EQF A;  2OO1 A;  4N4G A;  4O7B A;  5EP7 A;  4Y03 A;  4A9F A;  4MEO A;  5CUG A;  2H0D B;  4X3G A;  5CQA A;  3MXF A;  5J0D A;  4MR4 A;  4YYM A;  2HDP A;  5C11 A;  5CUD A;  2C2L A;  4O76 A;  5F3A A;  5C8G A;  4GNE A;  3L1Z B;  2DVS A;  5KO4 A;  2OUO A;  4O78 A;  5FG6 A;  1HYI A;  2RNY A;  3P5O A;  2LGG A;  2YEK A;  5E9M A;  4QC3 A;  5FE2 A;  2LRI C;  4P5O B;  4XUA A;  5ENJ A;  5EPB A;  2YQD A;  5FB1 A;  5HLS A;  3ONI A;  5A5N A;  4QF3 A;  4ZDT A;  2KYU A;  2MT5 A;  4B7Y C;  3N9N A;  4QSR A;  3V43 A;  5C13 A;  2L80 A;  1WEU A;  5HCL A;  4FO9 A;  5I88 A;  4UIV A;  4QYD A;  4A9E A;  4AUQ B;  5A83 A;  2LQ6 A;  5DKC A;  4A9N A;  3EB6 A;  4YBT A;  2YSM A;  2MIQ A;  1N72 A;  4ZUX U;  3DQV R;  2LV9 A;  3C5K A;  4AYC B;  3O7A A;  4GNG A;  3MUL A;  2DX8 A;  3LQJ A;  4UP0 A;  4BHW A;  2G4A A;  4L58 A;  2L84 A;  5COI A;  5CFW A;  5E9V A;  5HM0 A;  4Z6H A;  2G45 A;  5CQ8 A;  4UYF B;  1Z6U A;  4O7E A;  5K29 A;  5E3D A;  2WP1 A;  4UYH A;  2E7O A;  5FE6 A;  5F63 A;  4BJX A;  4YK0 A;  4HXN A;  4PCI A;  4QR5 A;  4QUT A;  4F3I A;  2K17 A;  5HFR A;  4YAB A;  1G25 A;  2MJV B;  2KWN A;  5CUB A;  3SVF A;  5EI4 A;  2F6J A;  2L43 A;  4A9L A;  5CS8 A;  2OXQ C;  5LKZ A;  3MQM A;  4PTB A;  4NXJ A;  5ETB A;  5IGN A;  2NAA A;  3P1D A;  4ALG A;  2LN0 A;  4CUP A;  3L1X A;  3N9Q A;  2FUI A;  4YYH A;  2YW5 A;  3AQA A;  1K2F A;  1MM2 A;  4UYG A;  5A5O A;  2ZET C;  5J3X A;  2KTB B;  4HBV A;  4Z93 A;  5I86 A;  5D7X A;  3JVJ A;  2VPG A;  3ZPV 1;  4QEU A;  5E3G A;  5LJ1 A;  1RMD A;  5CPE A;  4TU4 A;  4YH4 A;  2XB1 A;  2I8N A;  4O70 A;  4WIV A;  5F1L A;  1CHC A;  4LJN A;  5CQ7 A;  3HMF A;  2Y1N A;  3LQH A;  4LYW A;  2ECW A;  5F60 A;  4TT4 A;  4NR8 A;  1WUG A;  2MA6 A;  3M63 A;  4N3W A;  1U6G B;  1WEO A;  5CQ4 A;  5FE1 A;  4Z1Q A;  2EA6 A;  1WES A;  2LSP B;  5CTL A;  5DY7 A;  4E96 A;  5L97 A;  3O70 A;  2R0S A;  5CGP A;  5F25 A;  4HBW A;  5LVQ A;  1FP0 A;  4UYD A;  4IOR A;  4AKN A;  4UIT A;  4Z6I A;  4BW2 A;  4O7F A;  4UIW A;  5EWC A;  4O77 A;  1E4U A;  5CRM A;  2QIZ A;  5G4S A;  4A9K A;  4LAD B;  2MA5 A;  4A9I A;  4A9H A;  2JRJ A;  2JMD A;  4PPE A;  2VJF B;  5TAB A;  1X0J A;  5FH6 A;  1WIL A;  4O72 A;  2G6Q A;  4NR6 A;  1WGM A;  3DPL R;  3VK6 A;  5E73 A;  3U5P A;  4PS5 A;  2LXP C;  5A85 A;  4HXL A;  3O34 A;  4YY6 A;  5TRB A;  3RPG B;  5EPS A;  5I29 A;  5HFQ A;  4BW3 A;  3DWY A;  3O33 A;  3UW9 A;  2ECN A;  4I7C A;  3U5O A;  4HXM A;  1WE9 A;  5FBX A;  4UIX A;  3MB4 A;  4B86 C;  2NXB A;  2KWJ A;  4NR9 A;  4A9O A;  3O36 A;  4Q6F A;  3N9L A;  4QSS A;  5LKU A;  3S91 A;  3K2J A;  4FJC A;  2D9E A;  2YDW A;  5FFV A;  5LJ2 A;  5B76 A;  4O71 A;  4KCX A;  4QZS A;  1WEM A;  5HQ5 A;  3ZVY A;  4A49 A;  4OGI A;  2LDR A;  5CU8 A;  2QIC A;  3P1F A;  4DON A;  2FUU A;  4QUU A;  4CCG X;  1E6I A;  1DVP A;  4QSP A;  3QZT A;  5FE9 A;  3SOX A;  3SOU A;  4MEP A;  3NG2 A;  5C85 A;  5FB0 A;  1FBV A;  3FL2 A;  4A9M A;  5TDW A;  3ZVZ B;  4A4B A;  3QZS A;  5EU1 A;  4PKL A;  3NXB A;  3AAD A;  2E6S A;  4QR3 A;  4YBS A;  5HRX A;  4TQN A;  5D3P A;  4NR4 A;  2RO1 A;  2QJ0 A;  3N9P A;  4HXO A;  3N9O A;  1WFK A;  2M6M A;  5G4R A;  3HCT A;  3ZNI A;  5E9K A;  2M3H A;  4C66 A;  4S3O B;  4HBY A;  4LRG A;  2MD7 B;  5FER A;  4HXR A;  3ZPV E;  5D3S A;  4L7X A;  3LRQ A;  1VD4 A;  3UVD A;  5A5S A;  2FSA A;  4HXP A;  1IYM A;  5I7X A;  3N9M A;  1LDK C;  4XUB A;  5KH3 A;  5DYX A;  4LK9 A;  5G05 B;  4RVR A;  5EYA F;  5HQ7 A;  5ENI A;  5KU3 A;  2L5E A;  2YUC A;  5I80 A;  2R0V A;  2RI7 A;  5HRV A;  4TS8 A;  5TCM A;  4TKP B;  5DLX A;  2JMI A;  5LVR A;  5IBN A;  2D82 A;  4LDF A;  2DKW A;  5CP5 A;  2MD8 C;  5ACY A;  5D3T A;  2YSJ A;  3MHS A;  2MNZ A;  5A82 A;  3RPG C;  5D3J A;  5F2P A;  4V3L C;  2GRC A;  2DWW A;  4LZR A;  5E74 A;  4LZS A;  1WEV A;  4LYI A;  5ENC A;  5B77 A;  5D3R A;  2YHN A;  5ENH A;  5B79 A;  4MR3 A;  5AME A;  3UV4 A;  4QBM A;  5E9Y A;  4O7C A;  4IOQ A;  4N4H A;  3M62 A;  2L85 A;  5C89 A;  2YEL A;  5G04 B;  5HEM A;  5LKT A;  4NQM A;  5EWW A;  5FDZ A;  5FE8 A;  4UYE A;  5HEN A;  3IU6 A;  5E9L A;  4QYL A;  4WA6 A;  4UIU A;  5FFY A;  3O37 A;  5CQ6 A;  5D3N A;  2VP7 A;  2RS9 B;  4HXK A;  5L96 A;  3KQI A;  5H1U A;  5I40 A;  2F42 A;  4TT2 A;  5A81 A;  5DFD A;  4QB3 A;  4YC9 A;  2DVQ A;  5CUA A;  5HEL A;  5C7N A;  4IR3 A;  1X4J A;  5D1M B;  4MEN A;  5TBN A;  4WHU A;  3KV5 A;  5I83 A;  2VPE A;  4CFL A;  4UP5 A;  3RCW A;  2ECV A;  5AIU A;  5L8U A;  4WZ2 A;  4XYA A;  5KHM A;  4HBX A;  5FE3 A;  3GV4 A;  3PUQ A;  3GG3 A;  4MSX A;  3RTR B;  4R7E A;  3JVL A;  5CQT A;  5I7Y A;  5EK9 A;  4ZC9 A;  4XY9 A;  2C2V S;  1JOC A;  5DKA A;  4LR6 A;  4N4F A;  1V87 A;  4AP4 A;  1WEN A;  3PHD A;  3I2D A;  5DIN A;  5D3L A;  4C67 A;  3IU5 A;  4CUS A;  5F61 A;  1JSP B;  2I50 A;  3IHP A;  5FG5 A;  3HMH A;  5JWM A;  5DYA A;  5A5P A;  5BT4 A;  4O64 A;  4BBQ A;  4UI9 B;  4CL9 A;  4S3O C;  3Q2F A;  3U5K A;  3HTK C;  5DYU A;  2KWK A;  5E0R A;  5CQ3 A;  3UVW A;  5EVA A;  2UZG A;  3HCU A;  4QY4 A;  4NYW A;  4O75 A;  4IC3 A;  4YBM A;  2AN6 A;  5H1V A;  4FK5 A;  5D0C A;  3ZTG A;  5ENF A;  4YAT A;  3L11 A;  5A7C A;  5CZG A;  1JM4 B;  2F6N A;  1XWH A;  2KE1 A;  3KV6 A;  5B78 A;  1X4I A;  4QST A;  4QSW A;  3MB3 A;  2LGK A;  5LCW B;  3FKM X;  5F5Z A;  5FFW A;  2KGI A;  4NRA A;  5EGU A;  2MNY A;  4OUF A;  1ZS5 A;  4QNS A;  1VYX A;  5FG4 A;  2ECJ A;  5DBM A;  4PCE A;  5B75 A;  4C9Z A;  4TZ8 A;  1F68 A;  3TLP A;  3ZYQ A;  3UV2 A;  2H60 A;  5DX4 A;  5ENB A;  2YQM A;  2E3K A;  5C4Q A;  5DYC A;  4YH3 A;  5A5Q A;  2VNF A;  5D1L B;  2M1R A;  1WEW A;  3M99 A;  2JMJ A;  4ZQL A;  5I89 A;  4NN2 A;  5LUU A;  2K4D A;  2LGL A;  2MUM A;  2VJE A;  4IR5 A;  3ZYU A;  3ASL A;  4NRC A;  5IGL A;  4QEW A;  2Y43 A;  1X4U A;  3T6R A;  5L98 A;  3UVX A;  5AMF A;  5EIS A;  1ZBD B;  3U5N A;  4TU6 A;  5A5R A;  4NUC A;  2RNX A;  5TB6 A;  4CFK A;  5CY9 A;  5EWD A;  4IR6 A;  4CUR A;  2I7K A;  1WEP A;  4J0R A;  4UIZ A;  2EGP A;  4NR5 A;  5DFC A;  2BAY A;  1LDJ B;  2E7N A;  4UYF A;  3UV5 A;  3SVH A;  5IG6 A;  5EWV A;  3G0J A;  4FLP A;  5EWH A;  4NRB A;  5HJC A;  5L8T A;  4Q0N A;  2PUY A;  5DKH A;  5F36 A;  4YYD A;  2RNW A;  5AD2 A;  2KRE A;  2DVR A;  4GNF A;  4A0C D;  2CKL A;  5LKX A;  2N9G A;  4MR5 A;  5D26 A;  4YAD A;  3P1E A;  5KH7 A;  4QSX A;  2IDA A;  2VJE B;  2YU4 A;  3HCS A;  3JVM A;  4AVX A;  3GL6 A;  5AD3 A;  5CRZ A;  4I7B A;  5H9M A;  4YAX A;  5JG6 A;  3U5J A;  4LZ2 A;  2YUR A;  5FH8 A;  4GB0 A;  2EOD A;  3D7C A;  5H1T A;  2YT5 A;  2XEU A;  2YW8 A;  3U5L A;  4A9J A;  3HME A;  4YYJ A;  1T1H A;  4QSU A;  2KIZ A;  4YYG A;  2CT2 A;  3LQI A;  4WZ3 B;  3UVY A;  3SOW A;  3EB5 A;  5DLZ A;  4NYX A;  4CUU A;  4R8P K;  4LYS A;  2DVV A;  4Q0O A;  5EIC A;  1JM7 A;  3Q2E A;  5D3H A;  5BT5 A;  2RFJ A;  4YYN A;  5KTU A;  3G0L A;  5FE7 A;  4LLB A;  4I7D A;  5D24 A;  5F62 A;  2KWO A;  4TT6 A;  2ECG A;  5E7D A;  1N87 A;  4X2I A;  2Y1M A;  4YYI A;  3MHH A;  2CKL B;  3LXJ A;  5KTW A;  3KNV A;  4FIP A;  4WHW A;  5HQ6 A;  2KR4 A;  3P1C A;  4QF2 A;  5FEY A;  5EA1 A;  4QSQ A;  4CUQ A;  4BW1 A;  5H85 A;  5G0F A;  4LKA A;  2VJF A;  5JI8 A;  5L99 A;  5D1K B;  5D25 A;  2YYN A;  1WEQ A;  4KV1 A;  4BW4 A;  3C6W A;  3JVK A;  5EQ1 A;  5FE5 A;  1HYJ A;  4IR4 A;  3PUR A;  4ALH A;  4ZW1 A;  2ECT A;  4QEV A;  1VFY A;  1WUM A;  2R0Y A;  5AIT A;  2KGG A;  4HXS A;  2HYE D;  2M85 A;  2LGV A;  3T7L A;  4J0S A;  4GND A;  2L5U A;  4NUE A;  5II1 A;  4GPJ A;  1JM7 B;  1F62 A;  5IGK A;  4QR4 A;  5II2 A;  3QZV A;  1Z60 A;  5ENE A;  5I1Q A;  4TTE A;  4XI1 A;  4F52 B;  4LC2 A;  1Z2Q A;  2CSY A;  5FH7 A;  4O74 A;  4OGJ A;  4IOO A;  5FE4 A;  5IGM A;  4V3K C;  3I3J A;  5EM3 A;  2YYR A;  4YY4 A;  2LXH C;  4TZ2 A;  4YYK A;  5EV9 A;  5DKD A;  5E9I A;  5CQ5 A;  5EPR A;  5TDR A;  1WIM A;  5DW2 A;  2VPB A;  2PNX A;  3SHB A;  1WEE A;  2L75 A;  3U5M A;  2KU3 A;  2H0D A;  5LJ0 A;  4A4C A;  4R2Y A;  2K16 A;  1BOR A;  2K1J A;  2ECI A;  4MEQ A;  5IID A;  4KV4 A;  5B8D A;  4QSV A;  2R10 A;  5F1H A;  2D8S A;  4N4I A;  4J1P A;  3SVG A;  2YHO A;  4MVT A;  5KH9 A;  4QC1 A;  5CUE A;  3S92 A;  2YEM A;  4NQN A;  4CA1 A;  4Z1S A;  5BT3 A;  2YRE A;  2CSZ A;  3MUK A;  4NR7 A;  4TYL A;  5FE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...