5FB1A

Crystal structure of a phd finger bound to histone h3 k9me3 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
174
Chain Sequence
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYGPQKPMWLNKVKTSLNEQTYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/structural protein
molecule keywords Nuclear autoantigen Sp-100
total genus 57
structure length 174
sequence length 178
ec nomenclature
pdb deposition date 2015-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fb1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5fb1A01
5KH3A 2DATA 3UV2A 4UIWA 4ZQLA 5EWWA 4YBTA 2ECNA 4PCEA 4O7CA 3N9PA 4WHUA 4YAXA 5D1LB 4A4BA 5EPSA 5IGLA 3L1ZB 4NRCA 4NS5A 3AADA 5EU1A 4F3IA 2Y1NA 5CUAA 5DYCA 4PTBA 4F52B 1DVPA 1U6GB 4WZ0A 2K17A 3IU6A 4IOQA 2CKLA 4QSTA 3JVMA 5B76A 2JMDA 3QZVA 5DYUA 5H1VA 1JSPB 4HXPA 4NYVA 1VYXA 5D26A 4R8PK 4QB3A 4NYXA 4QR4A 2E7OA 4A9EA 4I7BA 5A5SA 2Y43A 4QF2A 4LRGA 4MR4A 5EQ1A 2LQ6A 4O7EA 4LJNA 3L1XA 2OO1A 4C66A 3O36A 4J1PA 5IGKA 2EGPA 5I86A 2YQLA 4YYJA 4LZ2A 4MEOA 5EV9A 5D24A 3UV5A 3LQHA 5DFBA 5A82A 4HXKA 5KTXA 2YHOA 4YADA 1CHCA 5CQ6A 5EGUA 3T7LA 5E9LA 2VNFA 2LGGA 1E4UA 4GPJA 5B79A 5G4SA 1XWHA 4UP0A 4IC2A 4I7CA 5DY7A 5HRXA 4WZ2A 4KCXA 4HXRA 1HYJA 2L84A 5F2PA 3JVLA 4YBMA 5DX4A 5F62A 1T1HA 4YYHA 4QNSA 1K2FA 4BJXA 5EP7A 1WEQA 1N72A 4O74A 3LQJA 3QZSA 5KU3A 4RVRA 5A81A 4BW4A 4YYMA 2MNYA 4X3GA 2YEMA 2RNYA 2YEKA 3O35A 3UW9A 4YY4A 5DW1A 3PUQA 2ECIA 5EICA 5IGNA 2ECTA 4XI1A 5FB1A 5A5QA 5FG5A 5FDZA 4IR5A 4FIPA 4KV4A 5II2A 2CSYA 5I89A 3UVYA 4ALHA 3ONIA 5FG4A 3SVFA 3U5PA 2H0DB 5L8TA 5IBNA 4NQMA 4QSRA 4MSXA 5B75A 5LKXA 2KREA 5E9YA 5CQAA 5EA1A 5F3AA 3ZNIA 5HRVA 4WZ3B 4XYAA 4YYKA 2K16A 2K4DA 5F36A 5IIDA 5DINA 2YDWA 4O7AA 4GNDA 4UIUA 1RMDA 3DQVR 4XY8A 3U5JA 5EPBA 2G6QA 5H9MA 4ZC9A 4Q0OA 4UYDA 5ACYA 5D3LA 5KO4A 5TRBA 1JM7A 5FFYA 5LVQA 3O34A 5FE3A 4LADB 5TBNA 4NUCA 5FE5A 5B78A 5C89A 4S3OB 3KV6A 4A9NA 2XB1A 4A9MA 3PHDA 5B8DA 3GG3A 2LV9A 4QC1A 4YK0A 3O37A 3L11A 2AN6A 4NR7A 4UYHA 5HQ6A 4UYEA 5F60A 4N4GA 4QEWA 4UIZA 2G4AA 5F5ZA 4A9HA 5AMEA 3SOUA 3HMFA 2KWOA 5HRWA 3SOWA 4HXMA 2QICA 4NR5A 5DKCA 1G25A 1HYIA 4NXJA 4QY4A 3M62A 4QUUA 2YT5A 2CT2A 5FERA 4CLBA 5FFWA 4NR9A 3S92A 3LRQA 2JMIA 5JWMA 5C11A 1LDKC 4TYLA 4QSWA 2LGKA 3KV5A 4YYDA 5E73A 4CL9A 5C13A 2M6MA 2YQMA 4UP5A 4LZSA 4NR8A 2L0BA 2VPBA 2RNXA 4TKPB 4TQNA 5D0CA 5TCMA 2E6RA 2NXBA 3MXFA 4CCGX 2C2LA 4QR5A 3SVGA 1LDJB 2M1RA 4AVXA 4XY9A 4J3IA 4A9FA 2CSZA 2OXQC 4NN2A 3T6RA 4B86C 5KH7A 5EWCA 4O72A 5LCWB 2LN0A 4Z93A 4YYIA 5A5RA 5LJ0A 2MT5A 3ASLA 4QSQA 2YW8A 4PS5A 5HEMA 1IYMA 3C5KA 4LZRA 2G43A 3O33A 3JVKA 3O70A 4IR4A 1WENA 4O75A 5DLXA 1BORA 4BHWA 4N4IA 5H85A 5ETBA 3IU5A 4WIVA 2RFJA 5CS8A 5FE8A 2YYRA 5FH6A 4S3OC 5G04B 3Q2FA 4HBXA 4QYDA 2N9GA 3I3JA 5EK9A 2VPGA 3PURA 4YY6A 4MEPA 4NUDA 3JVJA 4IOOA 4UIXA 2EA6A 2VJFB 4L58A 5FEYA 4IR6A 4MEQA 2DVRA 2E7NA 4UYGA 2VPDA 4OGIA 3FKMX 3FL2A 5KH9A 1WEMA 3MULA 4HXOA 2G45A 2JRJA 4LYWA 2KWNA 4TTEA 5COIA 5FE0A 3MUKA 4FLPA 4IORA 4R7EA 5DKDA 5ENJA 5ENBA 4BBQA 1JOCA 2YELA 5DBMA 4A4CA 2HYED 4HBYA 3MQMA 2RI7A 5E9VA 4CURA 3GL6A 4IC3A 2IDAA 2I8NA 5A83A 2F6JA 4Z6IA 4W4UA 2CKLB 5FE4A 4TU6A 3LQIA 4YC9A 2FSAA 4GB0A 5FH8A 3N9OA 3U5NA 3SVHA 5CGPA 3M99A 4BW3A 4J0SA 1X4IA 2NAAA 5AIUA 4PY6A 5H1UA 4N4HA 2RNWA 2R0VA 5DKHA 2L85A 2R10A 2DWWA 2DX8A 5B77A 2DVSA 2EODA 2D8SA 5A5PA 5F25A 4NR4A 5D7XA 1WFKA 1WILA 5LKTA 5D1KB 4QUTA 5LKUA 5CZGA 3Q2EA 2L75A 2MIQA 3RPGB 5HFQA 5A85A 5LUUA 4TZ2A 3ZVZB 5CQ4A 5FE7A 5AMFA 4O70A 5D3TA 3HTKC 5EPRA 5LKZA 4FO9A 2JMJA 2I7KA 5FFVA 3UVXA 1Z60A 4A0CD 4QSXA 3ZPVE 5IGMA 4QEUA 5F1HA 2MA6A 4LC2A 4HBVA 4HXSA 3EB5A 4MR3A 5CUBA 3ZPV1 1WUGA 5E9MA 5G0FA 3RTRB 2KR4A 5D25A 5D3HA 2KWKA 5CFWA 5DFCA 4UIVA 5CUGA 5CUCA 2MUMA 3TLPA 4N4FA 1ZBDB 2MJVB 4CUTA 4Q6FA 4ZUXU 4Q0NA 1X4UA 5FG6A 5ENEA 5C87A 4YBSA 4O64A 4QSUA 1JM7B 5C7NA 4YH4A 3ZYUA 5G4RA 2F6NA 2DVQA 2R0SA 5CUDA 5FE9A 3HCSA 1FBVA 3SOXA 4LKAA 4CUUA 5BT3A 3GV4A 4OGJA 5HM0A 1WEOA 5KHMA 2YUCA 5I80A 1WEUA 2ECGA 3V43A 1Z2QA 5EYAF 5I88A 1WEWA 5J3XA 5HQ5A 2FUIA 4NRAA 4PKLA 4A49A 3MHHA 4N3WA 5HQ7A 5TB6A 5HCLA 1WESA 4KV1A 5FBXA 2RSDA 3N9LA 4E96A 5H1TA 5L99A 2ZETC 4BW1A 4B7YC 3O7AA 3IHPA 2MA5A 5KTWA 1X0JA 3S91A 5E3GA 4YATA 3KQIA 2QJ0A 3I2DA 3HMEA 2ECVA 3EB6A 1WEPA 2LXPC 3HMHA 5ENHA 4C67A 2R0YA 5G05B 5EM3A 5CQTA 3K2JA 4R2YA 4MENA 5I83A 3QZTA 2ECWA 4YABA 1F68A 2H0DA 4ZW1A 3P1DA 5J0DA 2RS9B 2M3HA 4GNGA 4AKNA 3SHBA 5F61A 5I29A 2YSJA 4A9KA 2LGVA 5D3SA 5K29A 5TDRA 2WP1A 3DWYA 3D7CA 2Y1MA 5E3DA 5CQ8A 5E0RA 5KTUA 1VD4A 4O71A 3HCUA 4NYWA 4CFLA 4TS8A 2KGIA 4MVTA 2RO1A 4QZSA 5I7XA 5L97A 2C2VS 5I7YA 2LSPB 1EQFA 5E9IA 5I1QA 2KFTA 4BW2A 3U5KA 2PNXA 2KIZA 2YU4A 4WA6A 5F1LA 5CQ7A 1WEEA 4IR3A 4LYSA 3ZYQA 4FJCA 3P5OA 5JI8A 2QIZA 3N9NA 4UI9B 3P1EA 5TDWA 5HJCA 4O7FA 2F42A 4QEVA 4FK5A 3U5LA 5AITA 4NUEA 3MB4A 2M85A 4HXNA 4TT2A 3N9QA 4Z1SA 2LDRA 5JG6A 3AQAA 3G0LA 4AYCA 2LGLA 5BT5A 3NXBA 4P5OB 5EISA 3LXJA 2K1JA 4NQNA 4PCIA 3C6WA 1E6IA 5ETDA 4LLBA 1ZS5A 5ENIA 2YREA 5EVAA 5EWHA 4LDFA 4QSSA 4UITA 2L5EA 4DONA 4LR6A 5D3RA 2KWJA 4CUQA 2WP2A 4ZDTA 5C85A 4CA1A 3VK6A 4J0RA 4HBWA 4V3LC 3RPGC 2FUUA 5DKAA 5HFRA 2VPEA 4QSVA 3MB3A 2YYNA 5E7DA 2LXHC 4MR6A 5D3PA 5L96A 5CQ5A 5CU8A 5CUEA 4QF3A 3ZTGA 4YH3A 5CQ3A 4A9JA 2LRIC 5IG6A 5II1A 2MD7B 3DPLR 5HLSA 4XUBA 4LK9A 4UIYA 5CP5A 5I40A 2YQDA 2L43A 4O77A 4V3KC 2D9EA 4TZ8A 4XUAA 4Z6HA 5TABA 5ENFA 2H60A 1WIMA 4A9IA 3LJWA 4OUFA 1WUMA 5A7CA 4TU4A 3DAIA 5FB0A 4YYNA 4Z1QA 2KE1A 4GNFA 2VJEB 4MR5A 5EWVA 4Y03A 1VFYA 5CY9A 4O78A 2OUOA 2D82A 5LJ1A 4TT6A 5DLZA 5AD2A 2YHNA 4YYGA 4UYFA 2I50A 3NG2A 2UZGA 5I3LA 4QYLA 4AP4A 4UYFB 2E6SA 5C4QA 5E74A 3UV4A 3RCWA 5A5OA 4A9OA 2E3KA 4QSPA 5CRZA 2ECJA 5E9KA 5FE1A 4ALGA 4CUPA 4O7BA 5DFDA 5ENGA 3P1FA 2KGGA 4TT4A 5CTLA 4A9LA 1FP0A 1Z6UA 1MM2A 2BAYA 5DW2A 3MHSA 4NRBA 1F62A 4WHWA 4QC3A 5D3JA 5L98A 3U5MA 3UVDA 4PPEA 1N87A 4AYCB 2GRCA 4L7XA 5LVRA 2DKWA 5CRMA 2MNZA 3N9MA 4O76A 3P1CA 3HCTA 2VJFA 5DYXA 4X2IA 5AD3A 1MM3A 5ENCA 5FH7A 1WGMA 4NR6A 5FE2A 3UVWA 2DVVA 5HENA 2HDPA 3ZVYA 3G0JA 5HELA 4AUQB 4QBMA 2L5UA 2VJEA 2YSMA 5EI4A 2KTBB 4LYIA 4I7DA 2VP7A 2KU3A 5CPEA 4CFKA 1JM4B 5BT4A 1WE9A 5D3NA 3M63A 2MD8C 4CUSA 1V87A 1X4JA 4QR3A 2OSSA 2XEUA 2YURA 2L80A 3KNVA 5FE6A 2YW5A 5LJ2A 2KYUA 5F63A 5D1MB 5L8UA 4GNEA 5A5NA 1WEVA 4C9ZA 3U5OA 5C8GA 4HXLA 5EWDA 2PUYA 5DYAA
chains in the Genus database with same CATH superfamily
5KH3A 2DATA 3UV2A 3D1DA 2CRWA 4UIWA 4ZQLA 5EWWA 4YBTA 2ECNA 4PCEA 4O7CA 3N9PA 4WHUA 4YAXA 5D1LB 4A4BA 5EPSA 5IGLA 3L1ZB 4NRCA 4NS5A 3AADA 5EU1A 4F3IA 2Y1NA 5CUAA 5DYCA 3O47A 4PTBA 4F52B 1DVPA 1U6GB 4WZ0A 2K17A 4Z0RA 3IU6A 4IOQA 2CKLA 4QSTA 3JVMA 5B76A 2JMDA 3QZVA 5DYUA 5H1VA 1JSPB 4HXPA 4NYVA 1VYXA 5D26A 4R8PK 4QB3A 4NYXA 4QR4A 2E7OA 4A9EA 4I7BA 5A5SA 2Y43A 4QF2A 4LRGA 4MR4A 5EQ1A 2LQ6A 4O7EA 4LJNA 3M7KA 3L1XA 2OO1A 4C66A 3O36A 4J1PA 5IGKA 2EGPA 5I86A 2YQLA 4YYJA 4LZ2A 4MEOA 5EV9A 2CRRA 5D24A 3UV5A 3LQHA 5DFBA 5A82A 4HXKA 5KTXA 2YHOA 3FJUB 3LJUX 4YADA 1CHCA 5CQ6A 2L7PA 5EGUA 3T7LA 5E9LA 2VNFA 2LGGA 1E4UA 4GPJA 5B79A 5G4SA 1XWHA 4UP0A 2JUNA 4IC2A 4I7CA 5DY7A 5HRXA 4WZ2A 4KCXA 4HXRA 1HYJA 2L84A 5F2PA 3JVLA 4YBMA 5DX4A 5F62A 1T1HA 4YYHA 3FAOA 4QNSA 1K2FA 4BJXA 5EP7A 1WEQA 1N72A 4O74A 5SVIA 3LQJA 3QZSA 5KU3A 4RVRA 5A81A 4BW4A 4YYMA 2MNYA 2XOZA 4X3GA 2YEMA 2RNYA 2YEKA 3O35A 3UW9A 4YY4A 5DW1A 3PUQA 2ECIA 2KKXA 5EICA 5IGNA 2ECTA 4XI1A 3T9KA 5FB1A 5A5QA 5FG5A 5FDZA 4IR5A 4FIPA 4KV4A 5II2A 4H9DA 2CSYA 5I89A 3UVYA 4ALHA 3ONIA 5FG4A 3SVFA 3U5PA 2H0DB 5L8TA 5IBNA 4NQMA 4QSRA 4MSXA 5B75A 5LKXA 2KREA 5E9YA 5CQAA 5EA1A 5F3AA 3ZNIA 5HRVA 4WZ3B 4XYAA 4YYKA 2K16A 2K4DA 2YVRA 5F36A 3KDEC 5IIDA 5DINA 2YDWA 4O7AA 4GNDA 4UIUA 1RMDA 3DQVR 4XY8A 3U5JA 3JUEA 5EPBA 2G6QA 5H9MA 1DCQA 4ZC9A 4Q0OA 4UYDA 5ACYA 5D3LA 5KO4A 5TRBA 1JM7A 5FFYA 5LVQA 3O34A 5FE3A 3FEHA 4LADB 4NUCA 5FE5A 5TBNA 5B78A 5C89A 4S3OB 3KV6A 4A9NA 2XB1A 4A9MA 3PHDA 5B8DA 3GG3A 2LV9A 2JM3A 4QC1A 2E61A 4YK0A 3O37A 3Q1DA 3L11A 2AN6A 4NR7A 4UYHA 5HQ6A 4UYEA 5F60A 4N4GA 4QEWA 4UIZA 2G4AA 5F5ZA 4A9HA 5AMEA 3SOUA 3HMFA 2KWOA 5HRWA 3SOWA 4HXMA 2QICA 4NR5A 5DKCA 1G25A 1HYIA 4NXJA 4QY4A 2XP0A 3M62A 4QUUA 2YT5A 2CT2A 5FERA 4CLBA 5FFWA 4NR9A 3S92A 3LRQA 2JMIA 5JWMA 5C11A 1LDKC 4TYLA 4QSWA 2LGKA 3KV5A 4YYDA 5E73A 4CL9A 5C13A 2M6MA 2YQMA 2DSMA 4UP5A 4AKIA 4LZSA 4IC3A 2RR4A 4NR8A 2L0BA 2VPBA 2RNXA 4TKPB 4TQNA 5D0CA 5TCMA 3LVRE 2E6RA 2NXBA 3MXFA 4CCGX 2C2LA 4QR5A 3SVGA 1LDJB 2M1RA 4AVXA 4XY9A 4J3IA 4A9FA 2CSZA 2OXQC 4NN2A 3T6RA 4B86C 5KH7A 5EWCA 4O72A 5LCWB 2LN0A 4Z93A 4YYIA 5A5RA 5LJ0A 2MT5A 3ASLA 4QSQA 2YW8A 4PS5A 5HEMA 1IYMA 3C5KA 4LZRA 2G43A 3O33A 3JVKA 3O70A 4IR4A 1WENA 4O75A 5DLXA 1BORA 4BHWA 4N4IA 5H85A 5ETBA 3IU5A 4WIVA 4AKHA 2RFJA 5CS8A 5FE8A 2YYRA 5FH6A 4S3OC 5G04B 3Q2FA 4HBXA 4QYDA 2N9GA 4O62A 3I3JA 5EK9A 2VPGA 3PURA 4YY6A 4MEPA 4NUDA 3JVJA 4IOOA 4UIXA 3VKGA 2EA6A 2VJFB 4L58A 2IQJA 5FEYA 4IR6A 4MEQA 2DVRA 2E7NA 4UYGA 2VPDA 4OGIA 3FKMX 3FL2A 5KH9A 1WEMA 3MULA 4HXOA 2G45A 2JRJA 4LYWA 2KWNA 3LDYA 4TTEA 5COIA 5FE0A 3MUKA 4FLPA 4IORA 2LAUA 4R7EA 5DKDA 5ENJA 5ENBA 2EXUA 4BBQA 1JOCA 5K3QA 2YELA 5DBMA 4A4CA 2HYED 4HBYA 3MQMA 3FANA 2RI7A 5E9VA 4CURA 3DWDA 3GL6A 2IDAA 2I8NA 5A83A 2F6JA 4Z6IA 4W4UA 2CKLB 5FE4A 4TU6A 3LQIA 4YC9A 3D1BA 2FSAA 4GB0A 4QQ4A 5FH8A 3N9OA 3U5NA 3SVHA 2XOYA 5CGPA 3M99A 4BW3A 4J0SA 1X4IA 2NAAA 5AIUA 4PY6A 5H1UA 4N4HA 2EGMA 4AI6A 2RNWA 5SVXA 2R0VA 5DKHA 2L85A 2R10A 2DWWA 2DX8A 5B77A 2DVSA 2EODA 2D8SA 5A5PA 5F25A 4NR4A 5D7XA 1WFKA 1WILA 2D8UA 5LKTA 5D1KB 4QUTA 3PLWA 5LKUA 5CZGA 3Q2EA 2L75A 2MIQA 3RPGB 5HFQA 5A85A 5LUUA 4TZ2A 3ZVZB 5CQ4A 5FE7A 5AMFA 4O70A 5D3TA 3HTKC 5EPRA 5LKZA 4FO9A 2JMJA 2I7KA 5FFVA 3UVXA 1Z60A 4A0CD 4QSXA 3ZPVE 5IGMA 4QEUA 5F1HA 3ERRA 2MA6A 4LC2A 4HBVA 4HXSA 3EB5A 2CSVA 4MR3A 5CUBA 3ZPV1 1WUGA 5E9MA 5G0FA 3RTRB 2KR4A 5D25A 5D3HA 2KWKA 5CFWA 5DFCA 4UIVA 5CUGA 5CUCA 2MUMA 1PUOA 4N4FA 3TLPA 1ZBDB 2MJVB 4CUTA 4Q6FA 2MKEA 4ZUXU 4Q0NA 1X4UA 5FG6A 5ENEA 5C87A 4YBSA 4O64A 4QSUA 1JM7B 5C7NA 4YH4A 3ZYUA 5G4RA 2F6NA 2DVQA 2R0SA 5CUDA 5FE9A 3HCSA 1FBVA 3SOXA 4LKAA 4CUUA 5BT3A 3GV4A 4OGJA 5HM0A 1WEOA 5KHMA 2FD4A 2YUCA 5I80A 1WEUA 2ECGA 3V43A 1Z2QA 5EYAF 5I88A 1WEWA 5J3XA 5HQ5A 2FUIA 4NRAA 4PKLA 4A49A 3MHHA 4N3WA 5HQ7A 5TB6A 5HCLA 1WESA 4KV1A 5FBXA 2RSDA 3N9LA 4E96A 5H1TA 5L99A 2ZETC 4BW1A 4B7YC 3O7AA 3IHPA 2MA5A 5KTWA 1X0JA 3S91A 5E3GA 4YATA 3KQIA 3E2DA 2QJ0A 3I2DA 4Z0OA 3HMEA 2ECVA 3EB6A 1WEPA 2LXPC 3HMHA 5ENHA 4C67A 2R0YA 5G05B 5EM3A 5CQTA 3K2JA 4R2YA 4MENA 2FFWA 5I83A 3QZTA 2ECWA 4YABA 1F68A 2H0DA 4ZW1A 3P1DA 5J0DA 2RS9B 2M3HA 4GNGA 4AKNA 3SHBA 5F61A 5I29A 2YSJA 4A9KA 2LGVA 3VKHA 5D3SA 5K29A 5TDRA 2WP1A 3DWYA 2XOCA 3D7CA 2Y1MA 5E3DA 5CQ8A 5E0RA 5KTUA 1VD4A 4O71A 3HCUA 4NYWA 4CFLA 4TS8A 2KGIA 3LVQE 3MDBC 4MVTA 2RO1A 4QZSA 5I7XA 5L97A 2C2VS 5I7YA 2LSPB 1EQFA 5E9IA 5I1QA 2KFTA 2OWAA 4BW2A 3U5KA 2PNXA 2KIZA 2YU4A 4WA6A 5F1LA 5CQ7A 1WEEA 4IR3A 4LYSA 3ZYQA 4FJCA 3P5OA 5JI8A 2DJAA 2QIZA 3N9NA 5SVIB 4UI9B 3P1EA 5TDWA 5HJCA 4O7FA 2F42A 4QEVA 4FK5A 3U5LA 2KKYA 5AITA 4NUEA 2EJNA 4OGCA 3MB4A 2M85A 4HXNA 4TT2A 1MBMA 3N9QA 4F1PA 4Z1SA 2LDRA 5JG6A 3AQAA 5SVYA 3G0LA 4AYCA 2LGLA 5BT5A 3NXBA 4P5OB 5EISA 3LXJA 2K1JA 4NQNA 4PCIA 3C6WA 3FM8C 1E6IA 5ETDA 4LLBA 1ZS5A 5ENIA 2YREA 5EVAA 5EWHA 4LDFA 4QSSA 4UITA 2L5EA 4DONA 4LR6A 5D3RA 2KWJA 4CUQA 2WP2A 4ZDTA 5C85A 2M13A 4CA1A 3VK6A 4J0RA 4HBWA 4V3LC 3RPGC 2FUUA 5DKAA 5HFRA 2VPEA 4QSVA 2YYNA 3MB3A 5E7DA 2LXHC 4MR6A 5D3PA 5L96A 5CQ5A 5CU8A 5CUEA 2P57A 4QF3A 3ZTGA 4YH3A 5CQ3A 4A9JA 2LRIC 5IG6A 5II1A 2MD7B 3DPLR 5HLSA 4XUBA 4LK9A 4UIYA 5CP5A 5I40A 2YQDA 2L43A 4O77A 4V3KC 2D9EA 4TZ8A 4XUAA 2CONA 3H7HA 4Z6HA 5TABA 5ENFA 2H60A 1WIMA 4A9IA 3LJWA 4OUFA 1WUMA 5A7CA 4TU4A 3DAIA 5FB0A 4YYNA 4Z1QA 2KE1A 4GNFA 2VJEB 4MR5A 5EWVA 4Y03A 1VFYA 5CY9A 4O78A 2OUOA 2D82A 5LJ1A 4TT6A 5DLZA 5AD2A 2YHNA 4YYGA 4UYFA 2I50A 3NG2A 2UZGA 1ZKRA 5I3LA 4QYLA 4AP4A 4UYFB 2E6SA 5C4QA 5E74A 3UV4A 3RCWA 5A5OA 4A9OA 2E3KA 4QSPA 5CRZA 2ECJA 5E9KA 5FE1A 4ALGA 4CUPA 4O7BA 5DFDA 5ENGA 3P1FA 2KGGA 4TT4A 5CTLA 4A9LA 1FP0A 1Z6UA 1MM2A 2BAYA 5DW2A 3MHSA 4NRBA 1F62A 4WHWA 4QC3A 5D3JA 5L98A 3U5MA 3UVDA 2B0OE 4PPEA 1N87A 4AYCB 2GRCA 4L7XA 5LVRA 2DKWA 5CRMA 2MNZA 3N9MA 4O76A 3P1CA 3HCTA 2VJFA 5DYXA 4X2IA 5AD3A 1MM3A 4OGEA 5ENCA 5FH7A 1WGMA 4NR6A 5FE2A 3UVWA 2DVVA 5HENA 2HDPA 3ZVYA 3G0JA 5HELA 4AUQB 4QBMA 2L5UA 2VJEA 2YSMA 5EI4A 2KTBB 4LYIA 4I7DA 2VP7A 2KU3A 5CPEA 4CFKA 1JM4B 5BT4A 1WE9A 5D3NA 3DDTA 3M63A 2MD8C 4CUSA 1V87A 1X4JA 4QR3A 2OSSA 2XEUA 2YURA 2L80A 3KNVA 5FE6A 4AKGA 2YW5A 5LJ2A 2KYUA 5F63A 5D1MB 5L8UA 3SUBA 4GNEA 5A5NA 1WEVA 4C9ZA 3U5OA 5C8GA 4HXLA 5EWDA 2PUYA 5DYAA
chains in the Genus database with same CATH topology
5KH3A 2DATA 3UV2A 4UIWA 4ZQLA 5EWWA 4YBTA 2ECNA 4PCEA 4O7CA 3N9PA 4WHUA 4YAXA 5D1LB 4A4BA 5EPSA 5IGLA 3L1ZB 4NRCA 4NS5A 3AADA 5EU1A 4F3IA 2Y1NA 5CUAA 5DYCA 4PTBA 4F52B 1DVPA 1U6GB 4WZ0A 2K17A 3IU6A 4IOQA 2CKLA 4QSTA 3JVMA 5B76A 2JMDA 3QZVA 5DYUA 5H1VA 1JSPB 4HXPA 4NYVA 1VYXA 5D26A 4R8PK 4QB3A 4NYXA 4QR4A 2E7OA 4A9EA 4I7BA 5A5SA 2Y43A 4QF2A 4LRGA 4MR4A 5EQ1A 2LQ6A 4O7EA 4LJNA 3L1XA 2OO1A 4C66A 3O36A 4J1PA 5IGKA 2EGPA 5I86A 2YQLA 4YYJA 4LZ2A 4MEOA 5EV9A 5D24A 3UV5A 3LQHA 5DFBA 5A82A 4HXKA 5KTXA 2YHOA 4YADA 1CHCA 5CQ6A 5EGUA 3T7LA 5E9LA 2VNFA 2LGGA 1E4UA 4GPJA 5B79A 5G4SA 1XWHA 4UP0A 4IC2A 4I7CA 5DY7A 5HRXA 4WZ2A 4KCXA 4HXRA 1HYJA 2L84A 5F2PA 3JVLA 4YBMA 5DX4A 5F62A 1T1HA 4YYHA 4QNSA 1K2FA 4BJXA 5EP7A 1WEQA 1N72A 4O74A 3LQJA 3QZSA 5KU3A 4RVRA 5A81A 4BW4A 4YYMA 2MNYA 4X3GA 2YEMA 2RNYA 2YEKA 3O35A 3UW9A 4YY4A 5DW1A 3PUQA 2ECIA 5EICA 5IGNA 2ECTA 4XI1A 5FB1A 5A5QA 5FG5A 5FDZA 4IR5A 4FIPA 4KV4A 5II2A 2CSYA 5I89A 3UVYA 4ALHA 3ONIA 5FG4A 3SVFA 3U5PA 2H0DB 5L8TA 5IBNA 4NQMA 4QSRA 4MSXA 5B75A 5LKXA 2KREA 5E9YA 5CQAA 5EA1A 5F3AA 3ZNIA 5HRVA 4WZ3B 4XYAA 4YYKA 2K16A 2K4DA 5F36A 5IIDA 5DINA 2YDWA 4O7AA 4GNDA 4UIUA 1RMDA 3DQVR 4XY8A 3U5JA 5EPBA 2G6QA 5H9MA 4ZC9A 4Q0OA 4UYDA 5ACYA 5D3LA 5KO4A 5TRBA 1JM7A 5FFYA 5LVQA 3O34A 5FE3A 4LADB 5TBNA 4NUCA 5FE5A 5B78A 5C89A 4S3OB 3KV6A 4A9NA 2XB1A 4A9MA 3PHDA 5B8DA 3GG3A 2LV9A 4QC1A 4YK0A 3O37A 3L11A 2AN6A 4NR7A 4UYHA 5HQ6A 4UYEA 5F60A 4N4GA 4QEWA 4UIZA 2G4AA 5F5ZA 4A9HA 5AMEA 3SOUA 3HMFA 2KWOA 5HRWA 3SOWA 4HXMA 2QICA 4NR5A 5DKCA 1G25A 1HYIA 4NXJA 4QY4A 3M62A 4QUUA 2YT5A 2CT2A 5FERA 4CLBA 5FFWA 4NR9A 3S92A 3LRQA 2JMIA 5JWMA 5C11A 1LDKC 4TYLA 4QSWA 2LGKA 3KV5A 4YYDA 5E73A 4CL9A 5C13A 2M6MA 2YQMA 4UP5A 4LZSA 4NR8A 2L0BA 2VPBA 2RNXA 4TKPB 4TQNA 5D0CA 5TCMA 2E6RA 2NXBA 3MXFA 4CCGX 2C2LA 4QR5A 3SVGA 1LDJB 2M1RA 4AVXA 4XY9A 4J3IA 4A9FA 2CSZA 2OXQC 4NN2A 3T6RA 4B86C 5KH7A 5EWCA 4O72A 5LCWB 2LN0A 4Z93A 4YYIA 5A5RA 5LJ0A 2MT5A 3ASLA 4QSQA 2YW8A 4PS5A 5HEMA 1IYMA 3C5KA 4LZRA 2G43A 3O33A 3JVKA 3O70A 4IR4A 1WENA 4O75A 5DLXA 1BORA 4BHWA 4N4IA 5H85A 5ETBA 3IU5A 4WIVA 2RFJA 5CS8A 5FE8A 2YYRA 5FH6A 4S3OC 5G04B 3Q2FA 4HBXA 4QYDA 2N9GA 3I3JA 5EK9A 2VPGA 3PURA 4YY6A 4MEPA 4NUDA 3JVJA 4IOOA 4UIXA 2EA6A 2VJFB 4L58A 5FEYA 4IR6A 4MEQA 2DVRA 2E7NA 4UYGA 2VPDA 4OGIA 3FKMX 3FL2A 5KH9A 1WEMA 3MULA 4HXOA 2G45A 2JRJA 4LYWA 2KWNA 4TTEA 5COIA 5FE0A 3MUKA 4FLPA 4IORA 4R7EA 5DKDA 5ENJA 5ENBA 4BBQA 1JOCA 2YELA 5DBMA 4A4CA 2HYED 4HBYA 3MQMA 2RI7A 5E9VA 4CURA 3GL6A 4IC3A 2IDAA 2I8NA 5A83A 2F6JA 4Z6IA 4W4UA 2CKLB 5FE4A 4TU6A 3LQIA 4YC9A 2FSAA 4GB0A 5FH8A 3N9OA 3U5NA 3SVHA 5CGPA 3M99A 4BW3A 4J0SA 1X4IA 2NAAA 5AIUA 4PY6A 5H1UA 4N4HA 2RNWA 2R0VA 5DKHA 2L85A 2R10A 2DWWA 2DX8A 5B77A 2DVSA 2EODA 2D8SA 5A5PA 5F25A 4NR4A 5D7XA 1WFKA 1WILA 5LKTA 5D1KB 4QUTA 5LKUA 5CZGA 3Q2EA 2L75A 2MIQA 3RPGB 5HFQA 5A85A 5LUUA 4TZ2A 3ZVZB 5CQ4A 5FE7A 5AMFA 4O70A 5D3TA 3HTKC 5EPRA 5LKZA 4FO9A 2JMJA 2I7KA 5FFVA 3UVXA 1Z60A 4A0CD 4QSXA 3ZPVE 5IGMA 4QEUA 5F1HA 2MA6A 4LC2A 4HBVA 4HXSA 3EB5A 4MR3A 5CUBA 3ZPV1 1WUGA 5E9MA 5G0FA 3RTRB 2KR4A 5D25A 5D3HA 2KWKA 5CFWA 5DFCA 4UIVA 5CUGA 5CUCA 2MUMA 3TLPA 4N4FA 1ZBDB 2MJVB 4CUTA 4Q6FA 4ZUXU 4Q0NA 1X4UA 5FG6A 5ENEA 5C87A 4YBSA 4O64A 4QSUA 1JM7B 5C7NA 4YH4A 3ZYUA 5G4RA 2F6NA 2DVQA 2R0SA 5CUDA 5FE9A 3HCSA 1FBVA 3SOXA 4LKAA 4CUUA 5BT3A 3GV4A 4OGJA 5HM0A 1WEOA 5KHMA 2YUCA 5I80A 1WEUA 2ECGA 3V43A 1Z2QA 5EYAF 5I88A 1WEWA 5J3XA 5HQ5A 2FUIA 4NRAA 4PKLA 4A49A 3MHHA 4N3WA 5HQ7A 5TB6A 5HCLA 1WESA 4KV1A 5FBXA 2RSDA 3N9LA 4E96A 5H1TA 5L99A 2ZETC 4BW1A 4B7YC 3O7AA 3IHPA 2MA5A 5KTWA 1X0JA 3S91A 5E3GA 4YATA 3KQIA 2QJ0A 3I2DA 3HMEA 2ECVA 3EB6A 1WEPA 2LXPC 3HMHA 5ENHA 4C67A 2R0YA 5G05B 5EM3A 5CQTA 3K2JA 4R2YA 4MENA 5I83A 3QZTA 2ECWA 4YABA 1F68A 2H0DA 4ZW1A 3P1DA 5J0DA 2RS9B 2M3HA 4GNGA 4AKNA 3SHBA 5F61A 5I29A 2YSJA 4A9KA 2LGVA 5D3SA 5K29A 5TDRA 2WP1A 3DWYA 3D7CA 2Y1MA 5E3DA 5CQ8A 5E0RA 5KTUA 1VD4A 4O71A 3HCUA 4NYWA 4CFLA 4TS8A 2KGIA 4MVTA 2RO1A 4QZSA 5I7XA 5L97A 2C2VS 5I7YA 2LSPB 1EQFA 5E9IA 5I1QA 2KFTA 4BW2A 3U5KA 2PNXA 2KIZA 2YU4A 4WA6A 5F1LA 5CQ7A 1WEEA 4IR3A 4LYSA 3ZYQA 4FJCA 3P5OA 5JI8A 2QIZA 3N9NA 4UI9B 3P1EA 5TDWA 5HJCA 4O7FA 2F42A 4QEVA 4FK5A 3U5LA 5AITA 4NUEA 3MB4A 2M85A 4HXNA 4TT2A 3N9QA 4Z1SA 2LDRA 5JG6A 3AQAA 3G0LA 4AYCA 2LGLA 5BT5A 3NXBA 4P5OB 5EISA 3LXJA 2K1JA 4NQNA 4PCIA 3C6WA 1E6IA 5ETDA 4LLBA 1ZS5A 5ENIA 2YREA 5EVAA 5EWHA 4LDFA 4QSSA 4UITA 2L5EA 4DONA 4LR6A 5D3RA 2KWJA 4CUQA 2WP2A 4ZDTA 5C85A 4CA1A 3VK6A 4J0RA 4HBWA 4V3LC 3RPGC 2FUUA 5DKAA 5HFRA 2VPEA 4QSVA 3MB3A 2YYNA 5E7DA 2LXHC 4MR6A 5D3PA 5L96A 5CQ5A 5CU8A 5CUEA 4QF3A 3ZTGA 4YH3A 5CQ3A 4A9JA 2LRIC 5IG6A 5II1A 2MD7B 3DPLR 5HLSA 4XUBA 4LK9A 4UIYA 5CP5A 5I40A 2YQDA 2L43A 4O77A 4V3KC 2D9EA 4TZ8A 4XUAA 4Z6HA 5TABA 5ENFA 2H60A 1WIMA 4A9IA 3LJWA 4OUFA 1WUMA 5A7CA 4TU4A 3DAIA 5FB0A 4YYNA 4Z1QA 2KE1A 4GNFA 2VJEB 4MR5A 5EWVA 4Y03A 1VFYA 5CY9A 4O78A 2OUOA 2D82A 5LJ1A 4TT6A 5DLZA 5AD2A 2YHNA 4YYGA 4UYFA 2I50A 3NG2A 2UZGA 5I3LA 4QYLA 4AP4A 4UYFB 2E6SA 5C4QA 5E74A 3UV4A 3RCWA 5A5OA 4A9OA 2E3KA 4QSPA 5CRZA 2ECJA 5E9KA 5FE1A 4ALGA 4CUPA 4O7BA 5DFDA 5ENGA 3P1FA 2KGGA 4TT4A 5CTLA 4A9LA 1FP0A 1Z6UA 1MM2A 2BAYA 5DW2A 3MHSA 4NRBA 1F62A 4WHWA 4QC3A 5D3JA 5L98A 3U5MA 3UVDA 4PPEA 1N87A 4AYCB 2GRCA 4L7XA 5LVRA 2DKWA 5CRMA 2MNZA 3N9MA 4O76A 3P1CA 3HCTA 2VJFA 5DYXA 4X2IA 5AD3A 1MM3A 5ENCA 5FH7A 1WGMA 4NR6A 5FE2A 3UVWA 2DVVA 5HENA 2HDPA 3ZVYA 3G0JA 5HELA 4AUQB 4QBMA 2L5UA 2VJEA 2YSMA 5EI4A 2KTBB 4LYIA 4I7DA 2VP7A 2KU3A 5CPEA 4CFKA 1JM4B 5BT4A 1WE9A 5D3NA 3M63A 2MD8C 4CUSA 1V87A 1X4JA 4QR3A 2OSSA 2XEUA 2YURA 2L80A 3KNVA 5FE6A 2YW5A 5LJ2A 2KYUA 5F63A 5D1MB 5L8UA 4GNEA 5A5NA 1WEVA 4C9ZA 3U5OA 5C8GA 4HXLA 5EWDA 2PUYA 5DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH3 A;  2DAT A;  3UV2 A;  4UIW A;  4ZQL A;  5EWW A;  4YBT A;  2ECN A;  4PCE A;  4O7C A;  3N9P A;  4WHU A;  4YAX A;  5D1L B;  4A4B A;  5EPS A;  5IGL A;  3L1Z B;  4NRC A;  4NS5 A;  3AAD A;  5EU1 A;  4F3I A;  2Y1N A;  5CUA A;  5DYC A;  4PTB A;  4F52 B;  1DVP A;  1U6G B;  4WZ0 A;  2K17 A;  3IU6 A;  4IOQ A;  2CKL A;  4QST A;  3JVM A;  5B76 A;  2JMD A;  3QZV A;  5DYU A;  5H1V A;  1JSP B;  4HXP A;  4NYV A;  1VYX A;  5D26 A;  4R8P K;  4QB3 A;  4NYX A;  4QR4 A;  2E7O A;  4A9E A;  4I7B A;  5A5S A;  2Y43 A;  4QF2 A;  4LRG A;  4MR4 A;  5EQ1 A;  2LQ6 A;  4O7E A;  4LJN A;  3L1X A;  2OO1 A;  4C66 A;  3O36 A;  4J1P A;  5IGK A;  2EGP A;  5I86 A;  2YQL A;  4YYJ A;  4LZ2 A;  4MEO A;  5EV9 A;  5D24 A;  3UV5 A;  3LQH A;  5DFB A;  5A82 A;  4HXK A;  5KTX A;  2YHO A;  4YAD A;  1CHC A;  5CQ6 A;  5EGU A;  3T7L A;  5E9L A;  2VNF A;  2LGG A;  1E4U A;  4GPJ A;  5B79 A;  5G4S A;  1XWH A;  4UP0 A;  4IC2 A;  4I7C A;  5DY7 A;  5HRX A;  4WZ2 A;  4KCX A;  4HXR A;  1HYJ A;  2L84 A;  5F2P A;  3JVL A;  4YBM A;  5DX4 A;  5F62 A;  1T1H A;  4YYH A;  4QNS A;  1K2F A;  4BJX A;  5EP7 A;  1WEQ A;  1N72 A;  4O74 A;  3LQJ A;  3QZS A;  5KU3 A;  4RVR A;  5A81 A;  4BW4 A;  4YYM A;  2MNY A;  4X3G A;  2YEM A;  2RNY A;  2YEK A;  3O35 A;  3UW9 A;  4YY4 A;  5DW1 A;  3PUQ A;  2ECI A;  5EIC A;  5IGN A;  2ECT A;  4XI1 A;  5FB1 A;  5A5Q A;  5FG5 A;  5FDZ A;  4IR5 A;  4FIP A;  4KV4 A;  5II2 A;  2CSY A;  5I89 A;  3UVY A;  4ALH A;  3ONI A;  5FG4 A;  3SVF A;  3U5P A;  2H0D B;  5L8T A;  5IBN A;  4NQM A;  4QSR A;  4MSX A;  5B75 A;  5LKX A;  2KRE A;  5E9Y A;  5CQA A;  5EA1 A;  5F3A A;  3ZNI A;  5HRV A;  4WZ3 B;  4XYA A;  4YYK A;  2K16 A;  2K4D A;  5F36 A;  5IID A;  5DIN A;  2YDW A;  4O7A A;  4GND A;  4UIU A;  1RMD A;  3DQV R;  4XY8 A;  3U5J A;  5EPB A;  2G6Q A;  5H9M A;  4ZC9 A;  4Q0O A;  4UYD A;  5ACY A;  5D3L A;  5KO4 A;  5TRB A;  1JM7 A;  5FFY A;  5LVQ A;  3O34 A;  5FE3 A;  4LAD B;  5TBN A;  4NUC A;  5FE5 A;  5B78 A;  5C89 A;  4S3O B;  3KV6 A;  4A9N A;  2XB1 A;  4A9M A;  3PHD A;  5B8D A;  3GG3 A;  2LV9 A;  4QC1 A;  4YK0 A;  3O37 A;  3L11 A;  2AN6 A;  4NR7 A;  4UYH A;  5HQ6 A;  4UYE A;  5F60 A;  4N4G A;  4QEW A;  4UIZ A;  2G4A A;  5F5Z A;  4A9H A;  5AME A;  3SOU A;  3HMF A;  2KWO A;  5HRW A;  3SOW A;  4HXM A;  2QIC A;  4NR5 A;  5DKC A;  1G25 A;  1HYI A;  4NXJ A;  4QY4 A;  3M62 A;  4QUU A;  2YT5 A;  2CT2 A;  5FER A;  4CLB A;  5FFW A;  4NR9 A;  3S92 A;  3LRQ A;  2JMI A;  5JWM A;  5C11 A;  1LDK C;  4TYL A;  4QSW A;  2LGK A;  3KV5 A;  4YYD A;  5E73 A;  4CL9 A;  5C13 A;  2M6M A;  2YQM A;  4UP5 A;  4LZS A;  4NR8 A;  2L0B A;  2VPB A;  2RNX A;  4TKP B;  4TQN A;  5D0C A;  5TCM A;  2E6R A;  2NXB A;  3MXF A;  4CCG X;  2C2L A;  4QR5 A;  3SVG A;  1LDJ B;  2M1R A;  4AVX A;  4XY9 A;  4J3I A;  4A9F A;  2CSZ A;  2OXQ C;  4NN2 A;  3T6R A;  4B86 C;  5KH7 A;  5EWC A;  4O72 A;  5LCW B;  2LN0 A;  4Z93 A;  4YYI A;  5A5R A;  5LJ0 A;  2MT5 A;  3ASL A;  4QSQ A;  2YW8 A;  4PS5 A;  5HEM A;  1IYM A;  3C5K A;  4LZR A;  2G43 A;  3O33 A;  3JVK A;  3O70 A;  4IR4 A;  1WEN A;  4O75 A;  5DLX A;  1BOR A;  4BHW A;  4N4I A;  5H85 A;  5ETB A;  3IU5 A;  4WIV A;  2RFJ A;  5CS8 A;  5FE8 A;  2YYR A;  5FH6 A;  4S3O C;  5G04 B;  3Q2F A;  4HBX A;  4QYD A;  2N9G A;  3I3J A;  5EK9 A;  2VPG A;  3PUR A;  4YY6 A;  4MEP A;  4NUD A;  3JVJ A;  4IOO A;  4UIX A;  2EA6 A;  2VJF B;  4L58 A;  5FEY A;  4IR6 A;  4MEQ A;  2DVR A;  2E7N A;  4UYG A;  2VPD A;  4OGI A;  3FKM X;  3FL2 A;  5KH9 A;  1WEM A;  3MUL A;  4HXO A;  2G45 A;  2JRJ A;  4LYW A;  2KWN A;  4TTE A;  5COI A;  5FE0 A;  3MUK A;  4FLP A;  4IOR A;  4R7E A;  5DKD A;  5ENJ A;  5ENB A;  4BBQ A;  1JOC A;  2YEL A;  5DBM A;  4A4C A;  2HYE D;  4HBY A;  3MQM A;  2RI7 A;  5E9V A;  4CUR A;  3GL6 A;  4IC3 A;  2IDA A;  2I8N A;  5A83 A;  2F6J A;  4Z6I A;  4W4U A;  2CKL B;  5FE4 A;  4TU6 A;  3LQI A;  4YC9 A;  2FSA A;  4GB0 A;  5FH8 A;  3N9O A;  3U5N A;  3SVH A;  5CGP A;  3M99 A;  4BW3 A;  4J0S A;  1X4I A;  2NAA A;  5AIU A;  4PY6 A;  5H1U A;  4N4H A;  2RNW A;  2R0V A;  5DKH A;  2L85 A;  2R10 A;  2DWW A;  2DX8 A;  5B77 A;  2DVS A;  2EOD A;  2D8S A;  5A5P A;  5F25 A;  4NR4 A;  5D7X A;  1WFK A;  1WIL A;  5LKT A;  5D1K B;  4QUT A;  5LKU A;  5CZG A;  3Q2E A;  2L75 A;  2MIQ A;  3RPG B;  5HFQ A;  5A85 A;  5LUU A;  4TZ2 A;  3ZVZ B;  5CQ4 A;  5FE7 A;  5AMF A;  4O70 A;  5D3T A;  3HTK C;  5EPR A;  5LKZ A;  4FO9 A;  2JMJ A;  2I7K A;  5FFV A;  3UVX A;  1Z60 A;  4A0C D;  4QSX A;  3ZPV E;  5IGM A;  4QEU A;  5F1H A;  2MA6 A;  4LC2 A;  4HBV A;  4HXS A;  3EB5 A;  4MR3 A;  5CUB A;  3ZPV 1;  1WUG A;  5E9M A;  5G0F A;  3RTR B;  2KR4 A;  5D25 A;  5D3H A;  2KWK A;  5CFW A;  5DFC A;  4UIV A;  5CUG A;  5CUC A;  2MUM A;  3TLP A;  4N4F A;  1ZBD B;  2MJV B;  4CUT A;  4Q6F A;  4ZUX U;  4Q0N A;  1X4U A;  5FG6 A;  5ENE A;  5C87 A;  4YBS A;  4O64 A;  4QSU A;  1JM7 B;  5C7N A;  4YH4 A;  3ZYU A;  5G4R A;  2F6N A;  2DVQ A;  2R0S A;  5CUD A;  5FE9 A;  3HCS A;  1FBV A;  3SOX A;  4LKA A;  4CUU A;  5BT3 A;  3GV4 A;  4OGJ A;  5HM0 A;  1WEO A;  5KHM A;  2YUC A;  5I80 A;  1WEU A;  2ECG A;  3V43 A;  1Z2Q A;  5EYA F;  5I88 A;  1WEW A;  5J3X A;  5HQ5 A;  2FUI A;  4NRA A;  4PKL A;  4A49 A;  3MHH A;  4N3W A;  5HQ7 A;  5TB6 A;  5HCL A;  1WES A;  4KV1 A;  5FBX A;  2RSD A;  3N9L A;  4E96 A;  5H1T A;  5L99 A;  2ZET C;  4BW1 A;  4B7Y C;  3O7A A;  3IHP A;  2MA5 A;  5KTW A;  1X0J A;  3S91 A;  5E3G A;  4YAT A;  3KQI A;  2QJ0 A;  3I2D A;  3HME A;  2ECV A;  3EB6 A;  1WEP A;  2LXP C;  3HMH A;  5ENH A;  4C67 A;  2R0Y A;  5G05 B;  5EM3 A;  5CQT A;  3K2J A;  4R2Y A;  4MEN A;  5I83 A;  3QZT A;  2ECW A;  4YAB A;  1F68 A;  2H0D A;  4ZW1 A;  3P1D A;  5J0D A;  2RS9 B;  2M3H A;  4GNG A;  4AKN A;  3SHB A;  5F61 A;  5I29 A;  2YSJ A;  4A9K A;  2LGV A;  5D3S A;  5K29 A;  5TDR A;  2WP1 A;  3DWY A;  3D7C A;  2Y1M A;  5E3D A;  5CQ8 A;  5E0R A;  5KTU A;  1VD4 A;  4O71 A;  3HCU A;  4NYW A;  4CFL A;  4TS8 A;  2KGI A;  4MVT A;  2RO1 A;  4QZS A;  5I7X A;  5L97 A;  2C2V S;  5I7Y A;  2LSP B;  1EQF A;  5E9I A;  5I1Q A;  2KFT A;  4BW2 A;  3U5K A;  2PNX A;  2KIZ A;  2YU4 A;  4WA6 A;  5F1L A;  5CQ7 A;  1WEE A;  4IR3 A;  4LYS A;  3ZYQ A;  4FJC A;  3P5O A;  5JI8 A;  2QIZ A;  3N9N A;  4UI9 B;  3P1E A;  5TDW A;  5HJC A;  4O7F A;  2F42 A;  4QEV A;  4FK5 A;  3U5L A;  5AIT A;  4NUE A;  3MB4 A;  2M85 A;  4HXN A;  4TT2 A;  3N9Q A;  4Z1S A;  2LDR A;  5JG6 A;  3AQA A;  3G0L A;  4AYC A;  2LGL A;  5BT5 A;  3NXB A;  4P5O B;  5EIS A;  3LXJ A;  2K1J A;  4NQN A;  4PCI A;  3C6W A;  1E6I A;  5ETD A;  4LLB A;  1ZS5 A;  5ENI A;  2YRE A;  5EVA A;  5EWH A;  4LDF A;  4QSS A;  4UIT A;  2L5E A;  4DON A;  4LR6 A;  5D3R A;  2KWJ A;  4CUQ A;  2WP2 A;  4ZDT A;  5C85 A;  4CA1 A;  3VK6 A;  4J0R A;  4HBW A;  4V3L C;  3RPG C;  2FUU A;  5DKA A;  5HFR A;  2VPE A;  4QSV A;  3MB3 A;  2YYN A;  5E7D A;  2LXH C;  4MR6 A;  5D3P A;  5L96 A;  5CQ5 A;  5CU8 A;  5CUE A;  4QF3 A;  3ZTG A;  4YH3 A;  5CQ3 A;  4A9J A;  2LRI C;  5IG6 A;  5II1 A;  2MD7 B;  3DPL R;  5HLS A;  4XUB A;  4LK9 A;  4UIY A;  5CP5 A;  5I40 A;  2YQD A;  2L43 A;  4O77 A;  4V3K C;  2D9E A;  4TZ8 A;  4XUA A;  4Z6H A;  5TAB A;  5ENF A;  2H60 A;  1WIM A;  4A9I A;  3LJW A;  4OUF A;  1WUM A;  5A7C A;  4TU4 A;  3DAI A;  5FB0 A;  4YYN A;  4Z1Q A;  2KE1 A;  4GNF A;  2VJE B;  4MR5 A;  5EWV A;  4Y03 A;  1VFY A;  5CY9 A;  4O78 A;  2OUO A;  2D82 A;  5LJ1 A;  4TT6 A;  5DLZ A;  5AD2 A;  2YHN A;  4YYG A;  4UYF A;  2I50 A;  3NG2 A;  2UZG A;  5I3L A;  4QYL A;  4AP4 A;  4UYF B;  2E6S A;  5C4Q A;  5E74 A;  3UV4 A;  3RCW A;  5A5O A;  4A9O A;  2E3K A;  4QSP A;  5CRZ A;  2ECJ A;  5E9K A;  5FE1 A;  4ALG A;  4CUP A;  4O7B A;  5DFD A;  5ENG A;  3P1F A;  2KGG A;  4TT4 A;  5CTL A;  4A9L A;  1FP0 A;  1Z6U A;  1MM2 A;  2BAY A;  5DW2 A;  3MHS A;  4NRB A;  1F62 A;  4WHW A;  4QC3 A;  5D3J A;  5L98 A;  3U5M A;  3UVD A;  4PPE A;  1N87 A;  4AYC B;  2GRC A;  4L7X A;  5LVR A;  2DKW A;  5CRM A;  2MNZ A;  3N9M A;  4O76 A;  3P1C A;  3HCT A;  2VJF A;  5DYX A;  4X2I A;  5AD3 A;  1MM3 A;  5ENC A;  5FH7 A;  1WGM A;  4NR6 A;  5FE2 A;  3UVW A;  2DVV A;  5HEN A;  2HDP A;  3ZVY A;  3G0J A;  5HEL A;  4AUQ B;  4QBM A;  2L5U A;  2VJE A;  2YSM A;  5EI4 A;  2KTB B;  4LYI A;  4I7D A;  2VP7 A;  2KU3 A;  5CPE A;  4CFK A;  1JM4 B;  5BT4 A;  1WE9 A;  5D3N A;  3M63 A;  2MD8 C;  4CUS A;  1V87 A;  1X4J A;  4QR3 A;  2OSS A;  2XEU A;  2YUR A;  2L80 A;  3KNV A;  5FE6 A;  2YW5 A;  5LJ2 A;  2KYU A;  5F63 A;  5D1M B;  5L8U A;  4GNE A;  5A5N A;  1WEV A;  4C9Z A;  3U5O A;  5C8G A;  4HXL A;  5EWD A;  2PUY A;  5DYA A; 
#chains in the Genus database with same CATH topology
 5KH3 A;  2DAT A;  3UV2 A;  3D1D A;  2CRW A;  4UIW A;  4ZQL A;  5EWW A;  4YBT A;  2ECN A;  4PCE A;  4O7C A;  3N9P A;  4WHU A;  4YAX A;  5D1L B;  4A4B A;  5EPS A;  5IGL A;  3L1Z B;  4NRC A;  4NS5 A;  3AAD A;  5EU1 A;  4F3I A;  2Y1N A;  5CUA A;  5DYC A;  3O47 A;  4PTB A;  4F52 B;  1DVP A;  1U6G B;  4WZ0 A;  2K17 A;  4Z0R A;  3IU6 A;  4IOQ A;  2CKL A;  4QST A;  3JVM A;  5B76 A;  2JMD A;  3QZV A;  5DYU A;  5H1V A;  1JSP B;  4HXP A;  4NYV A;  1VYX A;  5D26 A;  4R8P K;  4QB3 A;  4NYX A;  4QR4 A;  2E7O A;  4A9E A;  4I7B A;  5A5S A;  2Y43 A;  4QF2 A;  4LRG A;  4MR4 A;  5EQ1 A;  2LQ6 A;  4O7E A;  4LJN A;  3M7K A;  3L1X A;  2OO1 A;  4C66 A;  3O36 A;  4J1P A;  5IGK A;  2EGP A;  5I86 A;  2YQL A;  4YYJ A;  4LZ2 A;  4MEO A;  5EV9 A;  2CRR A;  5D24 A;  3UV5 A;  3LQH A;  5DFB A;  5A82 A;  4HXK A;  5KTX A;  2YHO A;  3FJU B;  3LJU X;  4YAD A;  1CHC A;  5CQ6 A;  2L7P A;  5EGU A;  3T7L A;  5E9L A;  2VNF A;  2LGG A;  1E4U A;  4GPJ A;  5B79 A;  5G4S A;  1XWH A;  4UP0 A;  2JUN A;  4IC2 A;  4I7C A;  5DY7 A;  5HRX A;  4WZ2 A;  4KCX A;  4HXR A;  1HYJ A;  2L84 A;  5F2P A;  3JVL A;  4YBM A;  5DX4 A;  5F62 A;  1T1H A;  4YYH A;  3FAO A;  4QNS A;  1K2F A;  4BJX A;  5EP7 A;  1WEQ A;  1N72 A;  4O74 A;  5SVI A;  3LQJ A;  3QZS A;  5KU3 A;  4RVR A;  5A81 A;  4BW4 A;  4YYM A;  2MNY A;  2XOZ A;  4X3G A;  2YEM A;  2RNY A;  2YEK A;  3O35 A;  3UW9 A;  4YY4 A;  5DW1 A;  3PUQ A;  2ECI A;  2KKX A;  5EIC A;  5IGN A;  2ECT A;  4XI1 A;  3T9K A;  5FB1 A;  5A5Q A;  5FG5 A;  5FDZ A;  4IR5 A;  4FIP A;  4KV4 A;  5II2 A;  4H9D A;  2CSY A;  5I89 A;  3UVY A;  4ALH A;  3ONI A;  5FG4 A;  3SVF A;  3U5P A;  2H0D B;  5L8T A;  5IBN A;  4NQM A;  4QSR A;  4MSX A;  5B75 A;  5LKX A;  2KRE A;  5E9Y A;  5CQA A;  5EA1 A;  5F3A A;  3ZNI A;  5HRV A;  4WZ3 B;  4XYA A;  4YYK A;  2K16 A;  2K4D A;  2YVR A;  5F36 A;  3KDE C;  5IID A;  5DIN A;  2YDW A;  4O7A A;  4GND A;  4UIU A;  1RMD A;  3DQV R;  4XY8 A;  3U5J A;  3JUE A;  5EPB A;  2G6Q A;  5H9M A;  1DCQ A;  4ZC9 A;  4Q0O A;  4UYD A;  5ACY A;  5D3L A;  5KO4 A;  5TRB A;  1JM7 A;  5FFY A;  5LVQ A;  3O34 A;  5FE3 A;  3FEH A;  4LAD B;  4NUC A;  5FE5 A;  5TBN A;  5B78 A;  5C89 A;  4S3O B;  3KV6 A;  4A9N A;  2XB1 A;  4A9M A;  3PHD A;  5B8D A;  3GG3 A;  2LV9 A;  2JM3 A;  4QC1 A;  2E61 A;  4YK0 A;  3O37 A;  3Q1D A;  3L11 A;  2AN6 A;  4NR7 A;  4UYH A;  5HQ6 A;  4UYE A;  5F60 A;  4N4G A;  4QEW A;  4UIZ A;  2G4A A;  5F5Z A;  4A9H A;  5AME A;  3SOU A;  3HMF A;  2KWO A;  5HRW A;  3SOW A;  4HXM A;  2QIC A;  4NR5 A;  5DKC A;  1G25 A;  1HYI A;  4NXJ A;  4QY4 A;  2XP0 A;  3M62 A;  4QUU A;  2YT5 A;  2CT2 A;  5FER A;  4CLB A;  5FFW A;  4NR9 A;  3S92 A;  3LRQ A;  2JMI A;  5JWM A;  5C11 A;  1LDK C;  4TYL A;  4QSW A;  2LGK A;  3KV5 A;  4YYD A;  5E73 A;  4CL9 A;  5C13 A;  2M6M A;  2YQM A;  2DSM A;  4UP5 A;  4AKI A;  4LZS A;  4IC3 A;  2RR4 A;  4NR8 A;  2L0B A;  2VPB A;  2RNX A;  4TKP B;  4TQN A;  5D0C A;  5TCM A;  3LVR E;  2E6R A;  2NXB A;  3MXF A;  4CCG X;  2C2L A;  4QR5 A;  3SVG A;  1LDJ B;  2M1R A;  4AVX A;  4XY9 A;  4J3I A;  4A9F A;  2CSZ A;  2OXQ C;  4NN2 A;  3T6R A;  4B86 C;  5KH7 A;  5EWC A;  4O72 A;  5LCW B;  2LN0 A;  4Z93 A;  4YYI A;  5A5R A;  5LJ0 A;  2MT5 A;  3ASL A;  4QSQ A;  2YW8 A;  4PS5 A;  5HEM A;  1IYM A;  3C5K A;  4LZR A;  2G43 A;  3O33 A;  3JVK A;  3O70 A;  4IR4 A;  1WEN A;  4O75 A;  5DLX A;  1BOR A;  4BHW A;  4N4I A;  5H85 A;  5ETB A;  3IU5 A;  4WIV A;  4AKH A;  2RFJ A;  5CS8 A;  5FE8 A;  2YYR A;  5FH6 A;  4S3O C;  5G04 B;  3Q2F A;  4HBX A;  4QYD A;  2N9G A;  4O62 A;  3I3J A;  5EK9 A;  2VPG A;  3PUR A;  4YY6 A;  4MEP A;  4NUD A;  3JVJ A;  4IOO A;  4UIX A;  3VKG A;  2EA6 A;  2VJF B;  4L58 A;  2IQJ A;  5FEY A;  4IR6 A;  4MEQ A;  2DVR A;  2E7N A;  4UYG A;  2VPD A;  4OGI A;  3FKM X;  3FL2 A;  5KH9 A;  1WEM A;  3MUL A;  4HXO A;  2G45 A;  2JRJ A;  4LYW A;  2KWN A;  3LDY A;  4TTE A;  5COI A;  5FE0 A;  3MUK A;  4FLP A;  4IOR A;  2LAU A;  4R7E A;  5DKD A;  5ENJ A;  5ENB A;  2EXU A;  4BBQ A;  1JOC A;  5K3Q A;  2YEL A;  5DBM A;  4A4C A;  2HYE D;  4HBY A;  3MQM A;  3FAN A;  2RI7 A;  5E9V A;  4CUR A;  3DWD A;  3GL6 A;  2IDA A;  2I8N A;  5A83 A;  2F6J A;  4Z6I A;  4W4U A;  2CKL B;  5FE4 A;  4TU6 A;  3LQI A;  4YC9 A;  3D1B A;  2FSA A;  4GB0 A;  4QQ4 A;  5FH8 A;  3N9O A;  3U5N A;  3SVH A;  2XOY A;  5CGP A;  3M99 A;  4BW3 A;  4J0S A;  1X4I A;  2NAA A;  5AIU A;  4PY6 A;  5H1U A;  4N4H A;  2EGM A;  4AI6 A;  2RNW A;  5SVX A;  2R0V A;  5DKH A;  2L85 A;  2R10 A;  2DWW A;  2DX8 A;  5B77 A;  2DVS A;  2EOD A;  2D8S A;  5A5P A;  5F25 A;  4NR4 A;  5D7X A;  1WFK A;  1WIL A;  2D8U A;  5LKT A;  5D1K B;  4QUT A;  3PLW A;  5LKU A;  5CZG A;  3Q2E A;  2L75 A;  2MIQ A;  3RPG B;  5HFQ A;  5A85 A;  5LUU A;  4TZ2 A;  3ZVZ B;  5CQ4 A;  5FE7 A;  5AMF A;  4O70 A;  5D3T A;  3HTK C;  5EPR A;  5LKZ A;  4FO9 A;  2JMJ A;  2I7K A;  5FFV A;  3UVX A;  1Z60 A;  4A0C D;  4QSX A;  3ZPV E;  5IGM A;  4QEU A;  5F1H A;  3ERR A;  2MA6 A;  4LC2 A;  4HBV A;  4HXS A;  3EB5 A;  2CSV A;  4MR3 A;  5CUB A;  3ZPV 1;  1WUG A;  5E9M A;  5G0F A;  3RTR B;  2KR4 A;  5D25 A;  5D3H A;  2KWK A;  5CFW A;  5DFC A;  4UIV A;  5CUG A;  5CUC A;  2MUM A;  1PUO A;  4N4F A;  3TLP A;  1ZBD B;  2MJV B;  4CUT A;  4Q6F A;  2MKE A;  4ZUX U;  4Q0N A;  1X4U A;  5FG6 A;  5ENE A;  5C87 A;  4YBS A;  4O64 A;  4QSU A;  1JM7 B;  5C7N A;  4YH4 A;  3ZYU A;  5G4R A;  2F6N A;  2DVQ A;  2R0S A;  5CUD A;  5FE9 A;  3HCS A;  1FBV A;  3SOX A;  4LKA A;  4CUU A;  5BT3 A;  3GV4 A;  4OGJ A;  5HM0 A;  1WEO A;  5KHM A;  2FD4 A;  2YUC A;  5I80 A;  1WEU A;  2ECG A;  3V43 A;  1Z2Q A;  5EYA F;  5I88 A;  1WEW A;  5J3X A;  5HQ5 A;  2FUI A;  4NRA A;  4PKL A;  4A49 A;  3MHH A;  4N3W A;  5HQ7 A;  5TB6 A;  5HCL A;  1WES A;  4KV1 A;  5FBX A;  2RSD A;  3N9L A;  4E96 A;  5H1T A;  5L99 A;  2ZET C;  4BW1 A;  4B7Y C;  3O7A A;  3IHP A;  2MA5 A;  5KTW A;  1X0J A;  3S91 A;  5E3G A;  4YAT A;  3KQI A;  3E2D A;  2QJ0 A;  3I2D A;  4Z0O A;  3HME A;  2ECV A;  3EB6 A;  1WEP A;  2LXP C;  3HMH A;  5ENH A;  4C67 A;  2R0Y A;  5G05 B;  5EM3 A;  5CQT A;  3K2J A;  4R2Y A;  4MEN A;  2FFW A;  5I83 A;  3QZT A;  2ECW A;  4YAB A;  1F68 A;  2H0D A;  4ZW1 A;  3P1D A;  5J0D A;  2RS9 B;  2M3H A;  4GNG A;  4AKN A;  3SHB A;  5F61 A;  5I29 A;  2YSJ A;  4A9K A;  2LGV A;  3VKH A;  5D3S A;  5K29 A;  5TDR A;  2WP1 A;  3DWY A;  2XOC A;  3D7C A;  2Y1M A;  5E3D A;  5CQ8 A;  5E0R A;  5KTU A;  1VD4 A;  4O71 A;  3HCU A;  4NYW A;  4CFL A;  4TS8 A;  2KGI A;  3LVQ E;  3MDB C;  4MVT A;  2RO1 A;  4QZS A;  5I7X A;  5L97 A;  2C2V S;  5I7Y A;  2LSP B;  1EQF A;  5E9I A;  5I1Q A;  2KFT A;  2OWA A;  4BW2 A;  3U5K A;  2PNX A;  2KIZ A;  2YU4 A;  4WA6 A;  5F1L A;  5CQ7 A;  1WEE A;  4IR3 A;  4LYS A;  3ZYQ A;  4FJC A;  3P5O A;  5JI8 A;  2DJA A;  2QIZ A;  3N9N A;  5SVI B;  4UI9 B;  3P1E A;  5TDW A;  5HJC A;  4O7F A;  2F42 A;  4QEV A;  4FK5 A;  3U5L A;  2KKY A;  5AIT A;  4NUE A;  2EJN A;  4OGC A;  3MB4 A;  2M85 A;  4HXN A;  4TT2 A;  1MBM A;  3N9Q A;  4F1P A;  4Z1S A;  2LDR A;  5JG6 A;  3AQA A;  5SVY A;  3G0L A;  4AYC A;  2LGL A;  5BT5 A;  3NXB A;  4P5O B;  5EIS A;  3LXJ A;  2K1J A;  4NQN A;  4PCI A;  3C6W A;  3FM8 C;  1E6I A;  5ETD A;  4LLB A;  1ZS5 A;  5ENI A;  2YRE A;  5EVA A;  5EWH A;  4LDF A;  4QSS A;  4UIT A;  2L5E A;  4DON A;  4LR6 A;  5D3R A;  2KWJ A;  4CUQ A;  2WP2 A;  4ZDT A;  5C85 A;  2M13 A;  4CA1 A;  3VK6 A;  4J0R A;  4HBW A;  4V3L C;  3RPG C;  2FUU A;  5DKA A;  5HFR A;  2VPE A;  4QSV A;  2YYN A;  3MB3 A;  5E7D A;  2LXH C;  4MR6 A;  5D3P A;  5L96 A;  5CQ5 A;  5CU8 A;  5CUE A;  2P57 A;  4QF3 A;  3ZTG A;  4YH3 A;  5CQ3 A;  4A9J A;  2LRI C;  5IG6 A;  5II1 A;  2MD7 B;  3DPL R;  5HLS A;  4XUB A;  4LK9 A;  4UIY A;  5CP5 A;  5I40 A;  2YQD A;  2L43 A;  4O77 A;  4V3K C;  2D9E A;  4TZ8 A;  4XUA A;  2CON A;  3H7H A;  4Z6H A;  5TAB A;  5ENF A;  2H60 A;  1WIM A;  4A9I A;  3LJW A;  4OUF A;  1WUM A;  5A7C A;  4TU4 A;  3DAI A;  5FB0 A;  4YYN A;  4Z1Q A;  2KE1 A;  4GNF A;  2VJE B;  4MR5 A;  5EWV A;  4Y03 A;  1VFY A;  5CY9 A;  4O78 A;  2OUO A;  2D82 A;  5LJ1 A;  4TT6 A;  5DLZ A;  5AD2 A;  2YHN A;  4YYG A;  4UYF A;  2I50 A;  3NG2 A;  2UZG A;  1ZKR A;  5I3L A;  4QYL A;  4AP4 A;  4UYF B;  2E6S A;  5C4Q A;  5E74 A;  3UV4 A;  3RCW A;  5A5O A;  4A9O A;  2E3K A;  4QSP A;  5CRZ A;  2ECJ A;  5E9K A;  5FE1 A;  4ALG A;  4CUP A;  4O7B A;  5DFD A;  5ENG A;  3P1F A;  2KGG A;  4TT4 A;  5CTL A;  4A9L A;  1FP0 A;  1Z6U A;  1MM2 A;  2BAY A;  5DW2 A;  3MHS A;  4NRB A;  1F62 A;  4WHW A;  4QC3 A;  5D3J A;  5L98 A;  3U5M A;  3UVD A;  2B0O E;  4PPE A;  1N87 A;  4AYC B;  2GRC A;  4L7X A;  5LVR A;  2DKW A;  5CRM A;  2MNZ A;  3N9M A;  4O76 A;  3P1C A;  3HCT A;  2VJF A;  5DYX A;  4X2I A;  5AD3 A;  1MM3 A;  4OGE A;  5ENC A;  5FH7 A;  1WGM A;  4NR6 A;  5FE2 A;  3UVW A;  2DVV A;  5HEN A;  2HDP A;  3ZVY A;  3G0J A;  5HEL A;  4AUQ B;  4QBM A;  2L5U A;  2VJE A;  2YSM A;  5EI4 A;  2KTB B;  4LYI A;  4I7D A;  2VP7 A;  2KU3 A;  5CPE A;  4CFK A;  1JM4 B;  5BT4 A;  1WE9 A;  5D3N A;  3DDT A;  3M63 A;  2MD8 C;  4CUS A;  1V87 A;  1X4J A;  4QR3 A;  2OSS A;  2XEU A;  2YUR A;  2L80 A;  3KNV A;  5FE6 A;  4AKG A;  2YW5 A;  5LJ2 A;  2KYU A;  5F63 A;  5D1M B;  5L8U A;  3SUB A;  4GNE A;  5A5N A;  1WEV A;  4C9Z A;  3U5O A;  5C8G A;  4HXL A;  5EWD A;  2PUY A;  5DYA A; 
#chains in the Genus database with same CATH homology
 5KH3 A;  2DAT A;  3UV2 A;  4UIW A;  4ZQL A;  5EWW A;  4YBT A;  2ECN A;  4PCE A;  4O7C A;  3N9P A;  4WHU A;  4YAX A;  5D1L B;  4A4B A;  5EPS A;  5IGL A;  3L1Z B;  4NRC A;  4NS5 A;  3AAD A;  5EU1 A;  4F3I A;  2Y1N A;  5CUA A;  5DYC A;  4PTB A;  4F52 B;  1DVP A;  1U6G B;  4WZ0 A;  2K17 A;  3IU6 A;  4IOQ A;  2CKL A;  4QST A;  3JVM A;  5B76 A;  2JMD A;  3QZV A;  5DYU A;  5H1V A;  1JSP B;  4HXP A;  4NYV A;  1VYX A;  5D26 A;  4R8P K;  4QB3 A;  4NYX A;  4QR4 A;  2E7O A;  4A9E A;  4I7B A;  5A5S A;  2Y43 A;  4QF2 A;  4LRG A;  4MR4 A;  5EQ1 A;  2LQ6 A;  4O7E A;  4LJN A;  3L1X A;  2OO1 A;  4C66 A;  3O36 A;  4J1P A;  5IGK A;  2EGP A;  5I86 A;  2YQL A;  4YYJ A;  4LZ2 A;  4MEO A;  5EV9 A;  5D24 A;  3UV5 A;  3LQH A;  5DFB A;  5A82 A;  4HXK A;  5KTX A;  2YHO A;  4YAD A;  1CHC A;  5CQ6 A;  5EGU A;  3T7L A;  5E9L A;  2VNF A;  2LGG A;  1E4U A;  4GPJ A;  5B79 A;  5G4S A;  1XWH A;  4UP0 A;  4IC2 A;  4I7C A;  5DY7 A;  5HRX A;  4WZ2 A;  4KCX A;  4HXR A;  1HYJ A;  2L84 A;  5F2P A;  3JVL A;  4YBM A;  5DX4 A;  5F62 A;  1T1H A;  4YYH A;  4QNS A;  1K2F A;  4BJX A;  5EP7 A;  1WEQ A;  1N72 A;  4O74 A;  3LQJ A;  3QZS A;  5KU3 A;  4RVR A;  5A81 A;  4BW4 A;  4YYM A;  2MNY A;  4X3G A;  2YEM A;  2RNY A;  2YEK A;  3O35 A;  3UW9 A;  4YY4 A;  5DW1 A;  3PUQ A;  2ECI A;  5EIC A;  5IGN A;  2ECT A;  4XI1 A;  5FB1 A;  5A5Q A;  5FG5 A;  5FDZ A;  4IR5 A;  4FIP A;  4KV4 A;  5II2 A;  2CSY A;  5I89 A;  3UVY A;  4ALH A;  3ONI A;  5FG4 A;  3SVF A;  3U5P A;  2H0D B;  5L8T A;  5IBN A;  4NQM A;  4QSR A;  4MSX A;  5B75 A;  5LKX A;  2KRE A;  5E9Y A;  5CQA A;  5EA1 A;  5F3A A;  3ZNI A;  5HRV A;  4WZ3 B;  4XYA A;  4YYK A;  2K16 A;  2K4D A;  5F36 A;  5IID A;  5DIN A;  2YDW A;  4O7A A;  4GND A;  4UIU A;  1RMD A;  3DQV R;  4XY8 A;  3U5J A;  5EPB A;  2G6Q A;  5H9M A;  4ZC9 A;  4Q0O A;  4UYD A;  5ACY A;  5D3L A;  5KO4 A;  5TRB A;  1JM7 A;  5FFY A;  5LVQ A;  3O34 A;  5FE3 A;  4LAD B;  5TBN A;  4NUC A;  5FE5 A;  5B78 A;  5C89 A;  4S3O B;  3KV6 A;  4A9N A;  2XB1 A;  4A9M A;  3PHD A;  5B8D A;  3GG3 A;  2LV9 A;  4QC1 A;  4YK0 A;  3O37 A;  3L11 A;  2AN6 A;  4NR7 A;  4UYH A;  5HQ6 A;  4UYE A;  5F60 A;  4N4G A;  4QEW A;  4UIZ A;  2G4A A;  5F5Z A;  4A9H A;  5AME A;  3SOU A;  3HMF A;  2KWO A;  5HRW A;  3SOW A;  4HXM A;  2QIC A;  4NR5 A;  5DKC A;  1G25 A;  1HYI A;  4NXJ A;  4QY4 A;  3M62 A;  4QUU A;  2YT5 A;  2CT2 A;  5FER A;  4CLB A;  5FFW A;  4NR9 A;  3S92 A;  3LRQ A;  2JMI A;  5JWM A;  5C11 A;  1LDK C;  4TYL A;  4QSW A;  2LGK A;  3KV5 A;  4YYD A;  5E73 A;  4CL9 A;  5C13 A;  2M6M A;  2YQM A;  4UP5 A;  4LZS A;  4NR8 A;  2L0B A;  2VPB A;  2RNX A;  4TKP B;  4TQN A;  5D0C A;  5TCM A;  2E6R A;  2NXB A;  3MXF A;  4CCG X;  2C2L A;  4QR5 A;  3SVG A;  1LDJ B;  2M1R A;  4AVX A;  4XY9 A;  4J3I A;  4A9F A;  2CSZ A;  2OXQ C;  4NN2 A;  3T6R A;  4B86 C;  5KH7 A;  5EWC A;  4O72 A;  5LCW B;  2LN0 A;  4Z93 A;  4YYI A;  5A5R A;  5LJ0 A;  2MT5 A;  3ASL A;  4QSQ A;  2YW8 A;  4PS5 A;  5HEM A;  1IYM A;  3C5K A;  4LZR A;  2G43 A;  3O33 A;  3JVK A;  3O70 A;  4IR4 A;  1WEN A;  4O75 A;  5DLX A;  1BOR A;  4BHW A;  4N4I A;  5H85 A;  5ETB A;  3IU5 A;  4WIV A;  2RFJ A;  5CS8 A;  5FE8 A;  2YYR A;  5FH6 A;  4S3O C;  5G04 B;  3Q2F A;  4HBX A;  4QYD A;  2N9G A;  3I3J A;  5EK9 A;  2VPG A;  3PUR A;  4YY6 A;  4MEP A;  4NUD A;  3JVJ A;  4IOO A;  4UIX A;  2EA6 A;  2VJF B;  4L58 A;  5FEY A;  4IR6 A;  4MEQ A;  2DVR A;  2E7N A;  4UYG A;  2VPD A;  4OGI A;  3FKM X;  3FL2 A;  5KH9 A;  1WEM A;  3MUL A;  4HXO A;  2G45 A;  2JRJ A;  4LYW A;  2KWN A;  4TTE A;  5COI A;  5FE0 A;  3MUK A;  4FLP A;  4IOR A;  4R7E A;  5DKD A;  5ENJ A;  5ENB A;  4BBQ A;  1JOC A;  2YEL A;  5DBM A;  4A4C A;  2HYE D;  4HBY A;  3MQM A;  2RI7 A;  5E9V A;  4CUR A;  3GL6 A;  4IC3 A;  2IDA A;  2I8N A;  5A83 A;  2F6J A;  4Z6I A;  4W4U A;  2CKL B;  5FE4 A;  4TU6 A;  3LQI A;  4YC9 A;  2FSA A;  4GB0 A;  5FH8 A;  3N9O A;  3U5N A;  3SVH A;  5CGP A;  3M99 A;  4BW3 A;  4J0S A;  1X4I A;  2NAA A;  5AIU A;  4PY6 A;  5H1U A;  4N4H A;  2RNW A;  2R0V A;  5DKH A;  2L85 A;  2R10 A;  2DWW A;  2DX8 A;  5B77 A;  2DVS A;  2EOD A;  2D8S A;  5A5P A;  5F25 A;  4NR4 A;  5D7X A;  1WFK A;  1WIL A;  5LKT A;  5D1K B;  4QUT A;  5LKU A;  5CZG A;  3Q2E A;  2L75 A;  2MIQ A;  3RPG B;  5HFQ A;  5A85 A;  5LUU A;  4TZ2 A;  3ZVZ B;  5CQ4 A;  5FE7 A;  5AMF A;  4O70 A;  5D3T A;  3HTK C;  5EPR A;  5LKZ A;  4FO9 A;  2JMJ A;  2I7K A;  5FFV A;  3UVX A;  1Z60 A;  4A0C D;  4QSX A;  3ZPV E;  5IGM A;  4QEU A;  5F1H A;  2MA6 A;  4LC2 A;  4HBV A;  4HXS A;  3EB5 A;  4MR3 A;  5CUB A;  3ZPV 1;  1WUG A;  5E9M A;  5G0F A;  3RTR B;  2KR4 A;  5D25 A;  5D3H A;  2KWK A;  5CFW A;  5DFC A;  4UIV A;  5CUG A;  5CUC A;  2MUM A;  3TLP A;  4N4F A;  1ZBD B;  2MJV B;  4CUT A;  4Q6F A;  4ZUX U;  4Q0N A;  1X4U A;  5FG6 A;  5ENE A;  5C87 A;  4YBS A;  4O64 A;  4QSU A;  1JM7 B;  5C7N A;  4YH4 A;  3ZYU A;  5G4R A;  2F6N A;  2DVQ A;  2R0S A;  5CUD A;  5FE9 A;  3HCS A;  1FBV A;  3SOX A;  4LKA A;  4CUU A;  5BT3 A;  3GV4 A;  4OGJ A;  5HM0 A;  1WEO A;  5KHM A;  2YUC A;  5I80 A;  1WEU A;  2ECG A;  3V43 A;  1Z2Q A;  5EYA F;  5I88 A;  1WEW A;  5J3X A;  5HQ5 A;  2FUI A;  4NRA A;  4PKL A;  4A49 A;  3MHH A;  4N3W A;  5HQ7 A;  5TB6 A;  5HCL A;  1WES A;  4KV1 A;  5FBX A;  2RSD A;  3N9L A;  4E96 A;  5H1T A;  5L99 A;  2ZET C;  4BW1 A;  4B7Y C;  3O7A A;  3IHP A;  2MA5 A;  5KTW A;  1X0J A;  3S91 A;  5E3G A;  4YAT A;  3KQI A;  2QJ0 A;  3I2D A;  3HME A;  2ECV A;  3EB6 A;  1WEP A;  2LXP C;  3HMH A;  5ENH A;  4C67 A;  2R0Y A;  5G05 B;  5EM3 A;  5CQT A;  3K2J A;  4R2Y A;  4MEN A;  5I83 A;  3QZT A;  2ECW A;  4YAB A;  1F68 A;  2H0D A;  4ZW1 A;  3P1D A;  5J0D A;  2RS9 B;  2M3H A;  4GNG A;  4AKN A;  3SHB A;  5F61 A;  5I29 A;  2YSJ A;  4A9K A;  2LGV A;  5D3S A;  5K29 A;  5TDR A;  2WP1 A;  3DWY A;  3D7C A;  2Y1M A;  5E3D A;  5CQ8 A;  5E0R A;  5KTU A;  1VD4 A;  4O71 A;  3HCU A;  4NYW A;  4CFL A;  4TS8 A;  2KGI A;  4MVT A;  2RO1 A;  4QZS A;  5I7X A;  5L97 A;  2C2V S;  5I7Y A;  2LSP B;  1EQF A;  5E9I A;  5I1Q A;  2KFT A;  4BW2 A;  3U5K A;  2PNX A;  2KIZ A;  2YU4 A;  4WA6 A;  5F1L A;  5CQ7 A;  1WEE A;  4IR3 A;  4LYS A;  3ZYQ A;  4FJC A;  3P5O A;  5JI8 A;  2QIZ A;  3N9N A;  4UI9 B;  3P1E A;  5TDW A;  5HJC A;  4O7F A;  2F42 A;  4QEV A;  4FK5 A;  3U5L A;  5AIT A;  4NUE A;  3MB4 A;  2M85 A;  4HXN A;  4TT2 A;  3N9Q A;  4Z1S A;  2LDR A;  5JG6 A;  3AQA A;  3G0L A;  4AYC A;  2LGL A;  5BT5 A;  3NXB A;  4P5O B;  5EIS A;  3LXJ A;  2K1J A;  4NQN A;  4PCI A;  3C6W A;  1E6I A;  5ETD A;  4LLB A;  1ZS5 A;  5ENI A;  2YRE A;  5EVA A;  5EWH A;  4LDF A;  4QSS A;  4UIT A;  2L5E A;  4DON A;  4LR6 A;  5D3R A;  2KWJ A;  4CUQ A;  2WP2 A;  4ZDT A;  5C85 A;  4CA1 A;  3VK6 A;  4J0R A;  4HBW A;  4V3L C;  3RPG C;  2FUU A;  5DKA A;  5HFR A;  2VPE A;  4QSV A;  3MB3 A;  2YYN A;  5E7D A;  2LXH C;  4MR6 A;  5D3P A;  5L96 A;  5CQ5 A;  5CU8 A;  5CUE A;  4QF3 A;  3ZTG A;  4YH3 A;  5CQ3 A;  4A9J A;  2LRI C;  5IG6 A;  5II1 A;  2MD7 B;  3DPL R;  5HLS A;  4XUB A;  4LK9 A;  4UIY A;  5CP5 A;  5I40 A;  2YQD A;  2L43 A;  4O77 A;  4V3K C;  2D9E A;  4TZ8 A;  4XUA A;  4Z6H A;  5TAB A;  5ENF A;  2H60 A;  1WIM A;  4A9I A;  3LJW A;  4OUF A;  1WUM A;  5A7C A;  4TU4 A;  3DAI A;  5FB0 A;  4YYN A;  4Z1Q A;  2KE1 A;  4GNF A;  2VJE B;  4MR5 A;  5EWV A;  4Y03 A;  1VFY A;  5CY9 A;  4O78 A;  2OUO A;  2D82 A;  5LJ1 A;  4TT6 A;  5DLZ A;  5AD2 A;  2YHN A;  4YYG A;  4UYF A;  2I50 A;  3NG2 A;  2UZG A;  5I3L A;  4QYL A;  4AP4 A;  4UYF B;  2E6S A;  5C4Q A;  5E74 A;  3UV4 A;  3RCW A;  5A5O A;  4A9O A;  2E3K A;  4QSP A;  5CRZ A;  2ECJ A;  5E9K A;  5FE1 A;  4ALG A;  4CUP A;  4O7B A;  5DFD A;  5ENG A;  3P1F A;  2KGG A;  4TT4 A;  5CTL A;  4A9L A;  1FP0 A;  1Z6U A;  1MM2 A;  2BAY A;  5DW2 A;  3MHS A;  4NRB A;  1F62 A;  4WHW A;  4QC3 A;  5D3J A;  5L98 A;  3U5M A;  3UVD A;  4PPE A;  1N87 A;  4AYC B;  2GRC A;  4L7X A;  5LVR A;  2DKW A;  5CRM A;  2MNZ A;  3N9M A;  4O76 A;  3P1C A;  3HCT A;  2VJF A;  5DYX A;  4X2I A;  5AD3 A;  1MM3 A;  5ENC A;  5FH7 A;  1WGM A;  4NR6 A;  5FE2 A;  3UVW A;  2DVV A;  5HEN A;  2HDP A;  3ZVY A;  3G0J A;  5HEL A;  4AUQ B;  4QBM A;  2L5U A;  2VJE A;  2YSM A;  5EI4 A;  2KTB B;  4LYI A;  4I7D A;  2VP7 A;  2KU3 A;  5CPE A;  4CFK A;  1JM4 B;  5BT4 A;  1WE9 A;  5D3N A;  3M63 A;  2MD8 C;  4CUS A;  1V87 A;  1X4J A;  4QR3 A;  2OSS A;  2XEU A;  2YUR A;  2L80 A;  3KNV A;  5FE6 A;  2YW5 A;  5LJ2 A;  2KYU A;  5F63 A;  5D1M B;  5L8U A;  4GNE A;  5A5N A;  1WEV A;  4C9Z A;  3U5O A;  5C8G A;  4HXL A;  5EWD A;  2PUY A;  5DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...